{
  "schema_version": 1,
  "source_compilation_context": {
    "mi": {
      "attribution": {
        "inventory": {
          "name": "Compute Atlas",
          "creator": "Edward Kubiak",
          "url": "https://www.compute-atlas.com/api",
          "license": "CC BY 4.0",
          "license_url": "https://creativecommons.org/licenses/by/4.0/",
          "snapshot_url": "https://www.compute-atlas.com/api/facilities",
          "retrieved": "2026-10-14",
          "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37",
          "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally."
        },
        "counties": "U.S. Census Bureau county boundaries (public domain)",
        "research": "Field-specific source context. See the linked source and limits on each record."
      },
      "source_data_url": "https://datacentersatlas.com/data/mi.json",
      "updated": "2026-10-24"
    }
  },
  "scope": "Exact retained city label subset. This is not a municipal boundary or complete city inventory. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.",
  "collection": {
    "kind": "cities",
    "key": "mi/detroit",
    "label": "Detroit, Michigan"
  },
  "records": [
    {
      "id": "cogent-detroit-1320-3rd-st-mi",
      "state": "mi",
      "kind": "facility",
      "name": "Cogent Detroit Data Center (1320 3rd St)",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Wayne"
      ],
      "city": "Detroit",
      "address": "",
      "who": "Cogent Communications",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Generic multiple-options power gives no MW. Two area blocks need brochure mapping before assigning to Detroit versus Troy. Operator explicitly separates Detroit, Troy and Michigan edge sites. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Detroit/Troy named sections. Distinctsiteaddressesandspaces; GrandRapids/Lansing/Pontiac/FlintedgeaddressesnotadditionalDetroitfloorarea. NoMWadopted.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://cogentco.com/en/cogent-detroit",
          "host": "cogentco.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1320+3rd+St%2C+Detroit%2C+MI+48226&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Calculated Census street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.06063717329927%2C42.32730684259353%2C-83.05213128220272%2C42.333595020818464&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Aerial setting only, acquisition date unknown"
        },
        {
          "url": "https://www.cogentco.com/en/cogent-detroit",
          "host": "www.cogentco.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Named facility section and separate service street context"
        },
        {
          "url": "https://www.cogentco.com/en/network/service-locations?action=search&page=3&continent=&country=United%20States&state=&metro=&site_type=CDC",
          "host": "www.cogentco.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Exact named facility CDC row, separate from network presence"
        },
        {
          "url": "https://www.cogentco.com/en/network/cogent-data-centers",
          "host": "www.cogentco.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Provider explanation of Cogent data center and colocation relationships"
        }
      ],
      "loc": {
        "lng": -83.056384227751,
        "lat": 42.330450931706,
        "precision": "address",
        "basis": "Published Cogent Communications facility address 1320 3rd St, Detroit, MI 48226 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "field-verification-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "street": "1320 3rd St",
            "city": "Detroit",
            "marketed_service": "colocation"
          },
          "notes": [
            "Generic multiple-options power gives no MW.",
            "Two area blocks need brochure mapping before assigning to Detroit versus Troy.",
            "Operator explicitly separates Detroit, Troy and Michigan edge sites.",
            "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://cogentco.com/en/cogent-detroit",
              "host": "cogentco.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "Detroit/Troy named sections",
          "fields": {
            "site_sections": [
              {
                "city": "Troy",
                "address": "3331 W Big Beaver Road, Troy, MI48084",
                "operator_labeled_space_sqft": 5624
              },
              {
                "city": "Detroit",
                "address": "1320 3rd St, Detroit, MI48226",
                "operator_labeled_space_sqft": 31149
              }
            ]
          },
          "notes": [
            "Distinctsiteaddressesandspaces; GrandRapids/Lansing/Pontiac/FlintedgeaddressesnotadditionalDetroitfloorarea. NoMWadopted.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://cogentco.com/en/cogent-detroit",
              "host": "cogentco.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies the Detroit data center on Third Street, distinct from its Troy facility and other edge sites. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies the Detroit data center on Third Street, distinct from its Troy facility and other edge sites. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "Cogent explicitly offers current Detroit-market colocation and separately identifies the Detroit data center on Third Street, distinct from its Troy facility and other edge sites."
