{ "schema_version": 1, "source_compilation_context": { "az": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/az.json", "updated": "2026-10-24" }, "ca": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/ca.json", "updated": "2026-10-25" }, "ga": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/ga.json", "updated": "2026-10-24" }, "in": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/in.json", "updated": "2026-10-24" }, "la": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/la.json", "updated": "2026-10-25" }, "ma": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/ma.json", "updated": "2026-10-24" }, "md": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/md.json", "updated": "2026-10-24" }, "mn": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/mn.json", "updated": "2026-10-24" }, "mo": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/mo.json", "updated": "2026-10-26" }, "ms": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/ms.json", "updated": "2026-10-24" }, "nc": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/nc.json", "updated": "2026-10-25" }, "nv": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/nv.json", "updated": "2026-10-24" }, "oh": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/oh.json", "updated": "2026-10-24" }, "or": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/or.json", "updated": "2026-10-26" }, "pa": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/pa.json", "updated": "2026-10-24" }, "tx": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/tx.json", "updated": "2026-10-24" }, "va": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/va.json", "updated": "2026-10-25" }, "wa": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/wa.json", "updated": "2026-10-24" } }, "scope": "Linked company names and sourced roles retain their separate meaning in each record. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.", "collection": { "kind": "companies", "key": "amazon-web-services", "label": "Amazon Web Services (AWS)" }, "records": [ { "id": "amazon-becker-mn", "state": "mn", "kind": "facility", "name": "Amazon Becker Data Center (Suspended)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Sherburne" ], "city": "Becker", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. KNSINov14,2024reportsAmazonbought348acBeckerfor73.56MfromElkRiverTechnologies/Diode,whichhadboughtfromXcel7.97MinApril. Specificcertificate/deednotindependentlyread. Laterstageunknown;publishedlandtransactionnotconstruction/energization.1Bcapital100perm1200constructionwerecompanyforecasts,notlandpricepluscapex/actualjobs. Exactclosingdayunprinted. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://knsiradio.com/2024/11/14/amazon-purchases-348-acres-in-becker-for-data-center-development-near-retiring-sherco-plant/", "host": "knsiradio.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.ci.becker.mn.us/AgendaCenter/ViewFile/Minutes/_09292025-502", "host": "www.ci.becker.mn.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 45.4442, "lng": -93.7751, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "KNSINov14,2024reportsAmazonbought348acBeckerfor73.56MfromElkRiverTechnologies/Diode,whichhadboughtfromXcel7.97MinApril. Specificcertificate/deednotindependentlyread. Laterstageunknown;publishedlandtransactionnotconstruction/energization.1Bcapital100perm1200constructionwerecompanyforecasts,notlandpricepluscapex/actualjobs. Exactclosingdayunprinted." }, "notes": [ "KNSINov14,2024reportsAmazonbought348acBeckerfor73.56MfromElkRiverTechnologies/Diode,whichhadboughtfromXcel7.97MinApril. Specificcertificate/deednotindependentlyread. Laterstageunknown;publishedlandtransactionnotconstruction/energization.1Bcapital100perm1200constructionwerecompanyforecasts,notlandpricepluscapex/actualjobs. Exactclosingdayunprinted.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://knsiradio.com/2024/11/14/amazon-purchases-348-acres-in-becker-for-data-center-development-near-retiring-sherco-plant/", "host": "knsiradio.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 58", "scope": "The original posted City minutes record a staff update relaying a Star Tribune report that Amazon halted Becker plans, followed by an account of possible property sale under limited circumstances. This is a City record of a secondary news account rather than an independently read original Amazon announcement or completed sale. The posted minutes retain a blank submission line. No original current company project disposition, precise legal cessation, physical computing closure, construction or service is certified from this passage.", "fields": { "current_stage_evidence": { "outcome": "official_minutes_relay_secondary_account_current_physical_stage_held", "scope": "The original posted City minutes record a staff update relaying a Star Tribune report that Amazon halted Becker plans, followed by an account of possible property sale under limited circumstances. This is a City record of a secondary news account rather than an independently read original Amazon announcement or completed sale. The posted minutes retain a blank submission line. No original current company project disposition, precise legal cessation, physical computing closure, construction or service is certified from this passage." }, "source_read_scope": { "selected_minutes_development_update_paragraph_read": true, "staff_explicitly_cites_secondary_newspaper": true, "blank_submission_line_retained": true, "potential_land_sale_not_completed": true, "no_news_report_promoted_to_original_operator_confirmation": true } }, "notes": [ "The original posted City minutes record a staff update relaying a Star Tribune report that Amazon halted Becker plans, followed by an account of possible property sale under limited circumstances. This is a City record of a secondary news account rather than an independently read original Amazon announcement or completed sale. The posted minutes retain a blank submission line. No original current company project disposition, precise legal cessation, physical computing closure, construction or service is certified from this passage.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.ci.becker.mn.us/AgendaCenter/ViewFile/Minutes/_09292025-502", "host": "www.ci.becker.mn.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Becker · Sherburne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "27141" } }, { "id": "amazon-data-services-reno-storey-county-nv", "state": "nv", "kind": "facility", "name": "Amazon Data Services Reno Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Storey" ], "city": "Sparks", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Nevada Amazon proposed air-construction permit. Proposed action notice, not issued permit or observed operating proof. Sparks postal address not proof project is withinReno orSparks municipality.358engines not358facilities or MWload. Draft permits can condition use of diesel/renewable diesel; not carbon-free operations. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ndep.nv.gov/uploads/documents/ap7374-4768-proposed-action.pdf", "host": "ndep.nv.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.44687, "lng": -119.52913, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "Nevada Amazon proposed air-construction permit", "fields": { "air_permit_applicant": "AmazonDataServicesInc", "air_permit_id": "AP7374-4768", "air_facility_id": "A2648", "published_applicant_address": "3800 PeruDrive,Sparks,NV89437", "published_site_region": "TahoeRenoIndustrialCenter,approximately15miles eastofReno", "proposed_standby_diesel_generators": 358, "historical_comment_deadline": "2026-03-02" }, "notes": [ "Proposed action notice, not issued permit or observed operating proof. Sparks postal address not proof project is withinReno orSparks municipality.358engines not358facilities or MWload. Draft permits can condition use of diesel/renewable diesel; not carbon-free operations.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://ndep.nv.gov/uploads/documents/ap7374-4768-proposed-action.pdf", "host": "ndep.nv.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Sparks · Storey · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "32029" } }, { "id": "amazon-devlin-tech-park-va", "state": "va", "kind": "facility", "name": "Amazon Devlin Technology Park", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Prince William" ], "city": "Bristow", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Land price is not total construction spending. Zoning floor allowance is not commissioned space or proof of current operations. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://virginiabusiness.com/amazon-buys-189-acres-in-prince-william-tech-park-for-700m/", "host": "virginiabusiness.com", "date": "2025-11-18", "published": "2025-11-18", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 38.70393, "lng": -77.47812, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Reported Amazon purchase of 188.5 acres in Devlin Technology Park closed November 5 for 700 million USD.", "independently_verified_current_operating_status": null }, "notes": [ "Land price is not total construction spending. Zoning floor allowance is not commissioned space or proof of current operations.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://virginiabusiness.com/amazon-buys-189-acres-in-prince-william-tech-park-for-700m/", "host": "virginiabusiness.com", "date": "2025-11-18", "published": "2025-11-18", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Bristow · Prince William · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "51153" } }, { "id": "amazon-gilroy-ca", "state": "ca", "kind": "facility", "name": "Amazon AWS Gilroy Data Center", "group": "building", "status": "Under construction", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Santa Clara" ], "city": "Gilroy", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Gilroy municipal entitlement, permits and phase-specific water/power. 49MWutility and50MWpotentialstorage power are not critical IT or99MWcompute. Twenty-five2.5MW emergency generators plus600kWhouse generator are redundancy, not extra utility demand. Water forecasts not actual withdrawals. Building permits/agency construction account are not customer commissioning. Recycled-water agreement/connection still future; no exact service date. Two data buildings plus security is not three data centers. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Named-site current agency/operator stage, reviewed October 15, 2026. Only the current city stage and project identity are adopted. The 2028 first-phase opening remains a forecast; water/revenue projections and connection or generator ratings are not measured operation. No coordinate upgrade. Publication date of this current page is not established; the review date is not an event date. Displayed status uses the explicitly reviewed current status field; it is a source statement, not a physical inspection.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://cityofgilroy.org/1019/Gilroy-Data-Center-by-AWS", "host": "cityofgilroy.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 37.23143, "lng": -121.69482, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Gilroy municipal entitlement, permits and phase-specific water/power", "fields": { "agency": "City of Gilroy", "project": "AWS Gilroy Data Center AS20-23", "address": "8050 Camino Arroyo, Gilroy, California", "parcel": "841-69-044", "site_acres": 56, "agency_reported_stage": "under construction", "site_architectural_entitlement_approval_date": "2025-07-03", "appeal_received_date": "2025-07-21", "appeal_withdrawn_date": "2025-08-18", "grading_underground_utility_permits_date": "2025-12-11", "building_permit_date": "2026-03-19", "planned_data_center_buildings": 2, "security_buildings": 1, "total_building_sqft_approx": 438500, "each_data_center_sqft_approx": 218000, "security_building_sqft": 2500, "phase1_utility_connection_mw": 49, "potential_future_bess_power_mw_max": 50, "phase1_expected_potable_water_acre_feet_per_year": 23, "post_recycled_transition_expected_potable_water_acre_feet_per_year": 2, "water_transition_deadline": "within2years after phase1completion or before first phase2occupancy, whichever first", "water_answer_updated_date": "2026-08-12", "anticipated_recycled_connection_year": 2030 }, "notes": [ "49MWutility and50MWpotentialstorage power are not critical IT or99MWcompute. Twenty-five2.5MW emergency generators plus600kWhouse generator are redundancy, not extra utility demand. Water forecasts not actual withdrawals. Building permits/agency construction account are not customer commissioning. Recycled-water agreement/connection still future; no exact service date. Two data buildings plus security is not three data centers.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cityofgilroy.org/1019/Gilroy-Data-Center-by-AWS", "host": "cityofgilroy.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Atlas targeted primary-source follow-up", "scope": "Named-site current agency/operator stage, reviewed October 15, 2026", "fields": { "current_status": "under construction", "status_basis": "Gilroy’s municipal project page explicitly labels AS 20-23 Under Construction." }, "notes": [ "Only the current city stage and project identity are adopted. The 2028 first-phase opening remains a forecast; water/revenue projections and connection or generator ratings are not measured operation. No coordinate upgrade. Publication date of this current page is not established; the review date is not an event date." ], "sources": [ { "url": "https://cityofgilroy.org/1019/Gilroy-Data-Center-by-AWS", "host": "cityofgilroy.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "checked": "2026-10-15", "capture_sha256": "94129f9168be53d342a088e87d3af0d5993d2f522596d99df8ef2f97d4630749", "events": [], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Gilroy · Santa Clara · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "06085" } }, { "id": "amazon-pecos-county-data-center-tx", "state": "tx", "kind": "facility", "name": "Amazon Pecos County Data Center Campus", "group": "proposed", "status": "Operator-announced campus", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Pecos" ], "city": "", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Amazon Pecos County statement. No numeric IT MW, investment, opening date or permanent-versus-construction job split in reviewed statement. Solar/battery/produced-water options exploratory. Statement about ratepayer effects is developer claim, not adjudicated tariff finding. Publication day not present in saved body; metadata candidate not treated as event date. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.aboutamazon.com/news/company-news/amazon-pecos-county-texas-data-center-clean-energy-jobs", "host": "aboutamazon.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 30.78087, "lng": -102.72358, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "primary-source-review-round9-2026-10-14.json", "scope": "Amazon Pecos County statement", "fields": { "project_county": "Pecos County, Texas", "developer_described_initial_power": "new on-site generation with intended later grid connection", "water_plan": "non-potable water; exploring produced-water use", "operator_expected_jobs_description": "thousands of new jobs" }, "notes": [ "No numeric IT MW, investment, opening date or permanent-versus-construction job split in reviewed statement. Solar/battery/produced-water options exploratory. Statement about ratepayer effects is developer claim, not adjudicated tariff finding. Publication day not present in saved body; metadata candidate not treated as event date.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.aboutamazon.com/news/company-news/amazon-pecos-county-texas-data-center-clean-energy-jobs", "host": "aboutamazon.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "status-continuation-2026-10-19", "scope": "Amazon describes a planned data center campus in Pecos County.", "fields": { "current_stage_evidence": { "outcome": "operator_announced_campus", "scope": "Amazon describes a planned data center campus in Pecos County." } }, "notes": [ "This supports the announced project only. Promised energy, water, rate and employment outcomes are not measured facts or evidence of operation." ], "sources": [ { "url": "https://www.aboutamazon.com/news/company-news/amazon-pecos-county-texas-data-center-clean-energy-jobs", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Original source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Pecos · Source context reviewed", "status_scope": "Amazon describes a planned data center campus in Pecos County.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "48371" } }, { "id": "amazon-perry-township-stark-oh", "state": "oh", "kind": "facility", "name": "Amazon Perry Township Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Stark" ], "city": "Canton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. IdeastreamApr15,2026originalreportnamesPanattoni240MWundefinedproposalFaircrestSW/KropfPerryTownshipStarkCounty100+ac. Openhouseeventnotapproval;noAmazontenantidentifiedinthissource.16qualifiedsmallbusinessesnot16permanentjobs. Health/noiseconcernsandquietestneighborpledgenotmeasuredcausality/compliance. Petitionseeking>25MWstateban notenactedlaw. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations. News5June25,2026report saysStarkRegionalPlanningCommissionapprovedPerryTownshipsite;scopeofapprovaloriginalnotreadanddoesnotprovebuildingpermit/RFS. SeparateCantonTownshipmoratoriumandCantonCityMillerton/Orchardviewproposals notsamejurisdiction/site. RelatedPerryVILLAGE/LakeCountyarticleisdistinct.18000signaturecomforttargetnotactualcollectedsignatures;ballotinitiativefuture,notcurrentstateban. Amazonidentitynotestablishedhere.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.ideastream.org/environment-energy/2026-04-15/some-stark-county-residents-skeptical-of-developers-answers-on-data-center-project", "host": "ideastream.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.news5cleveland.com/news/local-news/we-follow-through/as-data-center-proposals-spread-across-stark-county-neighbors-fear-whats-next", "host": "news5cleveland.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.perrytwp.com/Documents/Departments/Administration/FAQs%20Data%20Center%20April%202026.pdf?t=202604211620460", "host": "www.perrytwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.perrytwp.com/Documents/Departments/Administration/Newsletters/PerryNewsSpring_proof3.pdf?t=202605012050560", "host": "www.perrytwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.81385, "lng": -81.36534, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "IdeastreamApr15,2026originalreportnamesPanattoni240MWundefinedproposalFaircrestSW/KropfPerryTownshipStarkCounty100+ac. Openhouseeventnotapproval;noAmazontenantidentifiedinthissource.16qualifiedsmallbusinessesnot16permanentjobs. Health/noiseconcernsandquietestneighborpledgenotmeasuredcausality/compliance. Petitionseeking>25MWstateban notenactedlaw." }, "notes": [ "IdeastreamApr15,2026originalreportnamesPanattoni240MWundefinedproposalFaircrestSW/KropfPerryTownshipStarkCounty100+ac. Openhouseeventnotapproval;noAmazontenantidentifiedinthissource.16qualifiedsmallbusinessesnot16permanentjobs. Health/noiseconcernsandquietestneighborpledgenotmeasuredcausality/compliance. Petitionseeking>25MWstateban notenactedlaw.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.ideastream.org/environment-energy/2026-04-15/some-stark-county-residents-skeptical-of-developers-answers-on-data-center-project", "host": "ideastream.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "News5June25,2026report saysStarkRegionalPlanningCommissionapprovedPerryTownshipsite;scopeofapprovaloriginalnotreadanddoesnotprovebuildingpermit/RFS. SeparateCantonTownshipmoratoriumandCantonCityMillerton/Orchardviewproposals notsamejurisdiction/site. RelatedPerryVILLAGE/LakeCountyarticleisdistinct.18000signaturecomforttargetnotactualcollectedsignatures;ballotinitiativefuture,notcurrentstateban. Amazonidentitynotestablishedhere." }, "notes": [ "News5June25,2026report saysStarkRegionalPlanningCommissionapprovedPerryTownshipsite;scopeofapprovaloriginalnotreadanddoesnotprovebuildingpermit/RFS. SeparateCantonTownshipmoratoriumandCantonCityMillerton/Orchardviewproposals notsamejurisdiction/site. RelatedPerryVILLAGE/LakeCountyarticleisdistinct.18000signaturecomforttargetnotactualcollectedsignatures;ballotinitiativefuture,notcurrentstateban. Amazonidentitynotestablishedhere.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.news5cleveland.com/news/local-news/we-follow-through/as-data-center-proposals-spread-across-stark-county-neighbors-fear-whats-next", "host": "news5cleveland.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The official Township FAQ and newsletter describe a Panattoni data center proposal and community questions. The selected originals do not identify an Amazon or Microsoft tenant, so their proposed use and administrative discussion are not a verified exact identity crosswalk for the inherited Amazon labeled record. Neither a Township open house nor a JEDD arrangement is commissioned computing. Institutional references to resident concern are retained as source context without a new facility concern whose subject match is unresolved. No provider name, role, geography or status is changed.", "fields": { "current_stage_evidence": { "outcome": "township_proposal_identity_crosswalk_held", "scope": "The official Township FAQ and newsletter describe a Panattoni data center proposal and community questions. The selected originals do not identify an Amazon or Microsoft tenant, so their proposed use and administrative discussion are not a verified exact identity crosswalk for the inherited Amazon labeled record. Neither a Township open house nor a JEDD arrangement is commissioned computing. Institutional references to resident concern are retained as source context without a new facility concern whose subject match is unresolved. No provider name, role, geography or status is changed." }, "source_read_scope": { "faq_selected_text_page": 1, "newsletter_selected_data_center_sections": true, "tenant_identity_not_certified": true, "source_file_month_not_exact_publication_day": true, "technical_and_financial_quantity_fields_not_exported": true } }, "notes": [ "The official Township FAQ and newsletter describe a Panattoni data center proposal and community questions. The selected originals do not identify an Amazon or Microsoft tenant, so their proposed use and administrative discussion are not a verified exact identity crosswalk for the inherited Amazon labeled record. Neither a Township open house nor a JEDD arrangement is commissioned computing. Institutional references to resident concern are retained as source context without a new facility concern whose subject match is unresolved. No provider name, role, geography or status is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.perrytwp.com/Documents/Departments/Administration/FAQs%20Data%20Center%20April%202026.pdf?t=202604211620460", "host": "www.perrytwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.perrytwp.com/Documents/Departments/Administration/Newsletters/PerryNewsSpring_proof3.pdf?t=202605012050560", "host": "www.perrytwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Canton · Stark · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39151" } }, { "id": "amazon-project-rainier-new-carlisle-in", "state": "in", "kind": "facility", "name": "Amazon Project Rainier", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "St. Joseph" ], "city": "New Carlisle", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Historical state announcement. Performance conditions and dependency on long-term electricity agreement remain; caps are not disbursements and are not added to capex. Subsequent construction/commissioning needs newer evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://iedc.in.gov/events/news/details/2024/04/25/gov.-holcomb-announces-amazon-web-services-plans-to-invest-11b-to-create-a-new-data-center-campus-in-northern-indiana", "host": "iedc.in.gov", "date": "2024-04-25", "published": "2024-04-25", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/aws/aws-project-rainier-ai-trainium-chips-compute-cluster?trk=test", "host": "www.aboutamazon.com", "published": "2025-06-24", "date": "2025-06-24", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 41.61663, "lng": -86.28996, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "county": "St. Joseph", "announced_planned_investment_usd": 11000000000, "forecast_jobs_minimum": 1000, "announced_sales_tax_exemption_term_years": 50, "performance_based_incentive_caps_usd": { "headcount_tax_credits": 18300000, "training_grants": 5000000, "hoosier_business_investment_credits": 55000000, "redevelopment_credits": 20000000 }, "road_infrastructure_contribution_usd_up_to": 7000000 }, "notes": [ "Historical state announcement. Performance conditions and dependency on long-term electricity agreement remain; caps are not disbursements and are not added to capex. Subsequent construction/commissioning needs newer evidence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://iedc.in.gov/events/news/details/2024/04/25/gov.-holcomb-announces-amazon-web-services-plans-to-invest-11b-to-create-a-new-data-center-campus-in-northern-indiana", "host": "iedc.in.gov", "date": "2024-04-25", "published": "2024-04-25", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 23", "scope": "Amazon current Rainier article describes an operational compute cluster spread across multiple United States data centers and identifies St. Joseph County as one participating location. This does not independently establish the exact current physical phase of every New Carlisle building or assign the entire cluster to this campus. Source metadata records original publication June 24, 2025 and modification October 29, 2025; the updated activation wording is not assigned to the original publication day. The state investment announcement does not supply a current operating milestone. Individual campus phase remains held.", "fields": { "current_stage_evidence": { "outcome": "operational_multi_site_compute_cluster_not_complete_new_carlisle_campus", "scope": "Amazon current Rainier article describes an operational compute cluster spread across multiple United States data centers and identifies St. Joseph County as one participating location. This does not independently establish the exact current physical phase of every New Carlisle building or assign the entire cluster to this campus. Source metadata records original publication June 24, 2025 and modification October 29, 2025; the updated activation wording is not assigned to the original publication day. The state investment announcement does not supply a current operating milestone. Individual campus phase remains held." }, "source_version_scope": { "article_published_at": "2025-06-24T09:40:35.203Z", "article_modified_at": "2025-10-29T11:00:00Z", "current_wording_not_backdated_to_original_publication": true, "multi_site_cluster_capacity_not_local_capacity": true, "no_individual_building_phase_or_provider_role_change": true } }, "notes": [ "Amazon current Rainier article describes an operational compute cluster spread across multiple United States data centers and identifies St. Joseph County as one participating location. This does not independently establish the exact current physical phase of every New Carlisle building or assign the entire cluster to this campus. Source metadata records original publication June 24, 2025 and modification October 29, 2025; the updated activation wording is not assigned to the original publication day. The state investment announcement does not supply a current operating milestone. Individual campus phase remains held.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/aws-project-rainier-ai-trainium-chips-compute-cluster?trk=test", "host": "www.aboutamazon.com", "published": "2025-06-24", "date": "2025-06-24", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://iedc.in.gov/events/news/details/2024/04/25/gov.-holcomb-announces-amazon-web-services-plans-to-invest-11b-to-create-a-new-data-center-campus-in-northern-indiana", "host": "iedc.in.