{ "schema_version": 1, "source_compilation_context": { "al": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/al.json", "updated": "2026-10-24" }, "ky": { "attribution": { "research": "Data Centers Atlas research from county and city records, Public Service Commission filings, company announcements and local news, linked on each record.", "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/" }, "counties": "U.S. Census Bureau county boundaries (public domain)", "geocoder": "U.S. Census Bureau geocoder (public domain)", "geometry": { "license": "ODbL 1.0", "credit": "OpenStreetMap contributors", "url": "https://www.openstreetmap.org/copyright", "note": "Matched building centers are adapted separately from the inventory; not surveyed parcels" } }, "source_data_url": "https://datacentersatlas.com/data/ky.json", "updated": "2026-10-24" }, "nc": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/nc.json", "updated": "2026-10-25" }, "nd": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/nd.json", "updated": "2026-10-24" }, "ok": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/ok.json", "updated": "2026-10-24" }, "tx": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/tx.json", "updated": "2026-10-24" } }, "scope": "Linked company names and sourced roles retain their separate meaning in each record. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.", "collection": { "kind": "companies", "key": "core-scientific", "label": "Core Scientific" }, "records": [ { "id": "core-scientific-auburn-al", "state": "al", "kind": "facility", "name": "Core Scientific Auburn Data Center (AUBix)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lee" ], "city": "Auburn", "address": "", "who": "Core Scientific", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. AIenabledoperatorofferingnotindependentall50MWenergized/currentNVIDIAcertificatereview. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Current operator listing for Auburn 1; no explicit whole-record current operating milestone established. The page lists the location and operator features but does not explicitly establish a present operating milestone. Operator capacity labels are not independently verified energized load. Current status and inherited point precision remain unresolved. Publication date is not established.", "date": "", "events": [ [ "2025-02-19", "The February 19, 2025 publication date of the original company release announces entry into the existing Auburn AUBix facility and a planned launch. This is not the exact physical opening, completion of every expansion or an independently verified delivered capacity." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://corescientific.com/high-density-data-centers/auburn-al/", "host": "corescientific.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" }, { "url": "https://investors.corescientific.com/sec-filings/all-sec-filings/content/0001628280-26-013305/core-20251231.htm", "host": "investors.corescientific.com", "published": "2026-03-02", "date": "2026-03-02", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://investors.corescientific.com/news-events/press-releases/detail/107/core-scientific-announces-expansion-into-auburn-alabama-with-new-high-performance-computing-facility", "host": "investors.corescientific.com", "published": "2025-02-19", "date": "2025-02-19", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://gis.auburnalabama.org/public/rest/services/Tools/PublicSearch/MapServer/0/query?where=AddressNumber+%3D+1571+AND+UPPER%28StreetName%29+%3D+%27SAMFORD%27&outFields=OBJECTID%2CFacilityID%2CAddressNumber%2CStreetName%2CFullStreet%2CFullAddress%2CMailingCity%2CState%2CZip%2CAddressAuthority%2CAddressClassification%2CAddressPointType%2CCreatedDate&returnGeometry=true&outSR=4326&f=json", "host": "gis.auburnalabama.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Independent City Address Authority point for the exact operator street" }, { "url": "https://gis.auburnalabama.org/public/rest/services/PublicService/Parcels/MapServer/0/query?geometry=-85.51275405445307%2C32.60119153688463&geometryType=esriGeometryPoint&inSR=4326&spatialRel=esriSpatialRelIntersects&outFields=OBJECTID%2CPARCEL%2CPIN%2CSTRNUM%2CSTRNAM%2CACRES_COUNTY%2CACRES&returnGeometry=true&outSR=4326&f=json", "host": "gis.auburnalabama.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete spatial intersection joins the City address authority to one parcel" }, { "url": "https://gis.auburnalabama.org/public/rest/services/PublicService/Parcels/MapServer/0/query?where=PIN+%3D+%2760478%27+AND+UPPER%28STRNAM%29+%3D+%271571+W+SAMFORD+AVE%27&outFields=OBJECTID%2CPARCEL%2CPIN%2CSTRNUM%2CSTRNAM%2CACRES_COUNTY%2CACRES&returnGeometry=true&outSR=4326&f=json", "host": "gis.auburnalabama.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete exact full situs and PIN parcel query" }, { "url": "https://gis.auburnalabama.org/public/rest/services/PublicService/Parcels/MapServer/0?f=pjson", "host": "gis.auburnalabama.org", "published": "", "date": "", "checked": "2026-10-23", "label": "City geometry and Lee County parcel attribute definitions" }, { "url": "https://api2.auburnalabama.org/ePacket/2726/file/7556", "host": "api2.auburnalabama.org", "published": "", "date": "", "checked": "2026-10-23", "label": "January 20, 2026 agenda separates data center 1571 and substation 1501" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1571+W+Samford+Ave%2C+Auburn%2C+AL+36832&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete literal Census street response and county context" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-85.51924474605134%2C32.59610928853755%2C-85.50751525394865%2C32.605990711462454&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting with unknown image acquisition date" } ], "loc": { "lng": -85.51338, "lat": 32.60105, "precision": "approximate", "basis": "Approximate calculated center of the complete official City of Auburn parcel 0807260000025005, PIN 60478, independently matched through the City Address Authority to the operator facility street 1571 W Samford Avenue. The original literal Census query has zero matches and is retained. The center is a bounded source parcel reference, without a surveyed roof, legal title, operating computing or full campus claim. Existing status group unknown remains unchanged. Imagery acquisition date is unknown and may predate construction." