{ "schema_version": 1, "source_compilation_context": { "mn": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/mn.json", "updated": "2026-10-24" } }, "scope": "Exact retained city label subset. This is not a municipal boundary or complete city inventory. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.", "collection": { "kind": "cities", "key": "mn/becker", "label": "Becker, Minnesota" }, "records": [ { "id": "amazon-becker-mn", "state": "mn", "kind": "facility", "name": "Amazon Becker Data Center (Suspended)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Sherburne" ], "city": "Becker", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. KNSINov14,2024reportsAmazonbought348acBeckerfor73.56MfromElkRiverTechnologies/Diode,whichhadboughtfromXcel7.97MinApril. Specificcertificate/deednotindependentlyread. Laterstageunknown;publishedlandtransactionnotconstruction/energization.1Bcapital100perm1200constructionwerecompanyforecasts,notlandpricepluscapex/actualjobs. Exactclosingdayunprinted. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://knsiradio.com/2024/11/14/amazon-purchases-348-acres-in-becker-for-data-center-development-near-retiring-sherco-plant/", "host": "knsiradio.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.ci.becker.mn.us/AgendaCenter/ViewFile/Minutes/_09292025-502", "host": "www.ci.becker.mn.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 45.4442, "lng": -93.7751, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "KNSINov14,2024reportsAmazonbought348acBeckerfor73.56MfromElkRiverTechnologies/Diode,whichhadboughtfromXcel7.97MinApril. Specificcertificate/deednotindependentlyread. Laterstageunknown;publishedlandtransactionnotconstruction/energization.1Bcapital100perm1200constructionwerecompanyforecasts,notlandpricepluscapex/actualjobs. Exactclosingdayunprinted." }, "notes": [ "KNSINov14,2024reportsAmazonbought348acBeckerfor73.56MfromElkRiverTechnologies/Diode,whichhadboughtfromXcel7.97MinApril. Specificcertificate/deednotindependentlyread. Laterstageunknown;publishedlandtransactionnotconstruction/energization.1Bcapital100perm1200constructionwerecompanyforecasts,notlandpricepluscapex/actualjobs. Exactclosingdayunprinted.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://knsiradio.com/2024/11/14/amazon-purchases-348-acres-in-becker-for-data-center-development-near-retiring-sherco-plant/", "host": "knsiradio.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 58", "scope": "The original posted City minutes record a staff update relaying a Star Tribune report that Amazon halted Becker plans, followed by an account of possible property sale under limited circumstances. This is a City record of a secondary news account rather than an independently read original Amazon announcement or completed sale. The posted minutes retain a blank submission line. No original current company project disposition, precise legal cessation, physical computing closure, construction or service is certified from this passage.", "fields": { "current_stage_evidence": { "outcome": "official_minutes_relay_secondary_account_current_physical_stage_held", "scope": "The original posted City minutes record a staff update relaying a Star Tribune report that Amazon halted Becker plans, followed by an account of possible property sale under limited circumstances. This is a City record of a secondary news account rather than an independently read original Amazon announcement or completed sale. The posted minutes retain a blank submission line. No original current company project disposition, precise legal cessation, physical computing closure, construction or service is certified from this passage." }, "source_read_scope": { "selected_minutes_development_update_paragraph_read": true, "staff_explicitly_cites_secondary_newspaper": true, "blank_submission_line_retained": true, "potential_land_sale_not_completed": true, "no_news_report_promoted_to_original_operator_confirmation": true } }, "notes": [ "The original posted City minutes record a staff update relaying a Star Tribune report that Amazon halted Becker plans, followed by an account of possible property sale under limited circumstances. This is a City record of a secondary news account rather than an independently read original Amazon announcement or completed sale. The posted minutes retain a blank submission line. No original current company project disposition, precise legal cessation, physical computing closure, construction or service is certified from this passage.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.ci.becker.mn.us/AgendaCenter/ViewFile/Minutes/_09292025-502", "host": "www.ci.becker.mn.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Becker · Sherburne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "27141" } }, { "id": "microsoft-becker-mn", "state": "mn", "kind": "facility", "name": "Microsoft Becker Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Sherburne" ], "city": "Becker", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Land purchase is not data-center construction spending, secured utility service or commissioning. Microsoft declined to disclose project details. Google's canceled proposal and Elk River Technologies' separate land sale are not this site. No MW, specific design or final opening date is established. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.mprnews.org/story/2024/02/21/xcel-energy-sells-land-in-becker-to-microsoft-for-data-center", "host": "mprnews.org", "date": "2024-02-21", "published": "2024-02-21", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 45.42206, "lng": -93.77316, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round28-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "MPR reports Microsoft's purchase of about 295 Becker acres from Xcel for about 17.7 million USD, confirmed by Xcel and state property data cited by the reporter.", "independently_verified_current_operating_status": null }, "notes": [ "Land purchase is not data-center construction spending, secured utility service or commissioning. Microsoft declined to disclose project details. Google's canceled proposal and Elk River Technologies' separate land sale are not this site. No MW, specific design or final opening date is established.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.mprnews.org/story/2024/02/21/xcel-energy-sells-land-in-becker-to-microsoft-for-data-center", "host": "mprnews.org", "date": "2024-02-21", "published": "2024-02-21", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Becker · Sherburne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "27141" } } ], "compilation_license": "withheld_pending_owner_decision" }