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Carlisle · St. Joseph · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "18141" } }, { "id": "amazon-sf011-corporate-avenue-hayward-ca", "state": "ca", "kind": "facility", "name": "Amazon Data Center SF011 (26415 Corporate Avenue)", "group": "operating", "status": "Operating", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Alameda" ], "city": "Hayward", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Do not use35MW as measured consumption or IT capacity. City separately labels STACK76.6MW as backup generation, not IT load. City explicitly lists SF011 currently operating and35MW estimated capacity; basis is not identified as IT load. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. three identified Hayward sites with separate future STACK context. STACK SVY03A separately under construction with76.6MW BACKUP generation, not IT. City says no municipal tax incentives for STACK; this does not exclude state benefits or transfer to Amazon/Hines. April2026 category change does not retroactively redate older approvals. Displayed status uses the explicitly reviewed current status field; it is a source statement, not a physical inspection.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.hayward-ca.gov/business/for-developers/data-center-development-applications", "host": "hayward-ca.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 37.64673, "lng": -121.8881, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "field-verification-2026-10-14.json", "scope": "Field or source context only", "fields": { "city": "Hayward", "current_status": "operating", "power_mw_estimate": 35, "power_basis": "city estimate; IT/gross basis not specified", "permit_date": "2015-02-20" }, "notes": [ "Do not use35MW as measured consumption or IT capacity.", "City separately labels STACK76.6MW as backup generation, not IT load.", "City explicitly lists SF011 currently operating and35MW estimated capacity; basis is not identified as IT load.", "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.hayward-ca.gov/business/for-developers/data-center-development-applications", "host": "hayward-ca.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "three identified Hayward sites with separate future STACK context", "fields": { "named_sites": [ { "name": "Amazon SF09", "government_reported_status": "operating", "advertised_capacity_mw": 24, "capacity_basis": "not explicit IT", "permit_approval_date": "2010-07-09" }, { "name": "Amazon SF011", "government_reported_status": "operating", "estimated_capacity_mw": 35, "capacity_basis": "not explicit IT", "permit_approval_date": "2015-02-20" }, { "name": "Hayward Exchange at92", "government_reported_status": "operating", "estimated_capacity_mw": 49, "capacity_basis": "not explicit IT", "permit_approval_date": "2021-02-11" } ] }, "notes": [ "STACK SVY03A separately under construction with76.6MW BACKUP generation, not IT. City says no municipal tax incentives for STACK; this does not exclude state benefits or transfer to Amazon/Hines. April2026 category change does not retroactively redate older approvals.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.hayward-ca.gov/business/for-developers/data-center-development-applications", "host": "hayward-ca.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hayward · Alameda · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "06001" } }, { "id": "amazon-sf09-corporate-avenue-hayward-ca", "state": "ca", "kind": "facility", "name": "Amazon Data Center SF09 (26464 Corporate Avenue)", "group": "operating", "status": "Agency reported operation", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Alameda" ], "city": "Hayward", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. three identified Hayward sites with separate future STACK context. STACK SVY03A separately under construction with76.6MW BACKUP generation, not IT. City says no municipal tax incentives for STACK; this does not exclude state benefits or transfer to Amazon/Hines. April2026 category change does not retroactively redate older approvals. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.hayward-ca.gov/business/for-developers/data-center-development-applications", "host": "hayward-ca.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.hayward-ca.gov/sites/default/files/2026-06/CMO-Data-Centers-Amazon-Data-Center-SF09-121005.pdf", "host": "www.hayward-ca.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Official filing numeric site address section only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=26464+Corporate+Avenue%2C+Hayward%2C+CA&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Calculated Census street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-122.11689581031924%2C37.62322706590553%2C-122.10895627888276%2C37.62951524413047&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Viewed aerial setting only, acquisition date unknown" } ], "loc": { "lng": -122.112926044601, "lat": 37.626371155018, "precision": "address", "basis": "Published official City of Hayward filing address 26464 Corporate Avenue, Hayward, CA matched to one Census street range inside the existing county. Calculated street reference only. No surveyed roof, parcel, full campus, legal title or current operation is certified. Existing native status remains unknown." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "three identified Hayward sites with separate future STACK context", "fields": { "named_sites": [ { "name": "Amazon SF09", "government_reported_status": "operating", "advertised_capacity_mw": 24, "capacity_basis": "not explicit IT", "permit_approval_date": "2010-07-09" }, { "name": "Amazon SF011", "government_reported_status": "operating", "estimated_capacity_mw": 35, "capacity_basis": "not explicit IT", "permit_approval_date": "2015-02-20" }, { "name": "Hayward Exchange at92", "government_reported_status": "operating", "estimated_capacity_mw": 49, "capacity_basis": "not explicit IT", "permit_approval_date": "2021-02-11" } ] }, "notes": [ "STACK SVY03A separately under construction with76.6MW BACKUP generation, not IT. City says no municipal tax incentives for STACK; this does not exclude state benefits or transfer to Amazon/Hines. April2026 category change does not retroactively redate older approvals.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.hayward-ca.gov/business/for-developers/data-center-development-applications", "host": "hayward-ca.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 21, October 23, 2026", "scope": "Official filing street reference only. Existing native status remains unknown. Protected facts and canonical address remain exact.", "fields": { "location_review_decision": { "location": { "lng": -122.112926044601, "lat": 37.626371155018, "precision": "address", "basis": "Published official City of Hayward filing address 26464 Corporate Avenue, Hayward, CA matched to one Census street range inside the existing county. Calculated street reference only. No surveyed roof, parcel, full campus, legal title or current operation is certified. Existing native status remains unknown." }, "reference_method": "Census interpolated street address", "published_address": "26464 Corporate Avenue, Hayward, CA", "county_fips": [ "06001" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The official numeric site address section and named filing bind this service street to the existing research record. Agency, staff, business and mailing addresses are excluded.", "The unique Census street range agrees with the existing county and its retained display polygon. The calculated street reference does not certify a roof, parcel, tenant, full campus, legal title or present operation.", "The canonical address remains blank. All status, quantity, physical date, role, identity and jurisdiction wrappers remain exact. Existing native status remains unknown.", "The current City of Hayward SF09 section links this exact October 1, 2012 A-100 interconnection letter and names permit PL-2010-0124. Its first page gives 26464 Corporate Avenue as the approved customer substation site for that permit. This is one site service street reference only. No substation roof, independent data hall, present operation, construction date or permit approval fact is adopted. The city office at 777 B Street and PG&E office at 245 Market Street are excluded." ], "sources": [ { "url": "https://www.hayward-ca.gov/sites/default/files/2026-06/CMO-Data-Centers-Amazon-Data-Center-SF09-121005.pdf", "host": "www.hayward-ca.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Official filing numeric site address section only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=26464+Corporate+Avenue%2C+Hayward%2C+CA&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Calculated Census street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-122.11689581031924%2C37.62322706590553%2C-122.10895627888276%2C37.62951524413047&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Viewed aerial setting only, acquisition date unknown" }, { "url": "https://www.hayward-ca.gov/business/for-developers/data-center-development-applications", "host": "www.hayward-ca.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Current SF09 section links this exact historic PL-2010-0124 notice" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 45", "scope": "The current original City of Hayward table explicitly labels Amazon SF09 currently operating. Agency reported operation is limited to that exact named code. The linked document labeled Notice of Decision is actually an October 2012 utility interconnection letter and proposed construction notice for the broader A 100 connection. Its January and June 2013 forecasts are not actual construction or opening dates. Current status relies on the City table, not the old utility letter. No capacity, exact opening, service uptime or completed phase count is promoted.", "fields": { "current_stage_evidence": { "outcome": "current_city_table_explicit_sf09_operation", "scope": "The current original City of Hayward table explicitly labels Amazon SF09 currently operating. Agency reported operation is limited to that exact named code. The linked document labeled Notice of Decision is actually an October 2012 utility interconnection letter and proposed construction notice for the broader A 100 connection. Its January and June 2013 forecasts are not actual construction or opening dates. Current status relies on the City table, not the old utility letter. No capacity, exact opening, service uptime or completed phase count is promoted." }, "source_read_scope": { "city_exact_named_status_row_read": true, "linked_utility_document_visual_pages": [ 1, 2, 3 ], "utility_document_total_pages": 6, "remaining_pages_not_reviewed": true, "old_utility_forecasts_not_physical_outcomes": true, "linked_notice_label_not_treated_as_original_use_permit": true } }, "notes": [ "The current original City of Hayward table explicitly labels Amazon SF09 currently operating. Agency reported operation is limited to that exact named code. The linked document labeled Notice of Decision is actually an October 2012 utility interconnection letter and proposed construction notice for the broader A 100 connection. Its January and June 2013 forecasts are not actual construction or opening dates. Current status relies on the City table, not the old utility letter. No capacity, exact opening, service uptime or completed phase count is promoted.", "All existing identity, organization roles, location, jurisdiction, quantity and physical opening fields remain unchanged. Source checks, filing receipts and prospective dates are not physical opening days." ], "sources": [ { "url": "https://www.hayward-ca.gov/business/for-developers/data-center-development-applications", "host": "www.hayward-ca.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.hayward-ca.gov/sites/default/files/2026-06/CMO-Data-Centers-Amazon-Data-Center-SF09-121005.pdf", "host": "www.hayward-ca.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published filing address reference, not a surveyed building or parcel", "summary": "Hayward · Alameda · Source context reviewed", "status_scope": "The current original City of Hayward table explicitly labels Amazon SF09 currently operating. Agency reported operation is limited to that exact named code. The linked document labeled Notice of Decision is actually an October 2012 utility interconnection letter and proposed construction notice for the broader A 100 connection. Its January and June 2013 forecasts are not actual construction or opening dates. Current status relies on the City table, not the old utility letter. No capacity, exact opening, service uptime or completed phase count is promoted." }, { "id": "aws-2550-beech-road-new-albany-oh", "state": "oh", "kind": "facility", "name": "AWS New Albany (2550 Beech Road)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Assessed improvements/abatements are property records, not investment or incentive payments. Official Licking County parcel query returns ownership/location. It does not demonstrate commissioned servers or operating load. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'095-111744-00.000'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.10383, "lng": -82.49647, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "field-verification-2026-10-14.json", "scope": "Field or source context only", "fields": { "parcel": "095-111744-00.000", "parcel_owner": "VADATA INC", "parcel_site_address": "2550 BEECH RD NW", "tax_acres": 67.27, "county": "Licking" }, "notes": [ "Assessed improvements/abatements are property records, not investment or incentive payments.", "Official Licking County parcel query returns ownership/location. It does not demonstrate commissioned servers or operating load.", "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'095-111744-00.000'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "fields": { "current_stage_evidence": { "outcome": "broader_new_albany_market_not_exact_component_stage", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed." }, "source_read_scope": { "selected_section": "August 7, 2025 AWS data centers in New Albany", "current_rolling_source_not_all_articles_read": true, "regional_service_not_transferred_to_every_building": true, "no_site_event_from_broader_market_publication": true } }, "notes": [ "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "aws-3180-beech-road-new-albany-oh", "state": "oh", "kind": "facility", "name": "AWS New Albany (3180 Beech Road)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Assessed improvements/abatements are property records, not investment or incentive payments. 3180 street number is not present in this queried parcel. Official Licking County parcel query returns ownership/location. It does not demonstrate commissioned servers or operating load. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'095-111618-04.000'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.06593, "lng": -82.48081, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "field-verification-2026-10-14.json", "scope": "Field or source context only", "fields": { "parcel": "095-111618-04.000", "parcel_owner": "AMAZON DATA SERVICES INC", "parcel_site_address": "BEECH RD NW", "tax_acres": 106.41, "county": "Licking" }, "notes": [ "Assessed improvements/abatements are property records, not investment or incentive payments.", "3180 street number is not present in this queried parcel.", "Official Licking County parcel query returns ownership/location. It does not demonstrate commissioned servers or operating load.", "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'095-111618-04.000'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "fields": { "current_stage_evidence": { "outcome": "broader_new_albany_market_not_exact_component_stage", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed." }, "source_read_scope": { "selected_section": "August 7, 2025 AWS data centers in New Albany", "current_rolling_source_not_all_articles_read": true, "regional_service_not_transferred_to_every_building": true, "no_site_event_from_broader_market_publication": true } }, "notes": [ "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "aws-arlington-gilliam-or", "state": "or", "kind": "facility", "name": "AWS Arlington Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Gilliam" ], "city": "Arlington", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Land price is not capex; wind energy purchase in MWh annually is not instantaneous site MW or proof of hourly renewable power. No exact construction/opening date given. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://bendbulletin.com/?p=417891", "host": "bendbulletin.com", "date": "2025-02-16", "published": "2025-02-16", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 45.37821, "lng": -120.2112, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Oregonian reporting via Bulletin describes Amazon Arlington land acquisition and additional port land negotiation, with operations potentially years away.", "independently_verified_current_operating_status": null }, "notes": [ "Land price is not capex; wind energy purchase in MWh annually is not instantaneous site MW or proof of hourly renewable power. No exact construction/opening date given.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://bendbulletin.com/?p=417891", "host": "bendbulletin.com", "date": "2025-02-16", "published": "2025-02-16", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Arlington · Gilliam · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "41021" } }, { "id": "aws-beech-road-new-albany-oh", "state": "oh", "kind": "facility", "name": "AWS New Albany (Beech/Miller Road Campus)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=UPPER(OwnerName)+LIKE+'%25AMAZON%25'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.11654, "lng": -82.4639, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 8, "cadastral_error": null, "parcel_assertions": [ { "PID": 93672, "Parcel": "093-106422-00.004", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "2575 NEWTON CT ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 1.64 }, { "PID": 96925, "Parcel": "095-111408-00.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "BEECH RD ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 199.81 }, { "PID": 93874, "Parcel": "095-111618-04.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "BEECH RD NW", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 106.41 }, { "PID": 96928, "Parcel": "095-111648-00.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "MILLER RD NW", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 67.68 }, { "PID": 96932, "Parcel": "095-111870-00.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "BEECH RD NW", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 0.27 }, { "PID": 90304, "Parcel": "095-112074-00.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "2575 NEWTON CT ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 92.69 }, { "PID": 96936, "Parcel": "095-112248-00.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "13757 MILLER RD ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 12.9 }, { "PID": 96941, "Parcel": "095-112248-00.001", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "BEECH RD ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 71.3 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=UPPER(OwnerName)+LIKE+'%25AMAZON%25'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "fields": { "current_stage_evidence": { "outcome": "broader_new_albany_market_not_exact_component_stage", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed." }, "source_read_scope": { "selected_section": "August 7, 2025 AWS data centers in New Albany", "current_rolling_source_not_all_articles_read": true, "regional_service_not_transferred_to_every_building": true, "no_site_event_from_broader_market_publication": true } }, "notes": [ "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "aws-benton-bossier-parish-la", "state": "la", "kind": "facility", "name": "Amazon Web Services Bossier Parish Campus (Benton)", "group": "building", "status": "Company reported construction", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Bossier" ], "city": "Benton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. historical two-campus regional project with potential duplicate operator/customer records. Four upstream AWS/STACK labels may refer to two shared campuses, not four physical sites; exact parcel crosswalk required. 12B is combined, not each. Later August18,2026 third-campus/18B update already separately reviewed in round3; do not present this older regional scope as current total. Programs offered/expected participation not quantified paid awards. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-02-23", "The original State and STACK February 23, 2026 announcements identify the coordinated Caddo and Bossier campus development. This is the public statement day rather than first construction, computing operation or additional physical campuses for each company record." ], [ "2026-06-10", "The original STACK June 10, 2026 release explicitly reports construction already underway at the planned Caddo and Bossier campuses. The publication dates the construction account and community contribution announcement, without dating exact groundbreaking or commissioned computing." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.opportunitylouisiana.gov/news/amazon-selects-louisiana-for-12-billion-data-center-campuses-in-major-u-s-expansion", "host": "opportunitylouisiana.gov", "date": "2026-02-23", "published": "2026-02-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.stackinfra.com/about/news-press/press-releases/stack-infrastructure-announces-data-center-developments-supporting-economic-growth-in-louisiana/", "host": "www.stackinfra.com", "published": "2026-02-23", "date": "2026-02-23", "checked": "2026-10-24", "label": "Reviewed operator source" }, { "url": "https://www.stackinfra.com/about/news-press/press-releases/stack-infrastructure-partners-with-amazon-to-invest-in-northwest-louisiana-communities/", "host": "www.stackinfra.com", "published": "2026-06-10", "date": "2026-06-10", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lat": 32.67819, "lng": -93.60513, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "historical two-campus regional project with potential duplicate operator/customer records", "fields": { "historical_announcement_date": "2026-02-23", "historical_regional_planned_investment_usd": 12000000000, "expected_regional_direct_jobs": 540, "expected_regional_indirect_jobs": 1700, "expected_regional_construction_jobs_max": 1500, "developer_owner": "STACK Infrastructure", "customer": "Amazon", "regional_scope": "Caddo and Bossier Parishes" }, "notes": [ "Four upstream AWS/STACK labels may refer to two shared campuses, not four physical sites; exact parcel crosswalk required. 12B is combined, not each. Later August18,2026 third-campus/18B update already separately reviewed in round3; do not present this older regional scope as current total. Programs offered/expected participation not quantified paid awards.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.opportunitylouisiana.gov/news/amazon-selects-louisiana-for-12-billion-data-center-campuses-in-major-u-s-expansion", "host": "opportunitylouisiana.gov", "date": "2026-02-23", "published": "2026-02-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 77", "scope": "The complete original State and developer February 23 announcements identify the coordinated Amazon and STACK campus development in Caddo and Bossier Parishes. The complete original June 10 developer release explicitly reports construction already underway at both planned parish campuses. This supports company reported construction at the Bossier parish campus scope, without computing commissioning or independent completion of every phase. The earlier imminent start forecast alone is not the basis for construction. Existing separate Amazon and STACK company records are not counted as four newly discovered physical campuses, merged or assigned new corporate roles. The selected sources do not independently refine the exact municipal or parcel placement. Community funding, future jobs, utility payments and full investment remain attributed accounts rather than measured delivered benefits or installed computing capacity.", "fields": { "current_stage_evidence": { "outcome": "developer_explicit_named_parish_campus_construction", "scope": "The complete original State and developer February 23 announcements identify the coordinated Amazon and STACK campus development in Caddo and Bossier Parishes. The complete original June 10 developer release explicitly reports construction already underway at both planned parish campuses. This supports company reported construction at the Bossier parish campus scope, without computing commissioning or independent completion of every phase. The earlier imminent start forecast alone is not the basis for construction. Existing separate Amazon and STACK company records are not counted as four newly discovered physical campuses, merged or assigned new corporate roles. The selected sources do not independently refine the exact municipal or parcel placement. Community funding, future jobs, utility payments and full investment remain attributed accounts rather than measured delivered benefits or installed computing capacity." }, "source_read_scope": { "complete_original_state_and_both_developer_release_bodies_read": true, "june10_explicit_construction_not_february_forecast_alone": true, "existing_company_records_not_four_new_physical_campuses": true, "no_identity_role_municipal_or_parcel_changes": true, "no_jobs_funding_resource_or_capacity_measurements_adopted": true } }, "notes": [ "The complete original State and developer February 23 announcements identify the coordinated Amazon and STACK campus development in Caddo and Bossier Parishes. The complete original June 10 developer release explicitly reports construction already underway at both planned parish campuses. This supports company reported construction at the Bossier parish campus scope, without computing commissioning or independent completion of every phase. The earlier imminent start forecast alone is not the basis for construction. Existing separate Amazon and STACK company records are not counted as four newly discovered physical campuses, merged or assigned new corporate roles. The selected sources do not independently refine the exact municipal or parcel placement. Community funding, future jobs, utility payments and full investment remain attributed accounts rather than measured delivered benefits or installed computing capacity.