          ],
          "sources": [
            {
              "url": "https://cogentco.com/en/cogent-detroit",
              "host": "cogentco.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 16, October 23, 2026",
          "scope": "Current official facility street reference only. Native protected facts and canonical address remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -83.056384227751,
                "lat": 42.330450931706,
                "precision": "address",
                "basis": "Published Cogent Communications facility address 1320 3rd St, Detroit, MI 48226 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "1320 3rd St, Detroit, MI 48226",
              "county_fips": [
                "26163"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named official numeric facility section binds the service address to this existing research record. Corporate offices, related facility cards and embedded map coordinates are excluded.",
            "The unique Census calculated street range agrees with the retained state and county. Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. The reference does not locate a surveyed roof, parcel, full campus, legal owner, floor or suite.",
            "All canonical address, status, physical dates, quantity, role, identity and jurisdiction wrappers remain exact. The retained Census method source keeps its actual October 22 date; new captures are dated October 23."
          ],
          "sources": [
            {
              "url": "https://cogentco.com/en/cogent-detroit",
              "host": "cogentco.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Official named Detroit Data Center numeric facility address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1320+3rd+St%2C+Detroit%2C+MI+48226&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Calculated Census street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.06063717329927%2C42.32730684259353%2C-83.05213128220272%2C42.333595020818464&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Aerial setting only, acquisition date unknown"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 28, October 23, 2026",
          "scope": "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes. The service table labels 1320 3rd Avenue, while the named Detroit facility page labels 1320 3rd St. That street wording conflict is retained without changing the existing address or point.",
          "fields": {
            "company_association": {
              "name": "Cogent Communications",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes. The service table labels 1320 3rd Avenue, while the named Detroit facility page labels 1320 3rd St. That street wording conflict is retained without changing the existing address or point."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes. The service table labels 1320 3rd Avenue, while the named Detroit facility page labels 1320 3rd St. That street wording conflict is retained without changing the existing address or point."
          ],
          "sources": [
            {
              "url": "https://www.cogentco.com/en/cogent-detroit",
              "host": "www.cogentco.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Named facility section and separate service street context"
            },
            {
              "url": "https://www.cogentco.com/en/network/service-locations?action=search&page=3&continent=&country=United%20States&state=&metro=&site_type=CDC",
              "host": "www.cogentco.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Exact named facility CDC row, separate from network presence"
            },
            {
              "url": "https://www.cogentco.com/en/network/cogent-data-centers",
              "host": "www.cogentco.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Provider explanation of Cogent data center and colocation relationships"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Detroit · Wayne · Source context reviewed",
      "status_scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies the Detroit data center on Third Street, distinct from its Troy facility and other edge sites. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "detroit-shoemaker-street-data-center-mi",
      "state": "mi",
      "kind": "facility",
      "name": "Shoemaker Street Data Center Proposal (11031 & 11081 Shoemaker St, Detroit east side)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Wayne"
      ],
      "city": "Detroit",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/",
          "host": "gandernewsroom.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 42.28249,
        "lng": -83.28262,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json",
          "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.",
          "fields": {
            "dated_reported_context": "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo."
          },
          "notes": [
            "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo.",
            "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations."
          ],
          "sources": [
            {
              "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/",
              "host": "gandernewsroom.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Detroit · Wayne · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "26163"
      }
    },
    {
      "id": "raeden-detroit-carrier-hotel-mi",
      "state": "mi",
      "kind": "facility",
      "name": "Raeden Detroit Carrier Hotel (615 W Lafayette)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Wayne"
      ],
      "city": "Detroit",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. RAEDEN two Detroit properties and power-scope separation. 500kVAUPSnotcriticalIT;linked3MWplusnotautomatically615Lafayettecapacity.1050Woodward3MWSCALABLEpotentialnotactualenergizedIT. Distinctaddressesnotonephysicalbuilding. No originalopeningorindependentwholecarrierhotelownership. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://raeden.com/data-centers/detroit/",
          "host": "raeden.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 42.31143,
        "lng": -83.26043,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round10-2026-10-14.json",
          "scope": "RAEDEN two Detroit properties and power-scope separation",
          "fields": {
            "operator": "RAEDEN",
            "named_detroit_sites": [
              {
                "address": "615 WestLafayetteBoulevard, Detroit, Michigan",
                "ups_apparent_power_kva": 500,
                "network_link": "directly connected to3MWplusenterprisecolocation"
              },
              {
                "address": "1050 WoodwardAvenue, Detroit, Michigan",
                "alias": "One Campus Martius",
                "colocation_space_sqft": 10000,
                "scalable_power_mw_max": 3
              }
            ]
          },
          "notes": [
            "500kVAUPSnotcriticalIT;linked3MWplusnotautomatically615Lafayettecapacity.1050Woodward3MWSCALABLEpotentialnotactualenergizedIT. Distinctaddressesnotonephysicalbuilding. No originalopeningorindependentwholecarrierhotelownership.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://raeden.com/data-centers/detroit/",
              "host": "raeden.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 51",
          "scope": "The current original provider page describes colocation and Remote Hands at 615 West Lafayette and advertises available space and ready infrastructure. These offerings and connection claims do not explicitly establish commissioned computing for this exact component in this bounded review. The page separately describes 1050 Woodward and a future mirror site. Their service, power and floor area are not transferred to the inherited Lafayette record.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "available_colocation_not_explicit_current_computing",
              "scope": "The current original provider page describes colocation and Remote Hands at 615 West Lafayette and advertises available space and ready infrastructure. These offerings and connection claims do not explicitly establish commissioned computing for this exact component in this bounded review. The page separately describes 1050 Woodward and a future mirror site. Their service, power and floor area are not transferred to the inherited Lafayette record."