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://www.opportunitylouisiana.gov/news/amazon-selects-louisiana-for-12-billion-data-center-campuses-in-major-u-s-expansion", "host": "www.opportunitylouisiana.gov", "published": "2026-02-23", "date": "2026-02-23", "checked": "2026-10-24", "label": "Reviewed government record" }, { "url": "https://www.stackinfra.com/about/news-press/press-releases/stack-infrastructure-announces-data-center-developments-supporting-economic-growth-in-louisiana/", "host": "www.stackinfra.com", "published": "2026-02-23", "date": "2026-02-23", "checked": "2026-10-24", "label": "Reviewed operator source" }, { "url": "https://www.stackinfra.com/about/news-press/press-releases/stack-infrastructure-partners-with-amazon-to-invest-in-northwest-louisiana-communities/", "host": "www.stackinfra.com", "published": "2026-06-10", "date": "2026-06-10", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Benton · Bossier · Source context reviewed", "status_scope": "The complete original State and developer February 23 announcements identify the coordinated Amazon and STACK campus development in Caddo and Bossier Parishes. The complete original June 10 developer release explicitly reports construction already underway at both planned parish campuses. This supports company reported construction at the Bossier parish campus scope, without computing commissioning or independent completion of every phase. The earlier imminent start forecast alone is not the basis for construction. Existing separate Amazon and STACK company records are not counted as four newly discovered physical campuses, merged or assigned new corporate roles. The selected sources do not independently refine the exact municipal or parcel placement. Community funding, future jobs, utility payments and full investment remain attributed accounts rather than measured delivered benefits or installed computing capacity.", "event_evidence": [ { "date": "2026-02-23", "text": "The original State and STACK February 23, 2026 announcements identify the coordinated Caddo and Bossier campus development. This is the public statement day rather than first construction, computing operation or additional physical campuses for each company record.", "kind": "announced", "sources": [ { "url": "https://www.opportunitylouisiana.gov/news/amazon-selects-louisiana-for-12-billion-data-center-campuses-in-major-u-s-expansion", "host": "www.opportunitylouisiana.gov", "published": "2026-02-23", "date": "2026-02-23", "checked": "2026-10-24", "label": "Reviewed government record" }, { "url": "https://www.stackinfra.com/about/news-press/press-releases/stack-infrastructure-announces-data-center-developments-supporting-economic-growth-in-louisiana/", "host": "www.stackinfra.com", "published": "2026-02-23", "date": "2026-02-23", "checked": "2026-10-24", "label": "Reviewed operator source" } ] }, { "date": "2026-06-10", "text": "The original STACK June 10, 2026 release explicitly reports construction already underway at the planned Caddo and Bossier campuses. The publication dates the construction account and community contribution announcement, without dating exact groundbreaking or commissioned computing.", "kind": "announced", "sources": [ { "url": "https://www.stackinfra.com/about/news-press/press-releases/stack-infrastructure-partners-with-amazon-to-invest-in-northwest-louisiana-communities/", "host": "www.stackinfra.com", "published": "2026-06-10", "date": "2026-06-10", "checked": "2026-10-24", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "22015" } }, { "id": "aws-blanchard-caddo-parish-la", "state": "la", "kind": "facility", "name": "Amazon Web Services Caddo Parish Campus (Blanchard)", "group": "building", "status": "Company reported construction", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Caddo" ], "city": "Blanchard", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. historical two-campus regional project with potential duplicate operator/customer records. Four upstream AWS/STACK labels may refer to two shared campuses, not four physical sites; exact parcel crosswalk required. 12B is combined, not each. Later August18,2026 third-campus/18B update already separately reviewed in round3; do not present this older regional scope as current total. Programs offered/expected participation not quantified paid awards. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-02-23", "The original State and STACK February 23, 2026 announcements identify the coordinated Caddo and Bossier campus development. This is the public statement day rather than first construction, computing operation or additional physical campuses for each company record." ], [ "2026-06-10", "The original STACK June 10, 2026 release explicitly reports construction already underway at the planned Caddo and Bossier campuses. The publication dates the construction account and community contribution announcement, without dating exact groundbreaking or commissioned computing." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.opportunitylouisiana.gov/news/amazon-selects-louisiana-for-12-billion-data-center-campuses-in-major-u-s-expansion", "host": "opportunitylouisiana.gov", "date": "2026-02-23", "published": "2026-02-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.stackinfra.com/about/news-press/press-releases/stack-infrastructure-announces-data-center-developments-supporting-economic-growth-in-louisiana/", "host": "www.stackinfra.com", "published": "2026-02-23", "date": "2026-02-23", "checked": "2026-10-24", "label": "Reviewed operator source" }, { "url": "https://www.stackinfra.com/about/news-press/press-releases/stack-infrastructure-partners-with-amazon-to-invest-in-northwest-louisiana-communities/", "host": "www.stackinfra.com", "published": "2026-06-10", "date": "2026-06-10", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lat": 32.58038, "lng": -93.88281, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "historical two-campus regional project with potential duplicate operator/customer records", "fields": { "historical_announcement_date": "2026-02-23", "historical_regional_planned_investment_usd": 12000000000, "expected_regional_direct_jobs": 540, "expected_regional_indirect_jobs": 1700, "expected_regional_construction_jobs_max": 1500, "developer_owner": "STACK Infrastructure", "customer": "Amazon", "regional_scope": "Caddo and Bossier Parishes" }, "notes": [ "Four upstream AWS/STACK labels may refer to two shared campuses, not four physical sites; exact parcel crosswalk required. 12B is combined, not each. Later August18,2026 third-campus/18B update already separately reviewed in round3; do not present this older regional scope as current total. Programs offered/expected participation not quantified paid awards.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.opportunitylouisiana.gov/news/amazon-selects-louisiana-for-12-billion-data-center-campuses-in-major-u-s-expansion", "host": "opportunitylouisiana.gov", "date": "2026-02-23", "published": "2026-02-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 77", "scope": "The complete original State and developer February 23 announcements identify the coordinated Amazon and STACK campus development in Caddo and Bossier Parishes. The complete original June 10 developer release explicitly reports construction already underway at both planned parish campuses. This supports company reported construction at the Caddo parish campus scope, without computing commissioning or independent completion of every phase. The earlier imminent start forecast alone is not the basis for construction. Existing separate Amazon and STACK company records are not counted as four newly discovered physical campuses, merged or assigned new corporate roles. The selected sources do not independently refine the exact municipal or parcel placement. Community funding, future jobs, utility payments and full investment remain attributed accounts rather than measured delivered benefits or installed computing capacity.", "fields": { "current_stage_evidence": { "outcome": "developer_explicit_named_parish_campus_construction", "scope": "The complete original State and developer February 23 announcements identify the coordinated Amazon and STACK campus development in Caddo and Bossier Parishes. The complete original June 10 developer release explicitly reports construction already underway at both planned parish campuses. This supports company reported construction at the Caddo parish campus scope, without computing commissioning or independent completion of every phase. The earlier imminent start forecast alone is not the basis for construction. Existing separate Amazon and STACK company records are not counted as four newly discovered physical campuses, merged or assigned new corporate roles. The selected sources do not independently refine the exact municipal or parcel placement. Community funding, future jobs, utility payments and full investment remain attributed accounts rather than measured delivered benefits or installed computing capacity." }, "source_read_scope": { "complete_original_state_and_both_developer_release_bodies_read": true, "june10_explicit_construction_not_february_forecast_alone": true, "existing_company_records_not_four_new_physical_campuses": true, "no_identity_role_municipal_or_parcel_changes": true, "no_jobs_funding_resource_or_capacity_measurements_adopted": true } }, "notes": [ "The complete original State and developer February 23 announcements identify the coordinated Amazon and STACK campus development in Caddo and Bossier Parishes. The complete original June 10 developer release explicitly reports construction already underway at both planned parish campuses. This supports company reported construction at the Caddo parish campus scope, without computing commissioning or independent completion of every phase. The earlier imminent start forecast alone is not the basis for construction. Existing separate Amazon and STACK company records are not counted as four newly discovered physical campuses, merged or assigned new corporate roles. The selected sources do not independently refine the exact municipal or parcel placement. Community funding, future jobs, utility payments and full investment remain attributed accounts rather than measured delivered benefits or installed computing capacity.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://www.opportunitylouisiana.gov/news/amazon-selects-louisiana-for-12-billion-data-center-campuses-in-major-u-s-expansion", "host": "www.opportunitylouisiana.gov", "published": "2026-02-23", "date": "2026-02-23", "checked": "2026-10-24", "label": "Reviewed government record" }, { "url": "https://www.stackinfra.com/about/news-press/press-releases/stack-infrastructure-announces-data-center-developments-supporting-economic-growth-in-louisiana/", "host": "www.stackinfra.com", "published": "2026-02-23", "date": "2026-02-23", "checked": "2026-10-24", "label": "Reviewed operator source" }, { "url": "https://www.stackinfra.com/about/news-press/press-releases/stack-infrastructure-partners-with-amazon-to-invest-in-northwest-louisiana-communities/", "host": "www.stackinfra.com", "published": "2026-06-10", "date": "2026-06-10", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Blanchard · Caddo · Source context reviewed", "status_scope": "The complete original State and developer February 23 announcements identify the coordinated Amazon and STACK campus development in Caddo and Bossier Parishes. The complete original June 10 developer release explicitly reports construction already underway at both planned parish campuses. This supports company reported construction at the Caddo parish campus scope, without computing commissioning or independent completion of every phase. The earlier imminent start forecast alone is not the basis for construction. Existing separate Amazon and STACK company records are not counted as four newly discovered physical campuses, merged or assigned new corporate roles. The selected sources do not independently refine the exact municipal or parcel placement. Community funding, future jobs, utility payments and full investment remain attributed accounts rather than measured delivered benefits or installed computing capacity.", "event_evidence": [ { "date": "2026-02-23", "text": "The original State and STACK February 23, 2026 announcements identify the coordinated Caddo and Bossier campus development. This is the public statement day rather than first construction, computing operation or additional physical campuses for each company record.", "kind": "announced", "sources": [ { "url": "https://www.opportunitylouisiana.gov/news/amazon-selects-louisiana-for-12-billion-data-center-campuses-in-major-u-s-expansion", "host": "www.opportunitylouisiana.gov", "published": "2026-02-23", "date": "2026-02-23", "checked": "2026-10-24", "label": "Reviewed government record" }, { "url": "https://www.stackinfra.com/about/news-press/press-releases/stack-infrastructure-announces-data-center-developments-supporting-economic-growth-in-louisiana/", "host": "www.stackinfra.com", "published": "2026-02-23", "date": "2026-02-23", "checked": "2026-10-24", "label": "Reviewed operator source" } ] }, { "date": "2026-06-10", "text": "The original STACK June 10, 2026 release explicitly reports construction already underway at the planned Caddo and Bossier campuses. The publication dates the construction account and community contribution announcement, without dating exact groundbreaking or commissioned computing.", "kind": "announced", "sources": [ { "url": "https://www.stackinfra.com/about/news-press/press-releases/stack-infrastructure-partners-with-amazon-to-invest-in-northwest-louisiana-communities/", "host": "www.stackinfra.com", "published": "2026-06-10", "date": "2026-06-10", "checked": "2026-10-24", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "22017" } }, { "id": "aws-butts-county-ga", "state": "ga", "kind": "facility", "name": "AWS Butts County Data Center Campus", "group": "proposed", "status": "Project listed for development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Butts" ], "city": "Jackson", "address": "", "who": "Amazon", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. AWS combined Georgia investment statement. Do not assign full two-county investment or all550jobs to Butts County alone. Amazon statewide workforce, solar household-equivalents and GDP are other scopes. Announcement is planned investment, not actual expenditure or per-campus IT MW. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2025-01-07", "Amazon published its Georgia infrastructure investment announcement January 7, 2025 and explicitly named Butts County. This is the source announcement day, not a physical construction or opening date." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.aboutamazon.com/news/aws/aws-investment-georgia-ai-cloud-infrastructure", "host": "aboutamazon.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 33.28715, "lng": -83.95669, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "primary-source-review-round9-2026-10-14.json", "scope": "AWS combined Georgia investment statement", "fields": { "investment_scope": "Butts and Douglas counties, Georgia, combined", "planned_investment_usd": 11000000000, "expected_direct_jobs_min_inclusive": 550 }, "notes": [ "Do not assign full two-county investment or all550jobs to Butts County alone. Amazon statewide workforce, solar household-equivalents and GDP are other scopes. Announcement is planned investment, not actual expenditure or per-campus IT MW.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/aws-investment-georgia-ai-cloud-infrastructure", "host": "aboutamazon.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Company role source check 04, October 22, 2026", "scope": "Amazon identifies AWS as developing data center infrastructure in Butts County. Developer is the provider brand role for the existing county research context. The announcement does not independently identify a parcel, a specific building, a legal ownership entity or current construction or operation. No announced investment or employment figure is promoted.", "fields": { "company_association": { "name": "Amazon", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Amazon identifies AWS as developing data center infrastructure in Butts County. Developer is the provider brand role for the existing county research context. The announcement does not independently identify a parcel, a specific building, a legal ownership entity or current construction or operation. No announced investment or employment figure is promoted." }, "provider_role": "developer" }, "notes": [ "Amazon identifies AWS as developing data center infrastructure in Butts County. Developer is the provider brand role for the existing county research context. The announcement does not independently identify a parcel, a specific building, a legal ownership entity or current construction or operation. No announced investment or employment figure is promoted.", "Source dates remain separate from physical milestones and the retained status field." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/aws-investment-georgia-ai-cloud-infrastructure", "host": "www.aboutamazon.com", "published": "2025-01-07", "date": "2025-01-07", "checked": "2026-10-22", "label": "First party named community development or operation statement" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 37", "scope": "Amazon original January 7, 2025 announcement explicitly names Butts County among the selected Georgia locations for new AWS data centers. Project listed for development is limited to that named investment plan. Its statewide investment and job forecasts and existing Amazon logistics facilities do not establish current construction, commissioned computing, delivered jobs or an exact campus opening. No statewide quantity is assigned to this component.", "fields": { "current_stage_evidence": { "outcome": "named_butts_county_development_announcement", "scope": "Amazon original January 7, 2025 announcement explicitly names Butts County among the selected Georgia locations for new AWS data centers. Project listed for development is limited to that named investment plan. Its statewide investment and job forecasts and existing Amazon logistics facilities do not establish current construction, commissioned computing, delivered jobs or an exact campus opening. No statewide quantity is assigned to this component." } }, "notes": [ "Amazon original January 7, 2025 announcement explicitly names Butts County among the selected Georgia locations for new AWS data centers. Project listed for development is limited to that named investment plan. Its statewide investment and job forecasts and existing Amazon logistics facilities do not establish current construction, commissioned computing, delivered jobs or an exact campus opening. No statewide quantity is assigned to this component.", "Existing identities, roles, locations, jurisdictions, quantities and physical opening fields remain exact. Source publication, check dates, forecasts and physical milestones have distinct meanings." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/aws-investment-georgia-ai-cloud-infrastructure", "host": "www.aboutamazon.com", "published": "2025-01-07", "date": "2025-01-07", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Jackson · Butts · Source context reviewed", "status_scope": "Amazon original January 7, 2025 announcement explicitly names Butts County among the selected Georgia locations for new AWS data centers. Project listed for development is limited to that named investment plan. Its statewide investment and job forecasts and existing Amazon logistics facilities do not establish current construction, commissioned computing, delivered jobs or an exact campus opening. No statewide quantity is assigned to this component.", "event_evidence": [ { "date": "2025-01-07", "text": "Amazon published its Georgia infrastructure investment announcement January 7, 2025 and explicitly named Butts County. This is the source announcement day, not a physical construction or opening date.", "kind": "announced", "sources": [ { "url": "https://www.aboutamazon.com/news/aws/aws-investment-georgia-ai-cloud-infrastructure", "host": "www.aboutamazon.com", "published": "2025-01-07", "date": "2025-01-07", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "13035" } }, { "id": "aws-calvert-cliffs-md", "state": "md", "kind": "facility", "name": "AWS Calvert County Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Calvert" ], "city": "Lusby", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Calvert county policy and withdrawn AWS application, not operating campus. County summary not separately read signed ordinance or termination instruments. Exact legal moratorium expiry remains unknown; do not calculate it. August4 is withdrawal announcement, not independently exact filing date. ENRA expiry does not prove all possible private proposals permanently cancelled. Generic jobs examples not local forecasts. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-08-04", "The County reports that its Board announced formal withdrawal of the AWS conceptual site development plan application on August 4, 2026. This dates the County announcement, not an independently established withdrawal filing day or physical closure of an operating facility." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.calvertcountymd.gov/3880/Data-Centers", "host": "calvertcountymd.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.choosecalvert.com/4059/Amazon-Web-Services", "host": "www.choosecalvert.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 38.54407, "lng": -76.56909, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "Calvert county policy and withdrawn AWS application, not operating campus", "fields": { "county_reported_moratorium_adoption_date": "2026-08-18", "moratorium_duration_months": 6, "ordinance_identifier": "42-26", "county_reported_aws_withdrawal_public_update_date": "2026-08-04", "county_reported_latest_enra_expiration": "2026-05-17", "current_county_statement": "no data-center site applications pending" }, "notes": [ "County summary not separately read signed ordinance or termination instruments. Exact legal moratorium expiry remains unknown; do not calculate it. August4 is withdrawal announcement, not independently exact filing date. ENRA expiry does not prove all possible private proposals permanently cancelled. Generic jobs examples not local forecasts.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.calvertcountymd.gov/3880/Data-Centers", "host": "calvertcountymd.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 50", "scope": "The County original AWS page states that the Board announced formal withdrawal of the Calvert Technology Center conceptual site development plan application at its August 4, 2026 meeting. This is a reported application withdrawal, not physical shutdown of an operating data center. Current physical computing stage remains unclear. Older no application language farther down the same page is superseded by the explicit withdrawal and processed application sections, not adopted as a current assertion.", "fields": { "current_stage_evidence": { "outcome": "reported_application_withdrawal_not_physical_shutdown", "scope": "The County original AWS page states that the Board announced formal withdrawal of the Calvert Technology Center conceptual site development plan application at its August 4, 2026 meeting. This is a reported application withdrawal, not physical shutdown of an operating data center. Current physical computing stage remains unclear. Older no application language farther down the same page is superseded by the explicit withdrawal and processed application sections, not adopted as a current assertion." } }, "notes": [ "The County original AWS page states that the Board announced formal withdrawal of the Calvert Technology Center conceptual site development plan application at its August 4, 2026 meeting. This is a reported application withdrawal, not physical shutdown of an operating data center. Current physical computing stage remains unclear. Older no application language farther down the same page is superseded by the explicit withdrawal and processed application sections, not adopted as a current assertion.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.choosecalvert.com/4059/Amazon-Web-Services", "host": "www.choosecalvert.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.calvertcountymd.gov/3880/Data-Centers", "host": "www.calvertcountymd.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lusby · Calvert · Source context reviewed", "event_evidence": [ { "date": "2026-08-04", "text": "The County reports that its Board announced formal withdrawal of the AWS conceptual site development plan application on August 4, 2026. This dates the County announcement, not an independently established withdrawal filing day or physical closure of an operating facility.", "kind": "withdrawn", "sources": [ { "url": "https://www.choosecalvert.com/4059/Amazon-Web-Services", "host": "www.choosecalvert.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "24009" } }, { "id": "aws-clinton-hinds-ms", "state": "ms", "kind": "facility", "name": "AWS Clinton Data Center", "group": "building", "status": "Agency reported construction", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Hinds" ], "city": "Clinton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Clinton municipal AWS reuse announcement. 1Bplanned investment, not actual spent or separate amount to add again to Amazon statewide25B. Reused industrial plant not newly built whole facility from scratch. Thousands of additional construction/supplychain jobs not all permanent direct onsite. Ceremony/announcement not actual customer opening; no ITMW or exact parcel in reviewed section. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-06-09", "The original Clinton City June 9, 2026 publication describes the AWS former Delphi conversion and celebrates its investment. This dates the City statement rather than an exact first construction day, commissioned computing opening or accomplished future benefits." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://clintonms.org/awsdatacenter/", "host": "clintonms.org", "date": "2026-06-09", "published": "2026-06-09", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/company-news/amazon-25-billion-mississippi-data-centers", "host": "www.aboutamazon.com", "published": "2026-04-09", "date": "2026-04-09", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lat": 32.26649, "lng": -90.44266, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Clinton municipal AWS reuse announcement", "fields": { "agency": "City of Clinton, Mississippi", "announcement_date": "2026-06-09", "project_operator": "AWS", "project_use": "repurpose former Delphi manufacturing plant as data center", "planned_investment_usd": 1000000000, "expected_full_operation_positions_min_inclusive": 100 }, "notes": [ "1Bplanned investment, not actual spent or separate amount to add again to Amazon statewide25B. Reused industrial plant not newly built whole facility from scratch. Thousands of additional construction/supplychain jobs not all permanent direct onsite. Ceremony/announcement not actual customer opening; no ITMW or exact parcel in reviewed section.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://clintonms.org/awsdatacenter/", "host": "clintonms.org", "date": "2026-06-09", "published": "2026-06-09", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 75", "scope": "The complete original City release says AWS is repurposing the former Delphi plant, and the original issuer update expressly describes that transformation. Together these support agency and company reported conversion construction at the statement scope. Celebrating investment is not a computing opening. Projected jobs, tax receipts, water commitments, electricity rates and statewide savings remain attributed prospective or aggregate accounts, not independently measured results for this building. No installed capacity, opening day, operator role or local legal outcome is inferred.", "fields": { "current_stage_evidence": { "outcome": "city_and_issuer_named_former_delphi_conversion", "scope": "The complete original City release says AWS is repurposing the former Delphi plant, and the original issuer update expressly describes that transformation. Together these support agency and company reported conversion construction at the statement scope. Celebrating investment is not a computing opening. Projected jobs, tax receipts, water commitments, electricity rates and statewide savings remain attributed prospective or aggregate accounts, not independently measured results for this building. No installed capacity, opening day, operator role or local legal outcome is inferred." }, "source_read_scope": { "complete_original_city_and_issuer_bodies_read": true, "explicit_repurposing_not_investment_alone": true, "issuer_original_jsonld_date_published20260409_read": true, "no_statewide_savings_as_building_measurement": true, "no_power_water_jobs_capacity_or_role_changes": true } }, "notes": [ "The complete original City release says AWS is repurposing the former Delphi plant, and the original issuer update expressly describes that transformation. Together these support agency and company reported conversion construction at the statement scope. Celebrating investment is not a computing opening. Projected jobs, tax receipts, water commitments, electricity rates and statewide savings remain attributed prospective or aggregate accounts, not independently measured results for this building. No installed capacity, opening day, operator role or local legal outcome is inferred.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://clintonms.org/awsdatacenter/", "host": "clintonms.org", "published": "2026-06-09", "date": "2026-06-09", "checked": "2026-10-24", "label": "Reviewed government record" }, { "url": "https://www.aboutamazon.com/news/company-news/amazon-25-billion-mississippi-data-centers", "host": "www.aboutamazon.com", "published": "2026-04-09", "date": "2026-04-09", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Clinton · Hinds · Source context reviewed", "status_scope": "The complete original City release says AWS is repurposing the former Delphi plant, and the original issuer update expressly describes that transformation. Together these support agency and company reported conversion construction at the statement scope. Celebrating investment is not a computing opening. Projected jobs, tax receipts, water commitments, electricity rates and statewide savings remain attributed prospective or aggregate accounts, not independently measured results for this building. No installed capacity, opening day, operator role or local legal outcome is inferred.", "event_evidence": [ { "date": "2026-06-09", "text": "The original Clinton City June 9, 2026 publication describes the AWS former Delphi conversion and celebrates its investment. This dates the City statement rather than an exact first construction day, commissioned computing opening or accomplished future benefits.", "kind": "announced", "sources": [ { "url": "https://clintonms.org/awsdatacenter/", "host": "clintonms.org", "published": "2026-06-09", "date": "2026-06-09", "checked": "2026-10-24", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "28049" } }, { "id": "aws-cosgray-hilliard-oh", "state": "oh", "kind": "facility", "name": "AWS Cosgray Road Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Hilliard", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Preferred city FAQ concerns the Scioto Darby Creek Road campus at 4186 Scioto Darby Creek Road. Do not assign its fuel-cell capacity, incentives or area to this different Hilliard record. Correct-site crosswalk required. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.96955, "lng": -83.00956, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": {}, "notes": [ "Preferred city FAQ concerns the Scioto Darby Creek Road campus at 4186 Scioto Darby Creek Road. Do not assign its fuel-cell capacity, incentives or area to this different Hilliard record. Correct-site crosswalk required.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "encore-2026-10-17-batch1", "scope": "Limited source identity and stage review; not whole-record certification, parcel verification or a physical-site census.", "fields": { "current_stage_evidence": { "outcome": "unresolved", "scope": "Hilliard’s fuel-cell FAQ concerns Amazon’s Scioto Darby Creek Road campus, not an independently matched Cosgray project. Its 72.9 MW is proposed generation context; approval and forecast dates do not establish current commissioning or this record’s IT capacity." } }, "notes": [ "Hilliard’s fuel-cell FAQ concerns Amazon’s Scioto Darby Creek Road campus, not an independently matched Cosgray project. Its 72.9 MW is proposed generation context; approval and forecast dates do not establish current commissioning or this record’s IT capacity." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed primary source" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "The current City fuel cell FAQ explicitly concerns Scioto Darby Creek Road. That separate campus project does not establish the individual current phase of this inherited Hilliard component. General AWS operations, utility generation approvals and municipality level accounts are not transferred between Cosgray, Hayden Run and Scioto Darby. Exact physical phase remains unclear.", "fields": { "current_stage_evidence": { "outcome": "separate_scioto_darby_source_does_not_resolve_this_hilliard_component", "scope": "The current City fuel cell FAQ explicitly concerns Scioto Darby Creek Road. That separate campus project does not establish the individual current phase of this inherited Hilliard component. General AWS operations, utility generation approvals and municipality level accounts are not transferred between Cosgray, Hayden Run and Scioto Darby. Exact physical phase remains unclear." } }, "notes": [ "The current City fuel cell FAQ explicitly concerns Scioto Darby Creek Road. That separate campus project does not establish the individual current phase of this inherited Hilliard component. General AWS operations, utility generation approvals and municipality level accounts are not transferred between Cosgray, Hayden Run and Scioto Darby. Exact physical phase remains unclear.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hilliard · Franklin · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39049" } }, { "id": "aws-costas-ridgeland-ms", "state": "ms", "kind": "facility", "name": "AWS Costas Property Campus (Ridgeland)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Madison" ], "city": "Ridgeland", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Combined investment and job commitments must not be assigned fully to each site. Warehouse and data center uses differ; historical forecast is not current delivery. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://magnoliatribune.com/?p=118379", "host": "magnoliatribune.com", "date": "2024-07-24", "published": "2024-07-24", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/company-news/amazon-25-billion-mississippi-data-centers", "host": "www.aboutamazon.com", "published": "2026-04-09", "date": "2026-04-09", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lat": 32.63505, "lng": -90.03336, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Magnolia Tribune identifies Costas/Ridgeland and Canton sites within a combined Madison County AWS plan, with 2027 completion forecast.", "independently_verified_current_operating_status": null }, "notes": [ "Combined investment and job commitments must not be assigned fully to each site. Warehouse and data center uses differ; historical forecast is not current delivery.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://magnoliatribune.com/?p=118379", "host": "magnoliatribune.com", "date": "2024-07-24", "published": "2024-07-24", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 75", "scope": "The complete original Amazon statewide update describes Madison County investment and a Canton campus, but does not independently name the inherited Costas Ridgeland record or establish its exact campus crosswalk. Regional construction and operational staffing do not independently commission this exact record. A Canton water forecast is not a Ridgeland measured resource result. Current physical stage and separate campus identity remain held.", "fields": { "current_stage_evidence": { "outcome": "regional_amazon_account_exact_costas_ridgeland_crosswalk_held", "scope": "The complete original Amazon statewide update describes Madison County investment and a Canton campus, but does not independently name the inherited Costas Ridgeland record or establish its exact campus crosswalk. Regional construction and operational staffing do not independently commission this exact record. A Canton water forecast is not a Ridgeland measured resource result. Current physical stage and separate campus identity remain held." }, "source_read_scope": { "complete_original_statewide_issuer_body_read": true, "county_or_canton_not_automatic_ridgeland_identity": true, "no_regional_staffing_or_water_forecast_as_exact_operation": true } }, "notes": [ "The complete original Amazon statewide update describes Madison County investment and a Canton campus, but does not independently name the inherited Costas Ridgeland record or establish its exact campus crosswalk. Regional construction and operational staffing do not independently commission this exact record. A Canton water forecast is not a Ridgeland measured resource result. Current physical stage and separate campus identity remain held.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://www.aboutamazon.com/news/company-news/amazon-25-billion-mississippi-data-centers", "host": "www.aboutamazon.com", "published": "2026-04-09", "date": "2026-04-09", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Ridgeland · Madison · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "28089" } }, { "id": "aws-crosby-court-franklin-county-oh", "state": "oh", "kind": "facility", "name": "AWS Crosby Court Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Plain City", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D'275-000010'&outFields=PARCELID,SITEADDRESS,OWNERNME1,CLASSDSCRP,BLDGAREA,ACRES&returnCentroid=true&outSR=4326&f=json", "host": "gis.franklincountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.98131, "lng": -83.02239, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PARCELID": "275-000010", "SITEADDRESS": "6685 - 6685 CROSBY CT", "OWNERNME1": "VADATA INC", "BLDGAREA": 768498, "ACRES": 66.82486614 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D'275-000010'&outFields=PARCELID,SITEADDRESS,OWNERNME1,CLASSDSCRP,BLDGAREA,ACRES&returnCentroid=true&outSR=4326&f=json", "host": "gis.franklincountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Plain City · Franklin · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39049" } }, { "id": "aws-cumulus-salem-township-pa", "state": "pa", "kind": "facility", "name": "AWS Cumulus Data Center Campus, Salem Township", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Luzerne" ], "city": "Salem Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Statewide exemption-cost estimates are not a known Amazon award amount. Two-campus commitment is not per-site spending; labor and energy claims remain attributed and dated. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://technical.ly/civics/amazon-data-centers-tax-break/", "host": "technical.ly", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-pennsylvania-investment-cloud-infrastructure-ai-innovation", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 41.17689, "lng": -75.98916, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Spotlight PA reporting via Technical.ly describes Salem Township and Falls Township AWS investments, state sales-tax exemption and workforce support.", "independently_verified_current_operating_status": null }, "notes": [ "Statewide exemption-cost estimates are not a known Amazon award amount. Two-campus commitment is not per-site spending; labor and energy claims remain attributed and dated.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://technical.ly/civics/amazon-data-centers-tax-break/", "host": "technical.ly", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 28", "scope": "DEP original project CSV separately lists Salem Amazon Phase 1 as DEP Review Complete and Phase 2 as under review. Related Phase 1 permit rows still include pending amendments and a not yet submitted item, so the aggregate title is not every approval complete. Amazon current investment announcement describes future campuses and is not itself commissioning of the exact inherited Cumulus component. A water system operations approval is not data center operation. Existing power supply, a broader campus investment, individual permitted infrastructure and future expansion remain distinct. Exact current computing operation and the inherited component crosswalk remain unclear.", "fields": { "current_stage_evidence": { "outcome": "salem_phase_and_individual_permit_scopes_not_exact_cumulus_operation", "scope": "DEP original project CSV separately lists Salem Amazon Phase 1 as DEP Review Complete and Phase 2 as under review. Related Phase 1 permit rows still include pending amendments and a not yet submitted item, so the aggregate title is not every approval complete. Amazon current investment announcement describes future campuses and is not itself commissioning of the exact inherited Cumulus component. A water system operations approval is not data center operation. Existing power supply, a broader campus investment, individual permitted infrastructure and future expansion remain distinct. Exact current computing operation and the inherited component crosswalk remain unclear." }, "tracker_scope": { "project_ids": [ "10000002", "10000066" ], "phase1_aggregate_and_related_pending_rows_differ": true, "water_system_operations_not_data_center_operations": true, "no_site_or_jurisdiction_change": true } }, "notes": [ "DEP original project CSV separately lists Salem Amazon Phase 1 as DEP Review Complete and Phase 2 as under review. Related Phase 1 permit rows still include pending amendments and a not yet submitted item, so the aggregate title is not every approval complete. Amazon current investment announcement describes future campuses and is not itself commissioning of the exact inherited Cumulus component. A water system operations approval is not data center operation. Existing power supply, a broader campus investment, individual permitted infrastructure and future expansion remain distinct. Exact current computing operation and the inherited component crosswalk remain unclear.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-pennsylvania-investment-cloud-infrastructure-ai-innovation", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Salem Township · Luzerne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42079" } }, { "id": "aws-falls-township-pa", "state": "pa", "kind": "facility", "name": "Amazon Web Services Innovation Campus, Falls Township", "group": "approved", "status": "Reported land use approval", "raw_status": "approved", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Bucks" ], "city": "Falls Township", "address": "", "who": "Amazon", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Falls municipal Amazon announcement and land-plan scopes. 20Band1250jobs statewide not Falls-only.1800ac entire redevelopment not DC footprint. Existingbuilding6distributionplan modified and247acphase2separate scopes;do not call all structures operating DCs. Preliminary/final land-development plans not observed customer service. No numeric ITMW, final current service date or actual spend. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2025-06-09", "Falls Township published its Amazon campus and revised land development approval account June 9, 2025. The Township describes earlier March approvals without an exact voting day in this account. This is the publication date, not a data center opening or precise construction start." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.fallstwp.com/resources/news/article/?id=10070", "host": "fallstwp.com", "date": "2025-06-09", "published": "2025-06-09", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-pennsylvania-investment-cloud-infrastructure-ai-innovation", "host": "www.aboutamazon.com", "published": "2025-06-09", "date": "2025-06-09", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lat": 40.33679, "lng": -75.10675, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Falls municipal Amazon announcement and land-plan scopes", "fields": { "agency": "Falls Township, Pennsylvania", "announcement_date": "2025-06-09", "operator": "Amazon", "regional_planned_investment_usd": 20000000000, "regional_expected_jobs": 1250, "regional_scope": "Pennsylvania multiple campuses", "broader_keystone_trade_center_acres": 1800, "phase2_digital_infrastructure_parcel_acres": 247, "modified_existing_plan_addresses": [ "1 Ben Fairless Drive", "700 SouthPortRoad" ], "phase2_planned_structures": 10, "phase2_total_planned_area_sqft_min_exclusive": 2000000, "phase2_individual_structure_sqft_range": [ 112000, 217000 ], "agency_described_plan_change_month": "2025-03" }, "notes": [ "20Band1250jobs statewide not Falls-only.1800ac entire redevelopment not DC footprint. Existingbuilding6distributionplan modified and247acphase2separate scopes;do not call all structures operating DCs. Preliminary/final land-development plans not observed customer service. No numeric ITMW, final current service date or actual spend.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.fallstwp.com/resources/news/article/?id=10070", "host": "fallstwp.com", "date": "2025-06-09", "published": "2025-06-09", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 27", "scope": "Falls Township June 9, 2025 account explicitly reports Supervisors approval in March of revised preliminary and final land development plans for the named NorthPoint portions of Keystone Trade Center that would become data center development. The same account identifies the Amazon campus announcement. Reported land use approval is limited to that Township account, not a building permit, physical start or operation of every future structure. March is not converted to an exact approval day. The statewide investment and job forecast are not local delivered quantities.", "fields": { "current_stage_evidence": { "outcome": "township_reported_named_revised_land_development_approval", "scope": "Falls Township June 9, 2025 account explicitly reports Supervisors approval in March of revised preliminary and final land development plans for the named NorthPoint portions of Keystone Trade Center that would become data center development. The same account identifies the Amazon campus announcement. Reported land use approval is limited to that Township account, not a building permit, physical start or operation of every future structure. March is not converted to an exact approval day. The statewide investment and job forecast are not local delivered quantities." } }, "notes": [ "Falls Township June 9, 2025 account explicitly reports Supervisors approval in March of revised preliminary and final land development plans for the named NorthPoint portions of Keystone Trade Center that would become data center development. The same account identifies the Amazon campus announcement. Reported land use approval is limited to that Township account, not a building permit, physical start or operation of every future structure. March is not converted to an exact approval day. The statewide investment and job forecast are not local delivered quantities.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://www.fallstwp.com/resources/news/article/?id=10070", "host": "www.fallstwp.com", "published": "2025-06-09", "date": "2025-06-09", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check69, October24,2026", "scope": "The June 9, 2025 Amazon announcement explicitly names Falls Township as a planned innovation campus community. Its separate Salem Township proposal is not merged with this record. Developer per source means the named project proponent, not legal property ownership, a construction contractor or a completed campus. The statewide investment is not a site cost or power figure. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred.", "fields": { "company_association": { "name": "Amazon", "role": "developer", "identity_scope": "provider_brand_only", "scope": "The June 9, 2025 Amazon announcement explicitly names Falls Township as a planned innovation campus community. Its separate Salem Township proposal is not merged with this record. Developer per source means the named project proponent, not legal property ownership, a construction contractor or a completed campus. The statewide investment is not a site cost or power figure. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred." }, "provider_role": "developer" }, "notes": [ "The June 9, 2025 Amazon announcement explicitly names Falls Township as a planned innovation campus community. Its separate Salem Township proposal is not merged with this record. Developer per source means the named project proponent, not legal property ownership, a construction contractor or a completed campus. The statewide investment is not a site cost or power figure. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/amazon-pennsylvania-investment-cloud-infrastructure-ai-innovation", "host": "www.aboutamazon.com", "published": "2025-06-09", "date": "2025-06-09", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Falls Township · Bucks · Source context reviewed", "status_scope": "Falls Township June 9, 2025 account explicitly reports Supervisors approval in March of revised preliminary and final land development plans for the named NorthPoint portions of Keystone Trade Center that would become data center development. The same account identifies the Amazon campus announcement. Reported land use approval is limited to that Township account, not a building permit, physical start or operation of every future structure. March is not converted to an exact approval day. The statewide investment and job forecast are not local delivered quantities.", "event_evidence": [ { "date": "2025-06-09", "text": "Falls Township published its Amazon campus and revised land development approval account June 9, 2025. The Township describes earlier March approvals without an exact voting day in this account. This is the publication date, not a data center opening or precise construction start.", "kind": "announced", "sources": [ { "url": "https://www.fallstwp.com/resources/news/article/?id=10070", "host": "www.fallstwp.com", "published": "2025-06-09", "date": "2025-06-09", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42017" } }, { "id": "aws-galaxy-sidney-oh", "state": "oh", "kind": "facility", "name": "AWS Project Galaxy - Sidney, OH", "group": "building", "status": "City-reported site preparation", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Shelby" ], "city": "Sidney", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Advocacy/commerciallead-product tracker is not an independently examined cityagreement.180 to 350 millionforegonetax and 2.4 to 4.6 millionperjob are tracker estimates over 30 years, not cashaward/currentcost;50 millionPILOTis 15 yearcumulative, not annualreceivedrevenue. Generic 300 gpmexample is NOTGalaxywaterdemand. Source says utility/tariff undisclosed then guessesAEP 85 percentapplies; do not adopt supplier or tariff.80/100 risk is proprietary editorialscore, not measuredtechnicalrisk. January 2026 construction/2030 target are attributed and currentoperationunknown. NoMW, executedESAoractualincentiveverified. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://stopohiodatacenters.org/shelby-county", "host": "stopohiodatacenters.org", "date": "2026-04-26", "published": "2026-04-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.sidneyoh.com/526/Sidney-Data-Center-FAQ", "host": "www.sidneyoh.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Original county or city record for the qualified stage" } ], "loc": { "lat": 40.33151, "lng": -84.20458, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "StopOhioDataCenters’ ShelbyCounty tracker describes ProjectGalaxy atSidney and reports 30 yearreal-propertyabatement/PILOT/constructionterms drawn from other reporting and cityFAQ.", "independently_verified_current_operating_status": null }, "notes": [ "Advocacy/commerciallead-product tracker is not an independently examined cityagreement.180 to 350 millionforegonetax and 2.4 to 4.6 millionperjob are tracker estimates over 30 years, not cashaward/currentcost;50 millionPILOTis 15 yearcumulative, not annualreceivedrevenue. Generic 300 gpmexample is NOTGalaxywaterdemand. Source says utility/tariff undisclosed then guessesAEP 85 percentapplies; do not adopt supplier or tariff.80/100 risk is proprietary editorialscore, not measuredtechnicalrisk. January 2026 construction/2030 target are attributed and currentoperationunknown. NoMW, executedESAoractualincentiveverified.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://stopohiodatacenters.org/shelby-county", "host": "stopohiodatacenters.org", "date": "2026-04-26", "published": "2026-04-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "county-status-2026-10-19", "scope": "Sidney describes tree felling and test-pit work at its AWS Project Galaxy/Rey development.", "fields": { "current_stage_evidence": { "outcome": "city_reported_site_preparation", "scope": "Sidney describes tree felling and test-pit work at its AWS Project Galaxy/Rey development." } }, "notes": [ "The city describes tree-clearing work in the week of March 2, 2026. This supports early site work only, not completed halls or operation. Its October 5 update label is not the first-publication date or a physical-stage day. Reported company plans do not establish measured environmental effects." ], "sources": [ { "url": "https://www.sidneyoh.com/526/Sidney-Data-Center-FAQ", "host": "www.sidneyoh.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Original county or city record for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Sidney · Shelby · Source context reviewed", "status_scope": "Sidney describes tree felling and test-pit work at its AWS Project Galaxy/Rey development.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39149" } }, { "id": "aws-grafton-ma", "state": "ma", "kind": "facility", "name": "Amazon Data Services Grafton", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Worcester" ], "city": "Grafton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.. TimothyDoyle WBJ November22,2022 original registry/assessor report: AmazonDataServices bought Grafton8Centennial155000sf/1.8acres for15.1M and Westborough600/800Friberg for11.6M,26.7M COMBINED. Westborough600 building was StateStreetDC,99160sf; twoWestboroughlots19acres total. Thursdayclosing impliesNovember17, not originaldeedread. Grafton flexbuilding DCuse UNCONFIRMED; Amazon didnot respond onfutureuses. Propertyprice is notnewDCconstruction spending or operatingproof. Other AmazonRobotics/OtisStreetprojects aredifferent uses/properties, notadditionalDCs. Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://wbjournal.com/article/amazon-buys-properties-in-grafton-and-westborough-for-267m/", "host": "wbjournal.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.grafton-ma.gov/1460/August-10-2026-Planning-Board-Meeting-Ma", "host": "www.grafton-ma.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.grafton-ma.gov/1493/October-26-2026-Planning-Board-Meeting-M", "host": "www.grafton-ma.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 42.35144, "lng": -71.90772, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-acquisitions-regulatory-stage-and-site-crosswalks-round81-2026-10-15.json", "scope": "Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.", "fields": {}, "notes": [ "TimothyDoyle WBJ November22,2022 original registry/assessor report: AmazonDataServices bought Grafton8Centennial155000sf/1.8acres for15.1M and Westborough600/800Friberg for11.6M,26.7M COMBINED. Westborough600 building was StateStreetDC,99160sf; twoWestboroughlots19acres total. Thursdayclosing impliesNovember17, not originaldeedread.", "Grafton flexbuilding DCuse UNCONFIRMED; Amazon didnot respond onfutureuses. Propertyprice is notnewDCconstruction spending or operatingproof. Other AmazonRobotics/OtisStreetprojects aredifferent uses/properties, notadditionalDCs.", "Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified." ], "sources": [ { "url": "https://wbjournal.com/article/amazon-buys-properties-in-grafton-and-westborough-for-267m/", "host": "wbjournal.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 66", "scope": "The original August 10, 2026 Town planning materials list draft computing bylaws and proposed amendments, without an exact Amazon property decision. The selected October 26, 2026 main agenda lists an Amazon drone delivery discussion follow up, not a computing project hearing. Town policy drafts, another company land use, a recurring meeting and property acquisition reporting do not establish current exact computing construction, service, a local computing ban or an accomplished vote. Linked complete draft bylaw instruments remain unread.", "fields": { "current_stage_evidence": { "outcome": "official_grafton_policy_and_drone_agenda_exact_aws_compute_stage_held", "scope": "The original August 10, 2026 Town planning materials list draft computing bylaws and proposed amendments, without an exact Amazon property decision. The selected October 26, 2026 main agenda lists an Amazon drone delivery discussion follow up, not a computing project hearing. Town policy drafts, another company land use, a recurring meeting and property acquisition reporting do not establish current exact computing construction, service, a local computing ban or an accomplished vote. Linked complete draft bylaw instruments remain unread." }, "source_read_scope": { "original_august_policy_materials_relevant_body_read": true, "complete_oct26_main_agenda_subjects_read": true, "amazon_drone_topic_not_computing_hearing": true, "linked_complete_draft_bylaws_unread": true, "no_generic_future_meeting_assigned_to_aws_site": true } }, "notes": [ "The original August 10, 2026 Town planning materials list draft computing bylaws and proposed amendments, without an exact Amazon property decision. The selected October 26, 2026 main agenda lists an Amazon drone delivery discussion follow up, not a computing project hearing. Town policy drafts, another company land use, a recurring meeting and property acquisition reporting do not establish current exact computing construction, service, a local computing ban or an accomplished vote. Linked complete draft bylaw instruments remain unread.