            },
            "source_read_scope": {
              "selected_section": "615 West Lafayette",
              "separate_1050_woodward_component_excluded": true
            }
          },
          "notes": [
            "The current original provider page describes colocation and Remote Hands at 615 West Lafayette and advertises available space and ready infrastructure. These offerings and connection claims do not explicitly establish commissioned computing for this exact component in this bounded review. The page separately describes 1050 Woodward and a future mirror site. Their service, power and floor area are not transferred to the inherited Lafayette record.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://raeden.com/data-centers/detroit/",
              "host": "raeden.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Detroit · Wayne · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "26163"
      }
    },
    {
      "id": "raeden-one-campus-martius-detroit-mi",
      "state": "mi",
      "kind": "facility",
      "name": "Raeden One Campus Martius (1050 Woodward)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Wayne"
      ],
      "city": "Detroit",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.. RAEDENoperatorpageidentifies1050Woodward/OneCampusMartiusDetroit10000sfcolocation,up-to3MWSCALABLEpower. NoIT/grossbasis,currentcommittedorcommissioned3MWverified. Separate615WLafayette500kVAUPS andconnected3MW+colocation cannotbeadded/copiedtoOCM. TwoRAEDENmanagedhubsitesnotproofownswholebuildings. 1-6monthmarketingcallnotactualRFS. Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://raeden.com/data-centers/detroit/",
          "host": "raeden.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 42.25722,
        "lng": -83.2429,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-and-government-review-round46-2026-10-14.json",
          "scope": "Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.",
          "fields": {
            "named_original_context": "RAEDENoperatorpageidentifies1050Woodward/OneCampusMartiusDetroit10000sfcolocation,up-to3MWSCALABLEpower. NoIT/grossbasis,currentcommittedorcommissioned3MWverified. Separate615WLafayette500kVAUPS andconnected3MW+colocation cannotbeadded/copiedtoOCM. TwoRAEDENmanagedhubsitesnotproofownswholebuildings. 1-6monthmarketingcallnotactualRFS."
          },
          "notes": [
            "RAEDENoperatorpageidentifies1050Woodward/OneCampusMartiusDetroit10000sfcolocation,up-to3MWSCALABLEpower. NoIT/grossbasis,currentcommittedorcommissioned3MWverified. Separate615WLafayette500kVAUPS andconnected3MW+colocation cannotbeadded/copiedtoOCM. TwoRAEDENmanagedhubsitesnotproofownswholebuildings. 1-6monthmarketingcallnotactualRFS.",
            "Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol."
          ],
          "sources": [
            {
              "url": "https://raeden.com/data-centers/detroit/",
              "host": "raeden.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 52",
          "scope": "The current original provider page separately describes 1050 Woodward Avenue as One Campus Martius and offers purpose built colocation and Remote Hands. It describes scalable potential and available space, not explicit exact current computing occupancy or commissioned service in this bounded review. The distinct 615 West Lafayette premise and future mirror site are not this building. No capacity, facility identity, role or location changes are made.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "available_space_and_scalable_power_current_stage_held",
              "scope": "The current original provider page separately describes 1050 Woodward Avenue as One Campus Martius and offers purpose built colocation and Remote Hands. It describes scalable potential and available space, not explicit exact current computing occupancy or commissioned service in this bounded review. The distinct 615 West Lafayette premise and future mirror site are not this building. No capacity, facility identity, role or location changes are made."
            },
            "source_read_scope": {
              "selected_section": "1050 Woodward Avenue",
              "separate_lafayette_component_not_transferred": true
            }
          },
          "notes": [
            "The current original provider page separately describes 1050 Woodward Avenue as One Campus Martius and offers purpose built colocation and Remote Hands. It describes scalable potential and available space, not explicit exact current computing occupancy or commissioned service in this bounded review. The distinct 615 West Lafayette premise and future mirror site are not this building. No capacity, facility identity, role or location changes are made.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://raeden.com/data-centers/detroit/",
              "host": "raeden.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Detroit · Wayne · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "26163"
      }
    }
  ],
  "compilation_license": "withheld_pending_owner_decision"
}