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. Source retrieval does not date physical commissioning." ], "sources": [ { "url": "https://www.grafton-ma.gov/1460/August-10-2026-Planning-Board-Meeting-Ma", "host": "www.grafton-ma.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.grafton-ma.gov/1493/October-26-2026-Planning-Board-Meeting-M", "host": "www.grafton-ma.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Grafton · Worcester · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "25027" } }, { "id": "aws-green-new-florence-mo", "state": "mo", "kind": "facility", "name": "AWS Project Green Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Montgomery" ], "city": "New Florence", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Tax projections are scenarios, not receipts; announced county/community payments are not verified disbursement. Do not add 25-year minimum and maximum cases. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://themissouritimes.com/aws-new-facilities-near-new-florence-will-double-tax-revenue-for-montgomery-county/", "host": "themissouritimes.com", "date": "2026-02-04", "published": "2026-02-04", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 38.94132, "lng": -91.47029, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Missouri Times describes Project Green minimum and maximum tax projections and different treatment of real and personal property.", "independently_verified_current_operating_status": null }, "notes": [ "Tax projections are scenarios, not receipts; announced county/community payments are not verified disbursement. Do not add 25-year minimum and maximum cases.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://themissouritimes.com/aws-new-facilities-near-new-florence-will-double-tax-revenue-for-montgomery-county/", "host": "themissouritimes.com", "date": "2026-02-04", "published": "2026-02-04", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Florence · Montgomery · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "29139" } }, { "id": "aws-hayden-run-hilliard-oh", "state": "oh", "kind": "facility", "name": "AWS Hayden Run Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Hilliard", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Preferred city FAQ concerns the Scioto Darby Creek Road campus at 4186 Scioto Darby Creek Road. Do not assign its fuel-cell capacity, incentives or area to this different Hilliard record. Correct-site crosswalk required. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.94503, "lng": -83.0074, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": {}, "notes": [ "Preferred city FAQ concerns the Scioto Darby Creek Road campus at 4186 Scioto Darby Creek Road. Do not assign its fuel-cell capacity, incentives or area to this different Hilliard record. Correct-site crosswalk required.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "encore-2026-10-17-batch1", "scope": "Limited source identity and stage review; not whole-record certification, parcel verification or a physical-site census.", "fields": { "current_stage_evidence": { "outcome": "unresolved", "scope": "Hilliard’s fuel-cell FAQ identifies a separate Scioto Darby Creek Road project. Its fuel cells, schedule and tax agreement are not independently matched to Hayden Run. No facility-specific stage, incentive or MW is transferred." } }, "notes": [ "Hilliard’s fuel-cell FAQ identifies a separate Scioto Darby Creek Road project. Its fuel cells, schedule and tax agreement are not independently matched to Hayden Run. No facility-specific stage, incentive or MW is transferred." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed primary source" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "The current City fuel cell FAQ explicitly concerns Scioto Darby Creek Road. That separate campus project does not establish the individual current phase of this inherited Hilliard component. General AWS operations, utility generation approvals and municipality level accounts are not transferred between Cosgray, Hayden Run and Scioto Darby. Exact physical phase remains unclear.", "fields": { "current_stage_evidence": { "outcome": "separate_scioto_darby_source_does_not_resolve_this_hilliard_component", "scope": "The current City fuel cell FAQ explicitly concerns Scioto Darby Creek Road. That separate campus project does not establish the individual current phase of this inherited Hilliard component. General AWS operations, utility generation approvals and municipality level accounts are not transferred between Cosgray, Hayden Run and Scioto Darby. Exact physical phase remains unclear." } }, "notes": [ "The current City fuel cell FAQ explicitly concerns Scioto Darby Creek Road. That separate campus project does not establish the individual current phase of this inherited Hilliard component. General AWS operations, utility generation approvals and municipality level accounts are not transferred between Cosgray, Hayden Run and Scioto Darby. Exact physical phase remains unclear.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hilliard · Franklin · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39049" } }, { "id": "aws-hermiston-or", "state": "or", "kind": "facility", "name": "AWS Hermiston Data Center Campuses", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Umatilla" ], "city": "Hermiston", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Hermiston signed urban growth boundary coadoption. Signed county ordinance is boundary/plan action, not all DC building permits, exactAWStenant, occupied campus or criticalIT.810acexpansionnotautomaticallydata-hallfootprint. October15,2025historicnotfutureOctober15,2026meeting. Attached city/exhibit records have separate scopes. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.co.umatilla.or.us/fileadmin/user_upload/Community_Development/Planning/Ordinances/2025/Ordinance_2025-11.pdf", "host": "co.umatilla.or.us", "date": "2025-10-15", "published": "2025-10-15", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 45.59161, "lng": -118.73687, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Hermiston signed urban growth boundary coadoption", "fields": { "agency": "Umatilla County, Oregon", "ordinance": "2025-11", "county_adoption_signature_date": "2025-10-15", "coadopted_city_ordinance": "Hermiston2374", "city_ordinance_adoption_date": "2025-09-08", "urban_growth_boundary_added_acres_approx": 810, "land_use_change": "Industrial comprehensive-plan designation, anticipating annexation/rezoning", "area_description": "south of EastFeedvilleRoad, north of FeedCanal, between SouthOttRoad and Highway395" }, "notes": [ "Signed county ordinance is boundary/plan action, not all DC building permits, exactAWStenant, occupied campus or criticalIT.810acexpansionnotautomaticallydata-hallfootprint. October15,2025historicnotfutureOctober15,2026meeting. Attached city/exhibit records have separate scopes.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.co.umatilla.or.us/fileadmin/user_upload/Community_Development/Planning/Ordinances/2025/Ordinance_2025-11.pdf", "host": "co.umatilla.or.us", "date": "2025-10-15", "published": "2025-10-15", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 42", "scope": "The original County ordinance in the inherited source list coadopts a Hermiston urban growth boundary and industrial comprehensive plan amendment. Its first two pages give an October 15, 2025 County action and the separate City ordinance reference. This is a land use boundary action. The selected pages do not establish the physical operating stage, exact component approvals or construction at every AWS Hermiston campus. The attached full City ordinance was not audited.", "fields": { "current_stage_evidence": { "outcome": "inherited_ordinance_is_boundary_policy_not_campus_operation", "scope": "The original County ordinance in the inherited source list coadopts a Hermiston urban growth boundary and industrial comprehensive plan amendment. Its first two pages give an October 15, 2025 County action and the separate City ordinance reference. This is a land use boundary action. The selected pages do not establish the physical operating stage, exact component approvals or construction at every AWS Hermiston campus. The attached full City ordinance was not audited." }, "source_read_scope": { "ordinance_text_pages": [ 1, 2 ], "attached_city_ordinance_not_reviewed": true, "physical_stage_and_parcel_permission_not_inferred": true } }, "notes": [ "The original County ordinance in the inherited source list coadopts a Hermiston urban growth boundary and industrial comprehensive plan amendment. Its first two pages give an October 15, 2025 County action and the separate City ordinance reference. This is a land use boundary action. The selected pages do not establish the physical operating stage, exact component approvals or construction at every AWS Hermiston campus. The attached full City ordinance was not audited.", "Identity, organization roles, locations, jurisdictions, quantities and physical opening fields stay unchanged. Source checks and prospective dates never establish an opening." ], "sources": [ { "url": "https://www.co.umatilla.or.us/fileadmin/user_upload/Community_Development/Planning/Ordinances/2025/Ordinance_2025-11.pdf", "host": "www.co.umatilla.or.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hermiston · Umatilla · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "41059" } }, { "id": "aws-hobart-in", "state": "in", "kind": "facility", "name": "AWS Hobart Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lake" ], "city": "Hobart", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Northwest Indiana investment geography and Hobart announcement. 15Bregional+11Bprior=26Bstate total, not52B.15Band1100jobs not Hobart-only. Publisher expected1B15yearratepayersavings/100percentgenerationcostaccountnot independently read utility agreement, actual savings or universal future guarantee. No exact Hobart parcel, numeric ITMW or observed opening. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.nwiforum.org/amazon-invests-15b-in-northwest-indiana", "host": "nwiforum.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.cityofhobart.org/AgendaCenter/ViewFile/Minutes/_03182026-2545", "host": "www.cityofhobart.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.41712, "lng": -87.38208, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Northwest Indiana investment geography and Hobart announcement", "fields": { "publisher_role": "Northwest Indiana regional economic-development organization", "regional_planned_aws_investment_usd": 15000000000, "regional_expected_new_jobs": 1100, "statewide_aws_planned_total_usd": 26000000000, "prior_st_joseph_county_commitment_usd": 11000000000, "hobart_agreement_announcement_date": "2025-11-25" }, "notes": [ "15Bregional+11Bprior=26Bstate total, not52B.15Band1100jobs not Hobart-only. Publisher expected1B15yearratepayersavings/100percentgenerationcostaccountnot independently read utility agreement, actual savings or universal future guarantee. No exact Hobart parcel, numeric ITMW or observed opening.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.nwiforum.org/amazon-invests-15b-in-northwest-indiana", "host": "nwiforum.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 23", "scope": "Hobart signed March 18, 2026 Council minutes record discussion of the Amazon proposal, construction traffic planning, wells, noise and resident concerns. Plans to bus workers and official replies are not an individual occupancy or current physical construction certification. The October construction update and reminder routes returned a missing route redirect or HTTP 404 in this capture, despite search cached text, and are not substituted as captured current status evidence. The separate New Carlisle traffic account quoted by residents is not independently verified or transferred. Exact current Hobart phase remains unclear.", "fields": { "current_stage_evidence": { "outcome": "signed_city_discussion_and_current_notice_capture_holds_not_operating_phase", "scope": "Hobart signed March 18, 2026 Council minutes record discussion of the Amazon proposal, construction traffic planning, wells, noise and resident concerns. Plans to bus workers and official replies are not an individual occupancy or current physical construction certification. The October construction update and reminder routes returned a missing route redirect or HTTP 404 in this capture, despite search cached text, and are not substituted as captured current status evidence. The separate New Carlisle traffic account quoted by residents is not independently verified or transferred. Exact current Hobart phase remains unclear." }, "source_scope": { "city_meeting_on": "2026-03-18", "all_four_signed_minutes_pages_visually_read": true, "public_comment_pages": [ 3, 4 ], "secondhand_medical_and_new_carlisle_claims_not_verified": true, "current_notice_route_failure_not_project_cancellation": true } }, "notes": [ "Hobart signed March 18, 2026 Council minutes record discussion of the Amazon proposal, construction traffic planning, wells, noise and resident concerns. Plans to bus workers and official replies are not an individual occupancy or current physical construction certification. The October construction update and reminder routes returned a missing route redirect or HTTP 404 in this capture, despite search cached text, and are not substituted as captured current status evidence. The separate New Carlisle traffic account quoted by residents is not independently verified or transferred. Exact current Hobart phase remains unclear.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://www.cityofhobart.org/AgendaCenter/ViewFile/Minutes/_03182026-2545", "host": "www.cityofhobart.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hobart · Lake · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "18089" } }, { "id": "aws-industrial-parkway-jerome-township-oh", "state": "oh", "kind": "facility", "name": "AWS Industrial Parkway Campus (Jerome Township)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Union" ], "city": "Plain City", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Union County Amazon Industrial Parkway cadastral context. Repeated joined feature rows are not three buildings. Distinct area/year attributes may represent improvements or joined assessment records; do not sum or label exact production opening. Appraised building value is tax-assessment context, not construction capex/transaction/incentive. Geometry is EPSG3857 meters, not lat/lon. No operating status or ITMW proven. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www7.co.union.oh.us/unioncountyohio/rest/services/ParcelAllSaleinfoBuildingInfo/MapServer/1/query?where=ParcelNo%3D'1500220390010'&outFields=ParcelNo,DeedOwner,Address,city,township,Acreage,classDescription,yearBuilt,TotalBuildingArea,AppraisedBuildValue&f=json", "host": "www7.co.union.oh.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.29938, "lng": -83.37152, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Union County Amazon Industrial Parkway cadastral context", "fields": { "agency": "Union County Ohio parcel service", "parcel": "1500220390010", "deed_owner_as_listed": "AMAZON DATA SERVICES INC", "situs_address": "8565 Industrial Parkway", "postal_city": "Plain City", "township": "Jerome", "parcel_acres": 86.18, "returned_feature_rows": 3, "distinct_attribute_rows": 2, "assessment_build_years": [ 2024, 2025 ], "assessment_building_area_values_sqft": [ 151305, 215144 ] }, "notes": [ "Repeated joined feature rows are not three buildings. Distinct area/year attributes may represent improvements or joined assessment records; do not sum or label exact production opening. Appraised building value is tax-assessment context, not construction capex/transaction/incentive. Geometry is EPSG3857 meters, not lat/lon. No operating status or ITMW proven.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www7.co.union.oh.us/unioncountyohio/rest/services/ParcelAllSaleinfoBuildingInfo/MapServer/1/query?where=ParcelNo%3D'1500220390010'&outFields=ParcelNo,DeedOwner,Address,city,township,Acreage,classDescription,yearBuilt,TotalBuildingArea,AppraisedBuildValue&f=json", "host": "www7.co.union.oh.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Plain City · Union · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39159" } }, { "id": "aws-jefferson-township-fayette-oh", "state": "oh", "kind": "facility", "name": "AWS Fayette County (Jefferson Township)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Fayette" ], "city": "Jeffersonville", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Stakeholder account is not signed CRA agreement or observed start. County investment is within larger Ohio program, not additive to every statewide announcement; construction jobs are temporary. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://columbusconstruction.org/amazon-web-services-to-build-new-datacenter-campus-in-fayette-county/", "host": "columbusconstruction.org", "date": "2025-01-30", "published": "2025-01-30", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 39.55998, "lng": -83.45609, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Building trades council describes planned Fayette County AWS campus, reported CRA exemption and anticipated early-2025 construction.", "independently_verified_current_operating_status": null }, "notes": [ "Stakeholder account is not signed CRA agreement or observed start. County investment is within larger Ohio program, not additive to every statewide announcement; construction jobs are temporary.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://columbusconstruction.org/amazon-web-services-to-build-new-datacenter-campus-in-fayette-county/", "host": "columbusconstruction.org", "date": "2025-01-30", "published": "2025-01-30", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Jeffersonville · Fayette · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39047" } }, { "id": "aws-kline-township-schuylkill-pa", "state": "pa", "kind": "facility", "name": "AWS Kline Township Data Center Campus", "group": "proposed", "status": "Permit review underway", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Schuylkill" ], "city": "Kline Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Extension is not preliminary/final land-development approval. Later deadline outcome remains unobserved; unrelated municipal spending in article is not project incentive. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-03-02", "Pennsylvania Office of Open Records issued its Kline Township records appeal determination March 2, 2026. It grants the appeal in part and dismisses part as moot. This is the dated records decision account, not an environmental permit ruling, project denial or proof of later compliance." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://shensentinel.com/news/kline-supervisors-grant-extension-for-consideration-of-amazon-data-center-plans/", "host": "shensentinel.com", "date": "2026-08-17", "published": "2026-08-17", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.openrecords.pa.gov/Appeals/DocketGetFile.cfm?id=257197", "host": "www.openrecords.pa.gov", "published": "2026-03-02", "date": "2026-03-02", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.70567, "lng": -76.21613, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Shenandoah Sentinel reports AWS Kline plan consideration deadline extended to September 30, 2026.", "independently_verified_current_operating_status": null }, "notes": [ "Extension is not preliminary/final land-development approval. Later deadline outcome remains unobserved; unrelated municipal spending in article is not project incentive.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://shensentinel.com/news/kline-supervisors-grant-extension-for-consideration-of-amazon-data-center-plans/", "host": "shensentinel.com", "date": "2026-08-17", "published": "2026-08-17", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 28", "scope": "The current DEP tracker original project CSV identifies Kline Township Data Center Development as project 10000004 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed.", "fields": { "current_stage_evidence": { "outcome": "current_named_dep_project_permit_review_not_physical_operation", "scope": "The current DEP tracker original project CSV identifies Kline Township Data Center Development as project 10000004 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed." }, "tracker_scope": { "project_id": "10000004", "project_and_permit_csv_read_together": true, "aggregate_status_not_every_permit_complete": true, "source_coordinates_not_promoted": true, "submitted_day_not_issued_day": true } }, "notes": [ "The current DEP tracker original project CSV identifies Kline Township Data Center Development as project 10000004 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.openrecords.pa.gov/Appeals/DocketGetFile.cfm?id=257197", "host": "www.openrecords.pa.gov", "published": "2026-03-02", "date": "2026-03-02", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Kline Township · Schuylkill · Source context reviewed", "status_scope": "The current DEP tracker original project CSV identifies Kline Township Data Center Development as project 10000004 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed.", "event_evidence": [ { "date": "2026-03-02", "text": "Pennsylvania Office of Open Records issued its Kline Township records appeal determination March 2, 2026. It grants the appeal in part and dismisses part as moot. This is the dated records decision account, not an environmental permit ruling, project denial or proof of later compliance.", "kind": "announced", "sources": [ { "url": "https://www.openrecords.pa.gov/Appeals/DocketGetFile.cfm?id=257197", "host": "www.openrecords.pa.gov", "published": "2026-03-02", "date": "2026-03-02", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42107" } }, { "id": "aws-laveen-az", "state": "az", "kind": "facility", "name": "AWS Laveen Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Maricopa" ], "city": "Laveen", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Reported 277 million USD is land transaction, not project capex or commissioned facility. Other Valley acquisitions and market MW totals do not belong to this site. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.aztechcouncil.org/amazon-buys-massive-valley-site-for-potential-data-center/", "host": "aztechcouncil.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 33.3222, "lng": -112.64336, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Phoenix Business Journal reporting republished by Arizona Technology Council describes Amazon Laveen acquisition and potential data center use.", "independently_verified_current_operating_status": null }, "notes": [ "Reported 277 million USD is land transaction, not project capex or commissioned facility. Other Valley acquisitions and market MW totals do not belong to this site.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.aztechcouncil.org/amazon-buys-massive-valley-site-for-potential-data-center/", "host": "aztechcouncil.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Laveen · Maricopa · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "04013" } }, { "id": "aws-mattermeade-caroline-va", "state": "va", "kind": "facility", "name": "AWS Mattermeade Tech Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Caroline" ], "city": "Bowling Green", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. unmatched county landing page. Spotsylvania County generic rezoning landing page does not match Caroline County Mattermeade site. No project fields adopted. Thin navigation body and county mismatch cannot establish case, approval or exact location. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.spotsylvania.va.us/799/Rezoning-Cases", "host": "spotsylvania.va.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://co.caroline.va.us/AgendaCenter/ViewFile/Item/6056?fileID=10076", "host": "co.caroline.va.us", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed source context" }, { "url": "https://co.caroline.va.us/AgendaCenter/ViewFile/Item/7398?fileID=11593", "host": "co.caroline.va.us", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed source context" }, { "url": "https://www.nao.usace.army.mil/Media/Public-Notices/Article/4054364/nao-2024-01108-mattameade-data-center-caroline-county-virginia/", "host": "www.nao.usace.army.mil", "published": "", "date": "", "checked": "2026-10-17", "label": "Access-check target" }, { "url": "https://co.caroline.va.us/1037/SubdivisionsSite-Plans", "host": "co.caroline.va.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.spotsylvania.va.us/3241/Data-Center-FAQs", "host": "www.spotsylvania.va.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 38.04278, "lng": -77.36523, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "primary-source-review-round9-2026-10-14.json", "scope": "unmatched county landing page", "fields": {}, "notes": [ "Spotsylvania County generic rezoning landing page does not match Caroline County Mattermeade site. No project fields adopted. Thin navigation body and county mismatch cannot establish case, approval or exact location.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.spotsylvania.va.us/799/Rezoning-Cases", "host": "spotsylvania.va.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "encore-2026-10-17-batch2", "scope": "Limited source identity and stage review; not whole-record certification, parcel verification or a physical-site census.", "fields": { "current_stage_evidence": { "outcome": "unresolved", "scope": "Caroline County spells the project Mattameade. The January 27, 2026 agenda reports an earlier local agreement but requests authorization for a new performance agreement; the attached unsigned terms are not a recorded vote, an executed grant or a payment. The 2023 application and access-limited USACE notice do not establish current construction. Cross-county geography requires separate parcel review; proposed MW and a 2027 target are not delivered capacity." } }, "notes": [ "Caroline County spells the project Mattameade. The January 27, 2026 agenda reports an earlier local agreement but requests authorization for a new performance agreement; the attached unsigned terms are not a recorded vote, an executed grant or a payment. The 2023 application and access-limited USACE notice do not establish current construction. Cross-county geography requires separate parcel review; proposed MW and a 2027 target are not delivered capacity." ], "sources": [ { "url": "https://co.caroline.va.us/AgendaCenter/ViewFile/Item/6056?fileID=10076", "host": "co.caroline.va.us", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed source context" }, { "url": "https://co.caroline.va.us/AgendaCenter/ViewFile/Item/7398?fileID=11593", "host": "co.caroline.va.us", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed source context" }, { "url": "https://www.nao.usace.army.mil/Media/Public-Notices/Article/4054364/nao-2024-01108-mattameade-data-center-caroline-county-virginia/", "host": "www.nao.usace.army.mil", "published": "", "date": "", "checked": "2026-10-17", "label": "Access-check target" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 49", "scope": "The current Caroline County site plan index describes Mattameade Phase II as submitted, deemed complete and forwarded for review. That is an application stage for the named phase, not current computing operation or completion of the entire campus. Separate projected water delivery and energization dates do not establish actual delivery. The selected Corps source remained unavailable at its robots check.", "fields": { "current_stage_evidence": { "outcome": "current_phase_application_not_campus_physical_stage", "scope": "The current Caroline County site plan index describes Mattameade Phase II as submitted, deemed complete and forwarded for review. That is an application stage for the named phase, not current computing operation or completion of the entire campus. Separate projected water delivery and energization dates do not establish actual delivery. The selected Corps source remained unavailable at its robots check." } }, "notes": [ "The current Caroline County site plan index describes Mattameade Phase II as submitted, deemed complete and forwarded for review. That is an application stage for the named phase, not current computing operation or completion of the entire campus. Separate projected water delivery and energization dates do not establish actual delivery. The selected Corps source remained unavailable at its robots check.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://co.caroline.va.us/1037/SubdivisionsSite-Plans", "host": "co.caroline.va.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.spotsylvania.va.us/3241/Data-Center-FAQs", "host": "www.spotsylvania.va.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Bowling Green · Caroline · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "51033" } }, { "id": "aws-newton-court-new-albany-oh", "state": "oh", "kind": "facility", "name": "AWS New Albany (Newton Court)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'095-112074-00.000'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.08521, "lng": -82.51888, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PID": 90304, "Parcel": "095-112074-00.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "2575 NEWTON CT ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 92.69 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'095-112074-00.000'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "fields": { "current_stage_evidence": { "outcome": "broader_new_albany_market_not_exact_component_stage", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed." }, "source_read_scope": { "selected_section": "August 7, 2025 AWS data centers in New Albany", "current_rolling_source_not_all_articles_read": true, "regional_service_not_transferred_to_every_building": true, "no_site_event_from_broader_market_publication": true } }, "notes": [ "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "aws-pdx154-boardman-airport-or", "state": "or", "kind": "facility", "name": "AWS PDX 154 (Boardman Airport Campus)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Morrow" ], "city": "Boardman", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Conditional land-use approval is not permit completion or operational opening. Building and pond areas are separate; settlement about existing regional operations not proof this campus caused pollution. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.tricitiesbusinessnews.com/articles/amazon-plans-another-data-center-southwest-of-tri-cities", "host": "tricitiesbusinessnews.com", "date": "2026-04-14", "published": "2026-04-14", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 45.41893, "lng": -119.58451, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Tri-Cities reporting says Morrow planning commission approved PDX154 land use March 31 with airport, stormwater and wastewater conditions.", "independently_verified_current_operating_status": null }, "notes": [ "Conditional land-use approval is not permit completion or operational opening. Building and pond areas are separate; settlement about existing regional operations not proof this campus caused pollution.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.tricitiesbusinessnews.com/articles/amazon-plans-another-data-center-southwest-of-tri-cities", "host": "tricitiesbusinessnews.com", "date": "2026-04-14", "published": "2026-04-14", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Boardman · Morrow · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "41049" } }, { "id": "aws-portage-in", "state": "in", "kind": "facility", "name": "AWS Portage Data Center (AmeriPlex at the Port)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Porter" ], "city": "Portage", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Reported 87 million USD combines 35 million building and 52 million equipment; do not add all three. No opening timeline provided; delivery warehouse is separate. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.insideindianabusiness.com/articles/amazon-building-87m-data-center-in-portage", "host": "insideindianabusiness.com", "date": "2023-12-20", "published": "2023-12-20", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 41.47073, "lng": -87.07827, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Inside INdiana Business, citing Times of Northwest Indiana, reports Portage AWS project and proposed tax treatment.", "independently_verified_current_operating_status": null }, "notes": [ "Reported 87 million USD combines 35 million building and 52 million equipment; do not add all three. No opening timeline provided; delivery warehouse is separate.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.insideindianabusiness.com/articles/amazon-building-87m-data-center-in-portage", "host": "insideindianabusiness.com", "date": "2023-12-20", "published": "2023-12-20", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Portage · Porter · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "18127" } }, { "id": "aws-project-atlas-madison-county-ms", "state": "ms", "kind": "facility", "name": "AWS Project Atlas - Madison County Mega Site (Canton)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Madison" ], "city": "Canton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Combined one GW and ten-billion-USD investment are regional plans, not each site. Groundbreaking is not operation; quoted spring-2027 target remains a forecast. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://siteselection.com/amazon-delivers-record-package-to-mississippi/", "host": "siteselection.com", "date": "2024-06-19", "published": "2024-06-19", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/company-news/amazon-25-billion-mississippi-data-centers", "host": "www.aboutamazon.com", "published": "2026-04-09", "date": "2026-04-09", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lat": 32.65147, "lng": -90.05127, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Site Selection reports May 20 AWS Madison County groundbreaking and two-campus development goals.", "independently_verified_current_operating_status": null }, "notes": [ "Combined one GW and ten-billion-USD investment are regional plans, not each site. Groundbreaking is not operation; quoted spring-2027 target remains a forecast.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://siteselection.com/amazon-delivers-record-package-to-mississippi/", "host": "siteselection.com", "date": "2024-06-19", "published": "2024-06-19", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 75", "scope": "The original Amazon statewide update describes two Madison County development campuses and past groundbreaking in the region. It does not independently name the exact inherited Project Atlas record or allocate all construction and operational references to that specific campus. The total statewide investment and prospective 2027 recycled water use are separate from commissioned computing and current measured consumption. No precise groundbreaking day, operating date, additional phase or campus merge is inferred.", "fields": { "current_stage_evidence": { "outcome": "regional_madison_construction_exact_project_atlas_scope_held", "scope": "The original Amazon statewide update describes two Madison County development campuses and past groundbreaking in the region. It does not independently name the exact inherited Project Atlas record or allocate all construction and operational references to that specific campus. The total statewide investment and prospective 2027 recycled water use are separate from commissioned computing and current measured consumption. No precise groundbreaking day, operating date, additional phase or campus merge is inferred." }, "source_read_scope": { "complete_original_statewide_issuer_body_read": true, "two_county_campuses_not_merged_into_named_atlas": true, "relative_two_years_not_invented_groundbreaking_day": true, "no_statewide_quantities_or_current_water_measurement_adopted": true } }, "notes": [ "The original Amazon statewide update describes two Madison County development campuses and past groundbreaking in the region. It does not independently name the exact inherited Project Atlas record or allocate all construction and operational references to that specific campus. The total statewide investment and prospective 2027 recycled water use are separate from commissioned computing and current measured consumption. No precise groundbreaking day, operating date, additional phase or campus merge is inferred.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://www.aboutamazon.com/news/company-news/amazon-25-billion-mississippi-data-centers", "host": "www.aboutamazon.com", "published": "2026-04-09", "date": "2026-04-09", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Canton · Madison · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "28089" } }, { "id": "aws-project-cosmos-marysville-oh", "state": "oh", "kind": "facility", "name": "AWS Project Cosmos", "group": "building", "status": "City-reported site preparation", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Union" ], "city": "Marysville", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Marysville two distinct data-center projects and approval chronology. Two separate city projects; do not label Anadonna as AWS without tenant proof. First reading not final adoption day; city reports CRA approved but actual signed terms not read here. Approximate annual4Mpayroll per project not jobs count or investment. Atleast50fulltimejobs plural FAQ scope ambiguous; not assigned each. No numeric ITMW or observed commissioning. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://marysvilleohio.org/772/Data-Center-FAQs", "host": "marysvilleohio.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.31227, "lng": -83.38558, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Marysville two distinct data-center projects and approval chronology", "fields": { "agency": "City of Marysville, Ohio", "named_projects": [ { "operator": "AWS", "project": "US33 Innovation Park", "address": "14684 Industrial Parkway", "site_acres_approx": 55, "estimated_building_sqft_approx": 500000, "estimated_investment_usd_approx": 1000000000, "agency_reported_site_readiness_start": "early2026", "construction_forecast_through_year": 2027 }, { "applicant": "Anadonna LLC", "project": "Marysville South", "site_acres_approx": 600, "estimated_building_sqft_range": [ 750000, 1000000 ], "estimated_investment_usd_min_inclusive_approx": 1000000000, "pud_rezoning_month": "2024-08", "cra_donation_agreement_first_reading_date": "2025-11-10" } ] }, "notes": [ "Two separate city projects; do not label Anadonna as AWS without tenant proof. First reading not final adoption day; city reports CRA approved but actual signed terms not read here. Approximate annual4Mpayroll per project not jobs count or investment. Atleast50fulltimejobs plural FAQ scope ambiguous; not assigned each. No numeric ITMW or observed commissioning.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://marysvilleohio.org/772/Data-Center-FAQs", "host": "marysvilleohio.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "county-status-2026-10-19", "scope": "Marysville reports that site readiness work for its AWS US 33 Innovation Park project began in early 2026.", "fields": { "current_stage_evidence": { "outcome": "city_reported_site_preparation", "scope": "Marysville reports that site readiness work for its AWS US 33 Innovation Park project began in early 2026." } }, "notes": [ "The city distinguishes this AWS project from the separate Anadonna / Marysville South development. Site preparation does not establish completed halls or operation. Construction through 2027 remains a forecast, and the early 2026 reference gives no exact start day." ], "sources": [ { "url": "https://marysvilleohio.org/772/Data-Center-FAQs", "host": "marysvilleohio.org", "published": "", "date": "", "checked": "2026-10-19", "label": "Original county or city record for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Marysville · Union · Source context reviewed", "status_scope": "Marysville reports that site readiness work for its AWS US 33 Innovation Park project began in early 2026.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39159" } }, { "id": "aws-project-eagle-boling-wharton-county-tx", "state": "tx", "kind": "facility", "name": "AWS Project Eagle (Wharton County)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wharton" ], "city": "Boling", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read exact-project public section or complete named article; derivative database/AI aggregation, exact-site mismatch and generic directories receive no independent manual-ID credit.. TDLR accessibility project registrations are not localbuildingpermits,groundbreakingprooforcompletion. Fourx300million=1.2billionestimatedconstructioncost,notspendingcommitmentorIT-inclusivecapex.2700acreslandbanknotallDCfootprint;756240squarefeetderivedsumoffourfloorareas,notland. 1587USDpersquarefootderivednotpaidcost. OtherBastrop,DeSoto/Spectrum andnuclearadjacencyprojectsareseparate;noenergysupply,ITorwaterverified. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Original TDLR architectural-barriers project registrations; estimated costs and filed timelines, not measured operating census.. ReviewCompleteisaccessibilityplan-reviewstatus,notcommissioning,occupancycertification,localbuildingpermitorutilityagreement. Allstart/completiondatesarefiledplans,noteventsverifiedonthosedates. BuildingBisAugust2027,whileA/C/DareJanuary2027;donotassignlaterdatetoDbecauseitisthefourthletter. AandDshare244EaglewoodbuthaveuniqueregistrationIDs;donotdeduplicatebyaddressaloneorcreatetwoindependentlyoperatingcampuses. Fourestimated300millioncostsarenotauditedspendingorIT-inclusivecampuscapex. No2700acrefootprint,MW,water,incentivesorendcustomerfromtheseregistrations.", "date": "", "events": [ [ "2026-06-25", "TDLR records date registration of Project Eagle Buildings A through D to June 25, 2026. These are four accessibility construction filings with scheduled dates, not four independently commissioned or operating campuses." ], [ "2026-09-11", "Amazon published its Wharton County project update on September 11, 2026 and reported campus planning with site preparation already underway. This dates the account, not an exact first work day or commissioned service in each Project Eagle component." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://usdatacenterprojects.com/texas/aws-files-1-2-billion-permit-for-four-building-data-center-campus-in-wharton-county-texas", "host": "usdatacenterprojects.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023825", "host": "tdlr.texas.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023826", "host": "tdlr.texas.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023832", "host": "tdlr.texas.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023834", "host": "tdlr.texas.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://data.texas.gov/resource/tzyg-j7q4.json?%24where=%28indus_type_cd_name+like+%27518210%25%27+OR+indus_type_cd_name+like+%27541513%25%27+OR+indus_typ_cd+in+%28%27518210%27%2C%27541513%27%29+OR+indus_typ_cd_1+in+%28%277374%27%2C%277376%27%29+OR+upper%28reg_ent_name%29+like+%27%25DATA%25CENTER%25%27+OR+upper%28reg_ent_name%29+like+%27%25DATA%25CENTRE%25%27+OR+upper%28reg_ent_desc_txt%29+like+%27%25DATA%25CENTER%25%27+OR+upper%28reg_ent_desc_txt%29+like+%27%25DATA%25CENTRE%25%27%29&%24order=ref_num_txt%2Cprogram_code%2Cadditional_id_text%2Cref_num_txt_1%2Caffil_begin_dt&%24limit=5000", "host": "data.texas.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Texas Commission on Environmental Quality source context" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "2026-09-11", "date": "2026-09-11", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 29.27779, "lng": -96.2221, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round38-2026-10-14.json", "scope": "Personally read exact-project public section or complete named article; derivative database/AI aggregation, exact-site mismatch and generic directories receive no independent manual-ID credit.", "fields": { "reported_context": "USDataCenterProjects reports four TexasTDLR filings forAWSProjectEagle nearBoling, each189060squarefeet/USD300millionestimatedcost, with August1,2026plannedstart and January/August2027completiontargets.", "independently_verified_current_operating_status": null }, "notes": [ "TDLR accessibility project registrations are not localbuildingpermits,groundbreakingprooforcompletion. Fourx300million=1.2billionestimatedconstructioncost,notspendingcommitmentorIT-inclusivecapex.2700acreslandbanknotallDCfootprint;756240squarefeetderivedsumoffourfloorareas,notland. 1587USDpersquarefootderivednotpaidcost. OtherBastrop,DeSoto/Spectrum andnuclearadjacencyprojectsareseparate;noenergysupply,ITorwaterverified.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://usdatacenterprojects.com/texas/aws-files-1-2-billion-permit-for-four-building-data-center-campus-in-wharton-county-texas", "host": "usdatacenterprojects.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-development-review-round38-2026-10-14.json", "scope": "Original TDLR architectural-barriers project registrations; estimated costs and filed timelines, not measured operating census.", "fields": { "registered_buildings": [ { "building": "A", "registration_number": "TABS2026023825", "registration_date": "2026-06-25", "registered_owner": "AMAZON DATA SERVICES, INC", "listed_tenant": "Not Assigned", "address_as_filed": "244 Eaglewood Road, Boling, Texas77420", "county": "Wharton", "filed_start_date": "2026-08-01", "filed_completion_date": "2027-01-01", "estimated_cost_usd": 300000000, "filed_building_sqft": 189060, "architectural_barriers_review_status": "Review Complete", "funding": "Privately funded, private land for private use", "source": { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023825", "sha256": "007491f5007d3713e5e6533bdbf675c24947787295f603617946ae1ae634add7", "publication_date": null, "publisher": "Texas Department of Licensing and Regulation" } }, { "building": "B", "registration_number": "TABS2026023826", "registration_date": "2026-06-25", "registered_owner": "AMAZON DATA SERVICES, INC", "listed_tenant": "Not Assigned", "address_as_filed": "258 Eaglewood Road, Boling, Texas77420", "county": "Wharton", "filed_start_date": "2026-08-01", "filed_completion_date": "2027-08-01", "estimated_cost_usd": 300000000, "filed_building_sqft": 189060, "architectural_barriers_review_status": "Review Complete", "funding": "Privately funded, private land for private use", "source": { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023826", "sha256": "44e02d9a4610e9a1d7923405be3f1f4fd587301bc84b858bb3fac88dd3d596ce", "publication_date": null, "publisher": "Texas Department of Licensing and Regulation" } }, { "building": "C", "registration_number": "TABS2026023832", "registration_date": "2026-06-25", "registered_owner": "AMAZON DATA SERVICES, INC", "listed_tenant": "Not Assigned", "address_as_filed": "240 Eaglewood Road, Boling, Texas77420", "county": "Wharton", "filed_start_date": "2026-08-01", "filed_completion_date": "2027-01-01", "estimated_cost_usd": 300000000, "filed_building_sqft": 189060, "architectural_barriers_review_status": "Review Complete", "funding": "Privately funded, private land for private use", "source": { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023832", "sha256": "4502ce87801efc4ad7651df66d2b5d5c77cbdcd826670251e00f07cb30d6d62f", "publication_date": null, "publisher": "Texas Department of Licensing and Regulation" } }, { "building": "D", "registration_number": "TABS2026023834", "registration_date": "2026-06-25", "registered_owner": "AMAZON DATA SERVICES, INC", "listed_tenant": "Not Assigned", "address_as_filed": "244 Eaglewood Road, Boling, Texas77420", "county": "Wharton", "filed_start_date": "2026-08-01", "filed_completion_date": "2027-01-01", "estimated_cost_usd": 300000000, "filed_building_sqft": 189060, "architectural_barriers_review_status": "Review Complete", "funding": "Privately funded, private land for private use", "source": { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023834", "sha256": "be57dbfec270f9f66815efc0df1378bda308c3b877871f4460073d1e7f182443", "publication_date": null, "publisher": "Texas Department of Licensing and Regulation" } } ], "derived_estimated_construction_cost_sum_usd": 1200000000, "derived_filed_building_area_sum_sqft": 756240, "campus_building_permit_verified": false, "actual_construction_start_verified": false, "actual_completion_verified": false, "critical_it_mw": null, "secured_utility_mw": null }, "notes": [ "ReviewCompleteisaccessibilityplan-reviewstatus,notcommissioning,occupancycertification,localbuildingpermitorutilityagreement. Allstart/completiondatesarefiledplans,noteventsverifiedonthosedates. BuildingBisAugust2027,whileA/C/DareJanuary2027;donotassignlaterdatetoDbecauseitisthefourthletter. AandDshare244EaglewoodbuthaveuniqueregistrationIDs;donotdeduplicatebyaddressaloneorcreatetwoindependentlyoperatingcampuses. Fourestimated300millioncostsarenotauditedspendingorIT-inclusivecampuscapex. No2700acrefootprint,MW,water,incentivesorendcustomerfromtheseregistrations.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023825", "host": "tdlr.texas.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023826", "host": "tdlr.texas.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023832", "host": "tdlr.texas.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023834", "host": "tdlr.texas.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "texas-registry-2026-10-17", "scope": "Official Texas registry source context, with initial eligibility and component triage. Not a physical-site census or current-stage review.", "fields": { "texas_registry_air_context": { "regulated_entity": "RN112500293", "registry_name": [ "AWS-PROJECT EAGLE" ], "program_contexts": [ { "program": "AIRNSR", "identifiers": [ "185226" ] } ], "association_scope": "Explicit AWS Project Eagle, Amazon Data Services and Wharton County support existing Project Eagle research context; no address or issued-permit/operating-stage inference.", "limits": "Registry authorizations, emissions reporting and historical customer affiliations can overlap. ACTIVE is a registry value, not proof of signed permit issuance, current operation, title or complete campus buildout. No generator MW, coordinates, street address or physical stage is promoted." } }, "notes": [ "AIRNSR and AIROP entries are registry contexts, not substitutes for signed permits. AIREI is emissions reporting, not a permit. Customer and status dates are not opening, completion or current ownership dates.", "The extract is a selected portion of Central Registry and the name/industry query is incomplete for all generator permits. Nonmatches are not evidence of absence." ], "sources": [ { "url": "https://data.texas.gov/resource/tzyg-j7q4.json?%24where=%28indus_type_cd_name+like+%27518210%25%27+OR+indus_type_cd_name+like+%27541513%25%27+OR+indus_typ_cd+in+%28%27518210%27%2C%27541513%27%29+OR+indus_typ_cd_1+in+%28%277374%27%2C%277376%27%29+OR+upper%28reg_ent_name%29+like+%27%25DATA%25CENTER%25%27+OR+upper%28reg_ent_name%29+like+%27%25DATA%25CENTRE%25%27+OR+upper%28reg_ent_desc_txt%29+like+%27%25DATA%25CENTER%25%27+OR+upper%28reg_ent_desc_txt%29+like+%27%25DATA%25CENTRE%25%27%29&%24order=ref_num_txt%2Cprogram_code%2Cadditional_id_text%2Cref_num_txt_1%2Caffil_begin_dt&%24limit=5000", "host": "data.texas.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Texas Commission on Environmental Quality source context" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 53", "scope": "Amazon September 11, 2026 Wharton County account describes a planned campus outside Boling and reports site preparation underway. Four current TDLR records separately identify Project Eagle Buildings A through D with June 25 registrations, scheduled dates and Review Complete labels. The larger announced campus and these four filed components are not an independently verified exact stage crosswalk. Site preparation at the wider campus does not certify construction or service in every filed building. No owner, operator, component identity, count, parcel or quantity field changes are made.", "fields": { "current_stage_evidence": { "outcome": "campus_preparation_and_component_filings_stage_held", "scope": "Amazon September 11, 2026 Wharton County account describes a planned campus outside Boling and reports site preparation underway. Four current TDLR records separately identify Project Eagle Buildings A through D with June 25 registrations, scheduled dates and Review Complete labels. The larger announced campus and these four filed components are not an independently verified exact stage crosswalk. Site preparation at the wider campus does not certify construction or service in every filed building. No owner, operator, component identity, count, parcel or quantity field changes are made." }, "source_read_scope": { "amazon_selected_section": "September 11 Wharton County project introduction and What we are building", "tdlr_project_details_read": [ "TABS2026023825", "TABS2026023826", "TABS2026023832", "TABS2026023834" ], "larger_campus_to_four_components_crosswalk_unresolved": true, "technical_quantity_fields_not_exported": true } }, "notes": [ "Amazon September 11, 2026 Wharton County account describes a planned campus outside Boling and reports site preparation underway. Four current TDLR records separately identify Project Eagle Buildings A through D with June 25 registrations, scheduled dates and Review Complete labels. The larger announced campus and these four filed components are not an independently verified exact stage crosswalk. Site preparation at the wider campus does not certify construction or service in every filed building. No owner, operator, component identity, count, parcel or quantity field changes are made.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "2026-09-11", "date": "2026-09-11", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023825", "host": "www.tdlr.texas.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023826", "host": "www.tdlr.texas.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023832", "host": "www.tdlr.texas.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023834", "host": "www.tdlr.texas.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Boling · Wharton · Source context reviewed", "event_evidence": [ { "date": "2026-06-25", "text": "TDLR records date registration of Project Eagle Buildings A through D to June 25, 2026. These are four accessibility construction filings with scheduled dates, not four independently commissioned or operating campuses.", "kind": "announced", "sources": [ { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023825", "host": "www.tdlr.texas.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023826", "host": "www.tdlr.texas.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023832", "host": "www.tdlr.texas.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.tdlr.texas.gov/TABS/Search/Project/TABS2026023834", "host": "www.tdlr.texas.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] }, { "date": "2026-09-11", "text": "Amazon published its Wharton County project update on September 11, 2026 and reported campus planning with site preparation already underway. This dates the account, not an exact first work day or commissioned service in each Project Eagle component.", "kind": "announced", "sources": [ { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "2026-09-11", "date": "2026-09-11", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "48481" } }, { "id": "aws-project-spectrum-somervell-county-tx", "state": "tx", "kind": "facility", "name": "AWS Project Spectrum (Somervell/Hood County)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Somervell" ], "city": "", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. 435 acres/up-to 18 two-storybuildings/5 billioninvestment are proposals, not built/leasedcapacity or actualspending.2.4 GWComanchePeak is existingGENERATION, not campuscriticalITor dedicatedsupply/PPA; article’s 1974 plantlaunchdate not adopted without originalhistory.2.5 milliongroundbreakingpayment and 300,000 perbuildingannually are contingent terms, not receivedtaxes or paidincentives. HoodCounty 1265 acreaddress andSailfish 2000 acres/5 GWare distinct/uncrosswalked development scopes, not automaticadditions.2027 start is forecast. Readercommentcease-and-desistclaim is not independent recordevidence. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://constructionreviewonline.com/amazon-to-collocate-5-billion-project-spectrum-data-center-campus-in-texas-with-nuclear-power-plant/", "host": "constructionreviewonline.com", "date": "2026-02-24", "published": "2026-02-24", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 32.2223, "lng": -97.77472, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "ConstructionReview summarizes AmazonDataServices’ proposed ProjectSpectrum onVistra land byComanchePeak, withSomervell development-agreement motion and lease terms still unfinished.", "independently_verified_current_operating_status": null }, "notes": [ "435 acres/up-to 18 two-storybuildings/5 billioninvestment are proposals, not built/leasedcapacity or actualspending.2.4 GWComanchePeak is existingGENERATION, not campuscriticalITor dedicatedsupply/PPA; article’s 1974 plantlaunchdate not adopted without originalhistory.2.5 milliongroundbreakingpayment and 300,000 perbuildingannually are contingent terms, not receivedtaxes or paidincentives. HoodCounty 1265 acreaddress andSailfish 2000 acres/5 GWare distinct/uncrosswalked development scopes, not automaticadditions.2027 start is forecast. Readercommentcease-and-desistclaim is not independent recordevidence.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://constructionreviewonline.com/amazon-to-collocate-5-billion-project-spectrum-data-center-campus-in-texas-with-nuclear-power-plant/", "host": "constructionreviewonline.com", "date": "2026-02-24", "published": "2026-02-24", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Somervell · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "48425" } }, { "id": "aws-project-steamboat-warren-county-ms", "state": "ms", "kind": "facility", "name": "AWS Project Steamboat - Warren County Data Center Campus", "group": "proposed", "status": "Company listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Warren" ], "city": "Vicksburg", "address": "", "who": "Amazon", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. AWS Mississippi statewide and county-specific investment scopes. 25B and2000jobs are Mississippi totals, not Warren-only. State totals include previously announced amounts; do not add25Bto its components. Canton2027recycled-water transition and83millionannualgallons are future other-campus plans. Renewable616MW is generation, not IT. Ratepayer/grid/water claims remain attributed forecasts. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2025-11-20", "The original Amazon Warren County release has publication metadata dated November 20, 2025 and announces plans for the campus. This is an issuer statement date rather than computing commissioning, installed capacity or an independently verified construction start." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.aboutamazon.com/news/company-news/amazon-25-billion-mississippi-data-centers", "host": "aboutamazon.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/company-news/amazon-3-billion-mississippi-data-center-investment", "host": "www.aboutamazon.com", "published": "2025-11-20", "date": "2025-11-20", "checked": "2026-10-22", "label": "Company announced Warren County campus" } ], "loc": { "lat": 32.35656, "lng": -90.85175, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "primary-source-review-round9-2026-10-14.json", "scope": "AWS Mississippi statewide and county-specific investment scopes", "fields": { "statewide_total_planned_investment_usd": 25000000000, "statewide_expected_jobs": 2000, "warren_previously_announced_planned_investment_usd": 3000000000, "additional_madison_planned_investment_usd": 11000000000, "hinds_planned_investment_usd": 1000000000, "hinds_reuse": "former Delphi manufacturing plant" }, "notes": [ "25B and2000jobs are Mississippi totals, not Warren-only. State totals include previously announced amounts; do not add25Bto its components. Canton2027recycled-water transition and83millionannualgallons are future other-campus plans. Renewable616MW is generation, not IT. Ratepayer/grid/water claims remain attributed forecasts.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.aboutamazon.com/news/company-news/amazon-25-billion-mississippi-data-centers", "host": "aboutamazon.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Company role source check, October 22, 2026", "scope": "Amazon identifies itself as the developer of a planned data center campus in Warren County. This supports the provider brand association for the existing county level research context. The source does not independently verify the legacy project code name, a parcel, legal ownership or current physical stage.", "fields": { "company_association": { "name": "Amazon", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Amazon identifies itself as the developer of a planned data center campus in Warren County. This supports the provider brand association for the existing county level research context. The source does not independently verify the legacy project code name, a parcel, legal ownership or current physical stage." }, "provider_role": "developer" }, "notes": [ "Amazon identifies itself as the developer of a planned data center campus in Warren County. This supports the provider brand association for the existing county level research context. The source does not independently verify the legacy project code name, a parcel, legal ownership or current physical stage.", "Source retrieval and document metadata do not establish a physical milestone date." ], "sources": [ { "url": "https://www.aboutamazon.com/news/company-news/amazon-3-billion-mississippi-data-center-investment", "host": "www.aboutamazon.com", "published": "2025-11-20", "date": "2025-11-20", "checked": "2026-10-22", "label": "Company announced Warren County campus" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 75", "scope": "The complete original issuer Warren County release explicitly announces plans for a new computing campus, and its later statewide update retains that planned investment. This supports a company listed proposal at the county campus scope. Regional computing infrastructure, job training and an unrelated Rainier story link are not this campus computing commissioning. Announced future investment, employment and community fund amounts do not establish current physical construction, actual jobs or measured economic benefits. Original publication metadata dates the release November 20, 2025, distinct from its current capture.", "fields": { "current_stage_evidence": { "outcome": "issuer_named_warren_campus_proposal", "scope": "The complete original issuer Warren County release explicitly announces plans for a new computing campus, and its later statewide update retains that planned investment. This supports a company listed proposal at the county campus scope. Regional computing infrastructure, job training and an unrelated Rainier story link are not this campus computing commissioning. Announced future investment, employment and community fund amounts do not establish current physical construction, actual jobs or measured economic benefits. Original publication metadata dates the release November 20, 2025, distinct from its current capture." }, "source_read_scope": { "complete_original_warren_and_later_statewide_bodies_read": true, "original_jsonld_date_published20251120_read": true, "linked_rainier_story_not_warren_commissioning": true, "planned_investment_not_actual_operation_or_measured_benefit": true } }, "notes": [ "The complete original issuer Warren County release explicitly announces plans for a new computing campus, and its later statewide update retains that planned investment. This supports a company listed proposal at the county campus scope. Regional computing infrastructure, job training and an unrelated Rainier story link are not this campus computing commissioning. Announced future investment, employment and community fund amounts do not establish current physical construction, actual jobs or measured economic benefits. Original publication metadata dates the release November 20, 2025, distinct from its current capture.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://www.aboutamazon.com/news/company-news/amazon-3-billion-mississippi-data-center-investment", "host": "www.aboutamazon.com", "published": "2025-11-20", "date": "2025-11-20", "checked": "2026-10-24", "label": "Reviewed operator source" }, { "url": "https://www.aboutamazon.com/news/company-news/amazon-25-billion-mississippi-data-centers", "host": "www.aboutamazon.com", "published": "2026-04-09", "date": "2026-04-09", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Vicksburg · Warren · Source context reviewed", "status_scope": "The complete original issuer Warren County release explicitly announces plans for a new computing campus, and its later statewide update retains that planned investment. This supports a company listed proposal at the county campus scope. Regional computing infrastructure, job training and an unrelated Rainier story link are not this campus computing commissioning. Announced future investment, employment and community fund amounts do not establish current physical construction, actual jobs or measured economic benefits. Original publication metadata dates the release November 20, 2025, distinct from its current capture.", "event_evidence": [ { "date": "2025-11-20", "text": "The original Amazon Warren County release has publication metadata dated November 20, 2025 and announces plans for the campus. This is an issuer statement date rather than computing commissioning, installed capacity or an independently verified construction start.", "kind": "announced", "sources": [ { "url": "https://www.aboutamazon.com/news/company-news/amazon-3-billion-mississippi-data-center-investment", "host": "www.aboutamazon.com", "published": "2025-11-20", "date": "2025-11-20", "checked": "2026-10-24", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "28149" } }, { "id": "aws-richmond-county-nc", "state": "nc", "kind": "facility", "name": "Amazon Web Services Richmond County Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Richmond" ], "city": "Rockingham", "address": "", "who": "Amazon", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named government source. June26draft-permit hearing notice not final permit or operating proof as ofOctober14. Engine counts and backup versus bridge power are not campus IT MW and not normally concurrent. Hearing announcement not observed hearing outcome. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.deq.nc.gov/news/press-releases/2026/06/26/deq-announces-joint-public-hearing-amazon-data-center-and-duke-energy-air-quality-permits-richmond", "host": "deq.nc.gov", "date": "2026-06-26", "published": "2026-06-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.deq.nc.gov/news/events/public-hearing-preliminary-determination-air-quality-permit-applications-amazon-data-services-and", "host": "www.deq.nc.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Original notice expressly separates Amazon computing and Duke power streets" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=198+Energy+Way%2C+Hamlet%2C+NC+28345&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete unique literal 198 Energy Way street response" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-79.74228547430411%2C34.83131928853755%2C-79.73024652569589%2C34.841200711462456&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed source setting, acquisition date unknown" }, { "url": "https://www.aboutamazon.com/news/aws/aws-investment-north-carolina-ai-cloud-infrastructure", "host": "www.aboutamazon.com", "published": "2025-06-04", "date": "2025-06-04", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lng": -79.736266, "lat": 34.83626, "precision": "address", "basis": "The original North Carolina agency notice explicitly identifies the Amazon computing project at 198 Energy Way, Hamlet, NC 28345, separately from the Duke power facility at 1761 Airport Road. One complete unique literal Census street range gives a calculated reference inside Richmond County. The nearby energy complex is excluded as a computing building. Existing status group unknown remains unchanged. No surveyed roof, legal title or complete campus is selected. Imagery acquisition date is unknown and may predate construction." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "named government source", "fields": { "project_name": "Energy Way Tech Campus", "published_location": "Airport Road, Hamlet, Richmond County, North Carolina", "hearing_scheduled_date": "2026-07-30", "hearing_scheduled_local_time": "18:00", "comment_deadline": "2026-07-31", "proposed_duke_bridge_diesel_engines": 57, "proposed_amazon_emergency_diesel_engines": 588, "bridge_retirement_requirement_after_operation_years": 1 }, "notes": [ "June26draft-permit hearing notice not final permit or operating proof as ofOctober14. Engine counts and backup versus bridge power are not campus IT MW and not normally concurrent. Hearing announcement not observed hearing outcome.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.deq.nc.gov/news/press-releases/2026/06/26/deq-announces-joint-public-hearing-amazon-data-center-and-duke-energy-air-quality-permits-richmond", "host": "deq.nc.gov", "date": "2026-06-26", "published": "2026-06-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 60, 2026-10-24", "scope": "Explicit computing source identity and calculated Census street range only. Existing status group unknown remains unchanged. No current computing operation, surveyed roof, legal title, tenant, role, physical milestone, technical quantity or complete campus is certified.", "fields": { "location_review_decision": { "location": { "lng": -79.736266, "lat": 34.83626, "precision": "address", "basis": "The original North Carolina agency notice explicitly identifies the Amazon computing project at 198 Energy Way, Hamlet, NC 28345, separately from the Duke power facility at 1761 Airport Road. One complete unique literal Census street range gives a calculated reference inside Richmond County. The nearby energy complex is excluded as a computing building. Existing status group unknown remains unchanged. No surveyed roof, legal title or complete campus is selected. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "198 Energy Way, Hamlet, NC 28345", "county_fips": [ "37153" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "Original agency notice explicitly orders Amazon computing address 198 Energy Way before the separate Duke 1761 Airport Road power facility. The unique Census street endpoint inside Richmond is a calculated range only. Power plant, hearing venue and agency offices are excluded. No computing roof, current operation, legal title, complete campus or approval event is inferred.", "Explicit computing source identity and calculated Census street range only. Existing status group unknown remains unchanged. No current computing operation, surveyed roof, legal title, tenant, role, physical milestone, technical quantity or complete campus is certified.", "The actual source frame shows an existing industrial energy complex to the northwest, a road through the center and extensive wooded areas south and east. The literal Census endpoint is a calculated street range only. The nearby power complex is not selected as a computing building, and this image does not establish a current computing campus or construction date.", "The inherited general area coordinate was not a reviewed computing property destination. The independently named original government computing street and complete unique literal Census street response support this bounded reference inside the retained county. The measured inherited point offset is 12543.5 metres. All predecessor coordinates and source versions remain in history. This is a reference correction without physical relocation, a new computing event, selected roof, ownership, current operation or whole campus certification." ], "sources": [ { "url": "https://www.deq.nc.gov/news/events/public-hearing-preliminary-determination-air-quality-permit-applications-amazon-data-services-and", "host": "www.deq.nc.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Original notice expressly separates Amazon computing and Duke power streets" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=198+Energy+Way%2C+Hamlet%2C+NC+28345&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete unique literal 198 Energy Way street response" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-79.74228547430411%2C34.83131928853755%2C-79.73024652569589%2C34.841200711462456&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed source setting, acquisition date unknown" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Company role source check69, October24,2026", "scope": "The June 4, 2025 Amazon announcement identifies its planned AWS infrastructure investment in Richmond County. Developer per source means the named project proponent, not an identified construction contractor, property title or proof of all planned buildings being complete. Statewide investment, job and energy totals are not allocated to this record. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred.", "fields": { "company_association": { "name": "Amazon", "role": "developer", "identity_scope": "provider_brand_only", "scope": "The June 4, 2025 Amazon announcement identifies its planned AWS infrastructure investment in Richmond County. Developer per source means the named project proponent, not an identified construction contractor, property title or proof of all planned buildings being complete. Statewide investment, job and energy totals are not allocated to this record. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred." }, "provider_role": "developer" }, "notes": [ "The June 4, 2025 Amazon announcement identifies its planned AWS infrastructure investment in Richmond County. Developer per source means the named project proponent, not an identified construction contractor, property title or proof of all planned buildings being complete. Statewide investment, job and energy totals are not allocated to this record. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/aws-investment-north-carolina-ai-cloud-infrastructure", "host": "www.aboutamazon.com", "published": "2025-06-04", "date": "2025-06-04", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Calculated street reference, not a roof or complete campus", "summary": "Rockingham · Richmond · Source context reviewed" }, { "id": "aws-scioto-darby-hilliard-oh", "state": "oh", "kind": "facility", "name": "AWS Scioto Darby Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Hilliard", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Fuel-cell generation is behind-the-meter supply, not data-center critical IT capacity. City FAQ reports a construction target, not a verified start. CRA campus scope and executed agreement need separate matching. Parcel service address 4120 differs from city fuel-cell address 4186; do not move the campus pin or overwrite the parcel address.", "date": "", "events": [ [ "2026-09-15", "Hilliard published its fuel cell permit appeal withdrawal account September 15, 2026. This records the City publication and reported case action, not an independently verified ERAC filing day, data hall opening or endorsement of every project impact." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D'050-002806'&outFields=*&f=json&returnGeometry=true&outSR=4326", "host": "gis.franklincountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://hilliardohio.gov/city-of-hilliard-ends-fuel-cell-permit-appeal-calls-for-stronger-local-input/", "host": "hilliardohio.gov", "published": "2026-09-15", "date": "2026-09-15", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://hilliardohio.gov/wp-content/uploads/2022/07/BZA-AGENDA-PACKET-7-21-22-amended.pdf", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actual viewed 2022 public filing names Amazon site and includes exact retained parcel" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D%27050-002806%27&outFields=%2A&f=json&returnGeometry=true&outSR=4326&resultRecordCount=100", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "One exact retained county reference parcel and numeric situs" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.13025493775973%2C40.01445844412504%2C-83.11852506224028%2C40.02344155587495&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting only, acquisition date unknown" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0?f=pjson", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact county layer fields and reference mapping" }, { "url": "https://hilliardohio.gov/wp-content/uploads/2025/11/25-7227-Notice-of-Appeal.pdf", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actual viewed 2025 filed notice spells the complete Scioto Darby Creek street" } ], "loc": { "lng": -83.12439, "lat": 40.01895, "precision": "approximate", "basis": "Approximate mathematical center of the exact Franklin County Auditor GIS reference parcel 050-002806 at 4120 Scioto Darby Creek Road, Hilliard, Ohio. Actual viewed public filings independently name this site and the exact retained parcel. One of six historically filed parcels only, not a complete campus boundary. County reference mapping only, not a surveyed boundary, legal title, roof or completed full campus. Aerial date is unknown and may predate development. Existing native status remains unknown." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PARCELID": "050-002806", "ACRES": 143.33342767, "SITEADDRESS": "4120 SCIOTO DARBY CRK", "OWNERNME1": "AMAZON DATA SERVICES INC", "BLDGAREA": 695120 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D'050-002806'&outFields=*&f=json&returnGeometry=true&outSR=4326", "host": "gis.franklincountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "fuel_cell_generation_mw": 72.9, "fuel_cell_site_address": "4186 Scioto Darby Creek Road", "fuel_cell_site_acres_approx": 6.4, "city_described_data_center_campus_acres": 142, "fuel_cell_approval_date": "2025-09-22", "fuel_cell_operation_target": "2027-09", "city_described_cra_investment_requirement_usd": 200000000, "cra_investment_requirement_deadline": "2026-12-31" }, "notes": [ "Fuel-cell generation is behind-the-meter supply, not data-center critical IT capacity. City FAQ reports a construction target, not a verified start. CRA campus scope and executed agreement need separate matching. Parcel service address 4120 differs from city fuel-cell address 4186; do not move the campus pin or overwrite the parcel address.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "Hilliard September 15, 2026 release reports withdrawal of its ERAC appeal of the AEP fuel cell permit at the AWS Scioto Darby campus and describes modeled impacts and later monitoring plans. The FAQ discusses a separate fuel cell project and forecast. Power generation approval or construction and an appeal withdrawal do not establish the current individual data hall operating phase. No projected emissions, health threshold, water or power quantity is adopted as measured site performance. The existing concern item is already marked withdrawn and is not added again.", "fields": { "current_stage_evidence": { "outcome": "fuel_cell_permit_appeal_followup_not_individual_compute_phase", "scope": "Hilliard September 15, 2026 release reports withdrawal of its ERAC appeal of the AEP fuel cell permit at the AWS Scioto Darby campus and describes modeled impacts and later monitoring plans. The FAQ discusses a separate fuel cell project and forecast. Power generation approval or construction and an appeal withdrawal do not establish the current individual data hall operating phase. No projected emissions, health threshold, water or power quantity is adopted as measured site performance. The existing concern item is already marked withdrawn and is not added again." }, "concern_followup": { "concern_id": "concern:oh-hilliard-fuel-cell-permit-appeal-withdrawal-2026", "scope": "The existing current documented item already reports the same City withdrawal account. This capture rechecks that source without duplicating the concern or changing its original chronology. Its native concern review date is not renewed by this site context review.", "duplicate_added": false } }, "notes": [ "Hilliard September 15, 2026 release reports withdrawal of its ERAC appeal of the AEP fuel cell permit at the AWS Scioto Darby campus and describes modeled impacts and later monitoring plans. The FAQ discusses a separate fuel cell project and forecast. Power generation approval or construction and an appeal withdrawal do not establish the current individual data hall operating phase. No projected emissions, health threshold, water or power quantity is adopted as measured site performance. The existing concern item is already marked withdrawn and is not added again.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://hilliardohio.gov/city-of-hilliard-ends-fuel-cell-permit-appeal-calls-for-stronger-local-input/", "host": "hilliardohio.gov", "published": "2026-09-15", "date": "2026-09-15", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 40, October 23, 2026", "scope": "Approximate remains approximate. One bounded county reference parcel only, not a complete campus. Existing native status remains unknown.", "fields": { "location_review_decision": { "location": { "lng": -83.12439, "lat": 40.01895, "precision": "approximate", "basis": "Approximate mathematical center of the exact Franklin County Auditor GIS reference parcel 050-002806 at 4120 Scioto Darby Creek Road, Hilliard, Ohio. Actual viewed public filings independently name this site and the exact retained parcel. One of six historically filed parcels only, not a complete campus boundary. County reference mapping only, not a surveyed boundary, legal title, roof or completed full campus. Aerial date is unknown and may predate development. Existing native status remains unknown." }, "reference_method": "Approximate county reference parcel center", "reference_parcel": { "identifier": "050-002806", "identifier_field": "PARCELID", "objectid": 463565, "agency": "Franklin County Auditor GIS", "reference_method": "calculated_polygon_centroid", "not_survey_quality": true, "legal_title_verified": false, "independent_building_identity": false, "full_campus_verified": false, "operator_ownership_verified": false, "county_codes_inferred": false, "filed_reference_ids": [ "050-003336", "050-002806", "050-003210", "050-0002427", "050-002299", "050-002301" ], "complete_filed_set_adopted": false }, "operator_coordinates_adopted": false, "census_range_adopted": false } }, "notes": [ "The actually viewed City of Hilliard July 21, 2022 staff report PDF page 41 names the Amazon data center at 4120 Scioto Darby Road and explicitly lists 050-002806 among six parcel references. The actually viewed November 7, 2025 filed notice PDF page 1 spells 4120 Scioto Darby Creek Road for the AWS site. The current exact Franklin County parcel 050-002806 has numeric situs 4120 SCIOTO DARBY CRK. This independently joins the retained exact parcel association to the named site without selecting a neighboring owner parcel or adopting project status. Only this bounded county reference parcel is admitted, not all six parcels or a complete campus. The historical list raw 050-0002427 spelling is preserved and not silently corrected.", "Approximate remains approximate. One bounded county reference parcel only, not a complete campus. Existing native status remains unknown.", "Actually viewed wooded and open ground, streets, highway and nearby commercial forms. Acquisition date is unknown and may predate development. No new construction, absence, completed campus, future roof or present operating finding is adopted." ], "sources": [ { "url": "https://hilliardohio.gov/wp-content/uploads/2022/07/BZA-AGENDA-PACKET-7-21-22-amended.pdf", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actual viewed 2022 public filing names Amazon site and includes exact retained parcel" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D%27050-002806%27&outFields=%2A&f=json&returnGeometry=true&outSR=4326&resultRecordCount=100", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "One exact retained county reference parcel and numeric situs" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.13025493775973%2C40.01445844412504%2C-83.11852506224028%2C40.02344155587495&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting only, acquisition date unknown" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0?f=pjson", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact county layer fields and reference mapping" }, { "url": "https://hilliardohio.gov/wp-content/uploads/2025/11/25-7227-Notice-of-Appeal.pdf", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actual viewed 2025 filed notice spells the complete Scioto Darby Creek street" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Approximate county reference parcel, not a confirmed building or full campus", "summary": "Hilliard · Franklin · Source context reviewed", "event_evidence": [ { "date": "2026-09-15", "text": "Hilliard published its fuel cell permit appeal withdrawal account September 15, 2026. This records the City publication and reported case action, not an independently verified ERAC filing day, data hall opening or endorsement of every project impact.", "kind": "announced", "sources": [ { "url": "https://hilliardohio.gov/city-of-hilliard-ends-fuel-cell-permit-appeal-calls-for-stronger-local-input/", "host": "hilliardohio.gov", "published": "2026-09-15", "date": "2026-09-15", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ] }, { "id": "aws-sprigg-township-adams-county-oh", "state": "oh", "kind": "facility", "name": "AWS Sprigg Township Data Center Campus (Buck Canyon)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Adams" ], "city": "Manchester", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Undated county project FAQ. These are proposed-project forecasts, not actual water use or jobs. The page includes separate statewide jobs and unrelated restoration water benefits; excluded. Cooling circuit and consumption versus withdrawal basis need primary engineering permits. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://amazon.adamscountyoh.gov/", "host": "amazon.adamscountyoh.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 38.84551, "lng": -83.47206, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "planned_investment_usd_minimum": 10000000000, "forecast_long_term_jobs_minimum": 500, "forecast_cooling_water_gallons_per_year_approx": 19700000, "advertised_cooling_water_source": "Ohio River", "developer_stage_as_described": "due diligence; general contractor not yet determined" }, "notes": [ "Undated county project FAQ. These are proposed-project forecasts, not actual water use or jobs. The page includes separate statewide jobs and unrelated restoration water benefits; excluded. Cooling circuit and consumption versus withdrawal basis need primary engineering permits.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://amazon.adamscountyoh.gov/", "host": "amazon.adamscountyoh.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "The County current Amazon page describes evaluation, due diligence and future building plans, with initial earthwork expected during 2026. It does not expressly identify Sprigg Township, Buck Canyon or the inherited parcel component. This broader county development account remains context until the exact proposal crosswalk is established. No expired or current year earthwork forecast, industrial site activity or wetland permit is promoted into actual data center construction, entitlement or operation.", "fields": { "current_stage_evidence": { "outcome": "county_amazon_development_context_without_exact_buck_canyon_component_crosswalk", "scope": "The County current Amazon page describes evaluation, due diligence and future building plans, with initial earthwork expected during 2026. It does not expressly identify Sprigg Township, Buck Canyon or the inherited parcel component. This broader county development account remains context until the exact proposal crosswalk is established. No expired or current year earthwork forecast, industrial site activity or wetland permit is promoted into actual data center construction, entitlement or operation." } }, "notes": [ "The County current Amazon page describes evaluation, due diligence and future building plans, with initial earthwork expected during 2026. It does not expressly identify Sprigg Township, Buck Canyon or the inherited parcel component. This broader county development account remains context until the exact proposal crosswalk is established. No expired or current year earthwork forecast, industrial site activity or wetland permit is promoted into actual data center construction, entitlement or operation.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://amazon.adamscountyoh.gov/", "host": "amazon.adamscountyoh.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Manchester · Adams · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39001" } }, { "id": "aws-trenton-madison-st-clair-butler-oh", "state": "oh", "kind": "facility", "name": "AWS Trenton / Madison-St. Clair Township Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Butler" ], "city": "Trenton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. TIF redirects tax increments; it is not automatically tax forgiveness. Competing proposed distributions are not actual receipts or final annexation; 141-acre and 600-acre schemes remain distinct. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wcpo.com/news/local-news/in-your-community/butler-county/townships-move-to-capture-future-data-center-tax-revenue-as-trenton-pursues-annexation", "host": "wcpo.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.4386, "lng": -84.57549, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Journal-News reporting via WCPO describes competing township and Trenton TIF/annexation approaches for AWS land.", "independently_verified_current_operating_status": null }, "notes": [ "TIF redirects tax increments; it is not automatically tax forgiveness. Competing proposed distributions are not actual receipts or final annexation; 141-acre and 600-acre schemes remain distinct.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.wcpo.com/news/local-news/in-your-community/butler-county/townships-move-to-capture-future-data-center-tax-revenue-as-trenton-pursues-annexation", "host": "wcpo.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Trenton · Butler · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39017" } }, { "id": "aws-umatilla-city-or", "state": "or", "kind": "facility", "name": "AWS Umatilla Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Umatilla" ], "city": "Umatilla", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. historical Oregon multi-program incentive context,primaryMorrowprojectnotboundsite. June2023agenda cover conflicts with2022running header; exact document date held. AppletwoLRZprojects not necessarilytwo physical campuses. MainMorrowCounty proposed2.37Bproject and113Mestimatednetbenefit do not belong to either boundApplePrineville orAmazonUmatillacampus. Historical15yearregime notcurrent2026eligibility; no tax savings allocated perbuilding. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.oregon.gov/biz/Publications/Boards/Business%20Oregon%20Commission/2023/AmazonSIPAgendaItem.pdf", "host": "oregon.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 45.62556, "lng": -118.77393, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "historical Oregon multi-program incentive context,primaryMorrowprojectnotboundsite", "fields": { "historical_umatilla_amazon_sip_approval_year": 2017, "historical_prineville_apple_lrz_exempt_projects": 2, "historical_prineville_apple_lrz_term_years": 15, "historical_reporting_period": "2022-2023" }, "notes": [ "June2023agenda cover conflicts with2022running header; exact document date held. AppletwoLRZprojects not necessarilytwo physical campuses. MainMorrowCounty proposed2.37Bproject and113Mestimatednetbenefit do not belong to either boundApplePrineville orAmazonUmatillacampus. Historical15yearregime notcurrent2026eligibility; no tax savings allocated perbuilding.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.oregon.gov/biz/Publications/Boards/Business%20Oregon%20Commission/2023/AmazonSIPAgendaItem.pdf", "host": "oregon.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Umatilla · Umatilla · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "41059" } }, { "id": "aws-wallula-gap-walla-walla-wa", "state": "wa", "kind": "facility", "name": "AWS Wallula Gap Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Walla Walla" ], "city": "Wallula", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Wallula Gap public application with dated county update. 134acre current application and554acre sale are different scopes, not contradictory or additive. August11operator open house explicitly not county-sponsored public hearing. Comment deadline has passed but no final decision established. Parcel identifier not a researched parcel coordinate. No site MW published here. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wwcowa.gov/government/community_development/amazon_data_center.php", "host": "wwcowa.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 46.22975, "lng": -118.47867, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "Wallula Gap public application with dated county update", "fields": { "county_page_updated": "2026-10-02", "application_ids": [ "SDP26-01", "SEPA26-05" ], "published_project_parcel": "310835410003", "site_acres": 134, "planned_data_center_buildings": 3, "planned_area_per_data_center_building_sqft_approx": 220000, "published_location_description": "Sundance Road between Dodd and Worden Road, about1.4miles east ofUS12", "application_determined_complete_date": "2026-08-24", "notice_comment_deadline": "2026-10-12", "port_sale_approval_date": "2026-02-12", "port_sale_acres": 554 }, "notes": [ "134acre current application and554acre sale are different scopes, not contradictory or additive. August11operator open house explicitly not county-sponsored public hearing. Comment deadline has passed but no final decision established. Parcel identifier not a researched parcel coordinate. No site MW published here.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.wwcowa.gov/government/community_development/amazon_data_center.php", "host": "wwcowa.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Wallula · Walla Walla · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "53071" } }, { "id": "aws-warner-road-jerome-township-oh", "state": "oh", "kind": "facility", "name": "AWS Warner Road Campus (Jerome Township)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Union" ], "city": "Plain City", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Union County Warner Road cadastral duplicates and historical improvements. 24joinedfeaturesand7distinctattributesnot24or7independentbuildings. Repeated215k-likeareas acrossyears may be same improvement; no summed area/count. YearBuiltassessmentnotfirst data service. Appraised value not actual investment or incentives. Geometry EPSG3857notlat/lon. No current operating status or ITMW. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www7.co.union.oh.us/unioncountyohio/rest/services/ParcelAllSaleinfoBuildingInfo/MapServer/1/query?where=ParcelNo%3D'1500300200000'&outFields=ParcelNo,DeedOwner,Address,city,township,Acreage,classDescription,yearBuilt,TotalBuildingArea,AppraisedBuildValue&f=json", "host": "www7.co.union.oh.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.27252, "lng": -83.36916, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Union County Warner Road cadastral duplicates and historical improvements", "fields": { "agency": "Union County Ohio parcel service", "parcel": "1500300200000", "deed_owner_as_listed": "AMAZON DATA SERVICES INC", "situs_address": "8567 Warner Road", "postal_city": "Plain City", "township": "Jerome", "parcel_acres": 92.77, "returned_feature_rows": 24, "distinct_attribute_rows": 7, "assessment_build_years": [ 2023, 2024 ], "assessment_area_values_sqft_unique": [ 900, 13851, 156826, 214097, 214507 ] }, "notes": [ "24joinedfeaturesand7distinctattributesnot24or7independentbuildings. Repeated215k-likeareas acrossyears may be same improvement; no summed area/count. YearBuiltassessmentnotfirst data service. Appraised value not actual investment or incentives. Geometry EPSG3857notlat/lon. No current operating status or ITMW.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www7.co.union.oh.us/unioncountyohio/rest/services/ParcelAllSaleinfoBuildingInfo/MapServer/1/query?where=ParcelNo%3D'1500300200000'&outFields=ParcelNo,DeedOwner,Address,city,township,Acreage,classDescription,yearBuilt,TotalBuildingArea,AppraisedBuildValue&f=json", "host": "www7.co.union.oh.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Plain City · Union · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39159" } }, { "id": "aws-westborough-ma", "state": "ma", "kind": "facility", "name": "Amazon Data Services Westborough", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Worcester" ], "city": "Westborough", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.. TimothyDoyle WBJ November22,2022 original registry/assessor report: AmazonDataServices bought Grafton8Centennial155000sf/1.8acres for15.1M and Westborough600/800Friberg for11.6M,26.7M COMBINED. Westborough600 building was StateStreetDC,99160sf; twoWestboroughlots19acres total. Thursdayclosing impliesNovember17, not originaldeedread. Grafton flexbuilding DCuse UNCONFIRMED; Amazon didnot respond onfutureuses. Propertyprice is notnewDCconstruction spending or operatingproof. Other AmazonRobotics/OtisStreetprojects aredifferent uses/properties, notadditionalDCs. Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://wbjournal.com/article/amazon-buys-properties-in-grafton-and-westborough-for-267m/", "host": "wbjournal.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.37554, "lng": -71.93403, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-acquisitions-regulatory-stage-and-site-crosswalks-round81-2026-10-15.json", "scope": "Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.", "fields": {}, "notes": [ "TimothyDoyle WBJ November22,2022 original registry/assessor report: AmazonDataServices bought Grafton8Centennial155000sf/1.8acres for15.1M and Westborough600/800Friberg for11.6M,26.7M COMBINED. Westborough600 building was StateStreetDC,99160sf; twoWestboroughlots19acres total. Thursdayclosing impliesNovember17, not originaldeedread.", "Grafton flexbuilding DCuse UNCONFIRMED; Amazon didnot respond onfutureuses. Propertyprice is notnewDCconstruction spending or operatingproof. Other AmazonRobotics/OtisStreetprojects aredifferent uses/properties, notadditionalDCs.", "Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified." ], "sources": [ { "url": "https://wbjournal.com/article/amazon-buys-properties-in-grafton-and-westborough-for-267m/", "host": "wbjournal.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Westborough · Worcester · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "25027" } }, { "id": "aws-wheatfield-in", "state": "in", "kind": "facility", "name": "AWS Wheatfield Campus (Project Rise)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Jasper" ], "city": "Wheatfield", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named operator concept or attributed original local reporting, with dates and numerical scopes.. Northwest Indiana Business June 18, 2026 reports officials approved Project Rise June 17, drawing on Northwest Indiana Forum and other attributed reporting. Exact approval instrument, all permits and current construction were not inspected. AWS Wheatfield/Jasper County identity gains context. $7 billion community investment and 250 future jobs are plans, not spending or actual headcount. $98 million described as paid in advance appears in future-deal narrative; independent payment receipt unread. $25 million public-water expansion and separately funded campus water/wastewater infrastructure are different scopes, not measured withdrawal. Annual-revenue/ten-year wording is ambiguous; no multiplied tax total adopted. 304 acres near Schahfer is attributed reporting, not surveyed parcel. 400 MW NIPSCO peaker and $643.7 million plant construction/financing describe generation, not campus IT or data-center capex. Air cooling except about 2% of the year is not 2% of water volume or zero annual use. 425-acre habitat and 110-million-gallon annual water-availability increase are commitments/projections, not completed restoration or campus use. Other regional Amazon investments are separate/possibly overlapping scopes. No complete record/current operating status, signed instruments, measured impacts or all-field certification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://nwindianabusiness.com/industries/professional-services/information-technology/officials-approve-jasper-county-amazon-data-center/78353/", "host": "nwindianabusiness.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.jaspercountyin.gov/government/documents/meeting-documents/county-commissioners/2026-county-commissioners-meetings/2026-county-commissioners-meetings-minutes/617-05-18-2026-jasper-county-commissioners-special-meeting-minutes/file", "host": "www.jaspercountyin.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.02309, "lng": -87.116, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "border-state-original-reporting-and-operator-stage-review-round67-2026-10-15.json", "scope": "Named operator concept or attributed original local reporting, with dates and numerical scopes.", "fields": {}, "notes": [ "Northwest Indiana Business June 18, 2026 reports officials approved Project Rise June 17, drawing on Northwest Indiana Forum and other attributed reporting. Exact approval instrument, all permits and current construction were not inspected. AWS Wheatfield/Jasper County identity gains context.", "$7 billion community investment and 250 future jobs are plans, not spending or actual headcount. $98 million described as paid in advance appears in future-deal narrative; independent payment receipt unread. $25 million public-water expansion and separately funded campus water/wastewater infrastructure are different scopes, not measured withdrawal. Annual-revenue/ten-year wording is ambiguous; no multiplied tax total adopted.", "304 acres near Schahfer is attributed reporting, not surveyed parcel. 400 MW NIPSCO peaker and $643.7 million plant construction/financing describe generation, not campus IT or data-center capex. Air cooling except about 2% of the year is not 2% of water volume or zero annual use. 425-acre habitat and 110-million-gallon annual water-availability increase are commitments/projections, not completed restoration or campus use. Other regional Amazon investments are separate/possibly overlapping scopes.", "No complete record/current operating status, signed instruments, measured impacts or all-field certification." ], "sources": [ { "url": "https://nwindianabusiness.com/industries/professional-services/information-technology/officials-approve-jasper-county-amazon-data-center/78353/", "host": "nwindianabusiness.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 23", "scope": "Jasper County May 18, 2026 special meeting minutes record tabling Amazon Data Services and NIPSCO agreements to the June 1 meeting while details were addressed. They do not record June 1 approval or crosswalk the agreement to the inherited Project Rise component. Wheatfield is separately mentioned in County auction business, which is not a site identity match. A later reported approval, a regional Amazon investment or the expiry of that schedule is not a current individual construction or operating fact. The component and phase remain held.", "fields": { "current_stage_evidence": { "outcome": "county_agreement_tabling_not_exact_wheatfield_component_or_later_approval", "scope": "Jasper County May 18, 2026 special meeting minutes record tabling Amazon Data Services and NIPSCO agreements to the June 1 meeting while details were addressed. They do not record June 1 approval or crosswalk the agreement to the inherited Project Rise component. Wheatfield is separately mentioned in County auction business, which is not a site identity match. A later reported approval, a regional Amazon investment or the expiry of that schedule is not a current individual construction or operating fact. The component and phase remain held." } }, "notes": [ "Jasper County May 18, 2026 special meeting minutes record tabling Amazon Data Services and NIPSCO agreements to the June 1 meeting while details were addressed. They do not record June 1 approval or crosswalk the agreement to the inherited Project Rise component. Wheatfield is separately mentioned in County auction business, which is not a site identity match. A later reported approval, a regional Amazon investment or the expiry of that schedule is not a current individual construction or operating fact. The component and phase remain held.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://www.jaspercountyin.gov/government/documents/meeting-documents/county-commissioners/2026-county-commissioners-meetings/2026-county-commissioners-meetings-minutes/617-05-18-2026-jasper-county-commissioners-special-meeting-minutes/file", "host": "www.jaspercountyin.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Wheatfield · Jasper · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "18073" } }, { "id": "aws-wilmington-clinton-oh", "state": "oh", "kind": "facility", "name": "AWS Wilmington Data Center Campus", "group": "proposed", "status": "Agency listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Clinton" ], "city": "Wilmington", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Wilmington official project site and separate annexation petition. Separate545acJanuary15,2026annexation petition by four owners not automatically this471acAWSsite. Developer infrastructure25Mplus forecast not actual completed upgrades or money paid to county. Entitlement/annexation not energization. Nine planned data buildings not operational building census. Quoted current code requirements from FAQ not independent signed ordinance inspection. No ITMW or exact customer service date adopted. School compensation approval reported by agency, but executed signed agreement not independently read. Promised upfront/annual payments not actual receipts. Water6M is ANNUAL, not daily, and not guaranteed peak demand. One-million-gallon PUBLIC water tower is storage capacity, not annual DC consumption. State tax award reported but underlying award not inspected; no local CRA percentage/term guessed from first reading. Distribution/transmission assurances explicitly do not cover generation rates. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2025-08-07", "The Port Authority FAQ reports City Council approval of project site annexation August 7, 2025. This is its bounded government account of that municipal action, not approval or operation of the data center, certification of every annexed parcel or a change to Atlas jurisdiction fields." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.chooseclintoncountyoh.org/news/data-center-faqs", "host": "chooseclintoncountyoh.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.42665, "lng": -83.8212, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Wilmington official project site and separate annexation petition", "fields": { "publisher_role": "Clinton County Port Authority economic-development FAQ", "project_operator": "AWS", "address": "1488 SouthUS68, Wilmington, Ohio45177", "project_site_acres": 471, "planned_principal_data_center_buildings": 9, "total_planned_building_sqft": 1920299, "individual_building_sqft_range": [ 162787, 219689 ], "agency_reported_annexation_approval_date": "2025-08-07", "agency_reported_light_industrial_zoning_approval_date": "2025-08-07", "agency_reported_dc_code_requirements_approval_date": "2025-07-17", "faq_location_zoning_updated_date": "2026-03-25", "developer_paid_public_infrastructure_capex_usd_min_exclusive": 25000000, "minimum_expected_permanent_jobs": 100, "expected_construction_jobs_min_exclusive": 200, "construction_duration_years_min_inclusive": 5, "expected_school_annual_revenue_usd": 1000000, "agency_reported_school_compensation_approval_date": "2025-11-19", "promised_upfront_city_payment_usd": 1500000, "separate_port_authority_payment_usd": 350000, "expected_annual_city_pilot_plus_income_tax_usd_min_exclusive": 1000000, "estimated_annual_water_gallons": 6000000, "water_basis": "developer projection quoted in FAQ, not metered actual", "water_service_agreement_stage": "being pursued", "city_public_water_tower_planned_gallons": 1000000 }, "notes": [ "Separate545acJanuary15,2026annexation petition by four owners not automatically this471acAWSsite. Developer infrastructure25Mplus forecast not actual completed upgrades or money paid to county. Entitlement/annexation not energization. Nine planned data buildings not operational building census. Quoted current code requirements from FAQ not independent signed ordinance inspection. No ITMW or exact customer service date adopted.", "School compensation approval reported by agency, but executed signed agreement not independently read. Promised upfront/annual payments not actual receipts. Water6M is ANNUAL, not daily, and not guaranteed peak demand. One-million-gallon PUBLIC water tower is storage capacity, not annual DC consumption. State tax award reported but underlying award not inspected; no local CRA percentage/term guessed from first reading. Distribution/transmission assurances explicitly do not cover generation rates.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.chooseclintoncountyoh.org/news/data-center-faqs", "host": "chooseclintoncountyoh.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "The Port Authority current FAQ explicitly names the AWS Wilmington campus proposal and the South US 68 project site, separately distinguishing other land petitions and their unidentified prospective end users. Agency listed proposal is limited to the named AWS account. Its August 7, 2025 annexation statement is not data center commissioning, individual site plan approval or a new jurisdiction edit. Water use, utility effects and community benefits remain attributed design estimates and explanations, not measured outcomes. A future design or service agreement is not delivered infrastructure.", "fields": { "current_stage_evidence": { "outcome": "named_aws_wilmington_proposal_separate_from_other_land_petitions", "scope": "The Port Authority current FAQ explicitly names the AWS Wilmington campus proposal and the South US 68 project site, separately distinguishing other land petitions and their unidentified prospective end users. Agency listed proposal is limited to the named AWS account. Its August 7, 2025 annexation statement is not data center commissioning, individual site plan approval or a new jurisdiction edit. Water use, utility effects and community benefits remain attributed design estimates and explanations, not measured outcomes. A future design or service agreement is not delivered infrastructure." } }, "notes": [ "The Port Authority current FAQ explicitly names the AWS Wilmington campus proposal and the South US 68 project site, separately distinguishing other land petitions and their unidentified prospective end users. Agency listed proposal is limited to the named AWS account. Its August 7, 2025 annexation statement is not data center commissioning, individual site plan approval or a new jurisdiction edit. Water use, utility effects and community benefits remain attributed design estimates and explanations, not measured outcomes. A future design or service agreement is not delivered infrastructure.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://www.chooseclintoncountyoh.org/news/data-center-faqs", "host": "www.chooseclintoncountyoh.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Wilmington · Clinton · Source context reviewed", "status_scope": "The Port Authority current FAQ explicitly names the AWS Wilmington campus proposal and the South US 68 project site, separately distinguishing other land petitions and their unidentified prospective end users. Agency listed proposal is limited to the named AWS account. Its August 7, 2025 annexation statement is not data center commissioning, individual site plan approval or a new jurisdiction edit. Water use, utility effects and community benefits remain attributed design estimates and explanations, not measured outcomes. A future design or service agreement is not delivered infrastructure.", "event_evidence": [ { "date": "2025-08-07", "text": "The Port Authority FAQ reports City Council approval of project site annexation August 7, 2025. This is its bounded government account of that municipal action, not approval or operation of the data center, certification of every annexed parcel or a change to Atlas jurisdiction fields.", "kind": "approved", "sources": [ { "url": "https://www.chooseclintoncountyoh.org/news/data-center-faqs", "host": "www.chooseclintoncountyoh.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39027" } } ], "compilation_license": "withheld_pending_owner_decision" }