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "published_address": "1571 W Samford Ave, Auburn, AL36832", "advertised_total_power_capacity_mw": 50, "campus_acres": 6, "total_area_sqft": 39202, "power_basis": "totalpowercapacity, not explicitlycriticalIT" }, "notes": [ "AIenabledoperatorofferingnotindependentall50MWenergized/currentNVIDIAcertificatereview.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/auburn-al/", "host": "corescientific.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Atlas targeted primary-source follow-up", "scope": "Current operator listing for Auburn 1; no explicit whole-record current operating milestone established", "fields": { "operator_published_address": "1571 W Samford Ave, Auburn, AL 36832", "listed_facility_name": "Auburn 1" }, "notes": [ "The page lists the location and operator features but does not explicitly establish a present operating milestone. Operator capacity labels are not independently verified energized load. Current status and inherited point precision remain unresolved. Publication date is not established." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/auburn-al/", "host": "corescientific.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "checked": "2026-10-15", "capture_sha256": "d08b2bf78a94f86f17ffc6c8f0d04cbd1b434a606a468eb7537b5e13f8c8b393", "events": [], "whole_record_certified": false }, { "overlay": "overnight-discovery-2026-10-17", "scope": "Source-scoped official discovery and annual-filing comparison; research-context associations do not certify distinct physical sites or current whole-campus activity.", "fields": { "issuer_annual_utility_context": { "issuer": "Core Scientific", "reporting_period": "2025-12-31", "source_rows": [ { "location": "Auburn, Alabama", "utility": "Alabama Power Company", "gross_utility_capacity_mw": 50 } ], "scope": "Annual gross utility-capacity context only; not critical IT, current load, an opened phase or an unambiguous physical-site boundary. No typed MW fact or summed campus total added." } }, "notes": [ "No status, address, map point, jurisdiction, operating date or technical quantity is promoted in this review. Annual filings retain their reporting periods; a fresh retrieval is not a fresh physical-site certification." ], "sources": [ { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 43", "scope": "The current original company page names Auburn 1 and lists facility specifications. The issuer March 2, 2026 annual report lists Auburn in its December 31, 2025 utility capacity table, and the February 19, 2025 original release describes taking over the existing AUBix facility with a future launch. A utility allocation, owned or leased portfolio total, acquisition process and marketed specifications do not separately establish actual customer computing at every Auburn component today. Current physical stage remains unclear; no capacity, completed expansion, title or employee outcome is promoted.", "fields": { "current_stage_evidence": { "outcome": "current_named_marketing_and_annual_capacity_table_not_exact_current_compute_stage", "scope": "The current original company page names Auburn 1 and lists facility specifications. The issuer March 2, 2026 annual report lists Auburn in its December 31, 2025 utility capacity table, and the February 19, 2025 original release describes taking over the existing AUBix facility with a future launch. A utility allocation, owned or leased portfolio total, acquisition process and marketed specifications do not separately establish actual customer computing at every Auburn component today. Current physical stage remains unclear; no capacity, completed expansion, title or employee outcome is promoted." }, "source_read_scope": { "annual_report_sections": [ "Business Operations and Segments", "Power Providers utility capacity table" ], "annual_table_as_of": "2025-12-31", "whole_annual_report_audited": false, "current_named_auburn_page_read": true } }, "notes": [ "The current original company page names Auburn 1 and lists facility specifications. The issuer March 2, 2026 annual report lists Auburn in its December 31, 2025 utility capacity table, and the February 19, 2025 original release describes taking over the existing AUBix facility with a future launch. A utility allocation, owned or leased portfolio total, acquisition process and marketed specifications do not separately establish actual customer computing at every Auburn component today. Current physical stage remains unclear; no capacity, completed expansion, title or employee outcome is promoted.", "All existing identity, organization roles, location, jurisdiction, quantity and physical opening fields remain unchanged. Source checks and prospective dates are not physical opening days." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/auburn-al/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://investors.corescientific.com/sec-filings/all-sec-filings/content/0001628280-26-013305/core-20251231.htm", "host": "investors.corescientific.com", "published": "2026-03-02", "date": "2026-03-02", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://investors.corescientific.com/news-events/press-releases/detail/107/core-scientific-announces-expansion-into-auburn-alabama-with-new-high-performance-computing-facility", "host": "investors.corescientific.com", "published": "2025-02-19", "date": "2025-02-19", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check 31, October 23, 2026", "scope": "Core Scientific identifies the same named Auburn 1 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown.", "fields": { "company_association": { "name": "Core Scientific", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Core Scientific identifies the same named Auburn 1 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." }, "provider_role": "operator" }, "notes": [ "Core Scientific identifies the same named Auburn 1 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/auburn-al/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 55, October 23, 2026", "scope": "Explicit source bound reference only. Existing status group unknown remains unchanged. No new computing operation, operator role, title, owner, tenant, physical milestone, quantity, certification, roof or complete campus is certified.", "fields": { "location_review_decision": { "location": { "lng": -85.51338, "lat": 32.60105, "precision": "approximate", "basis": "Approximate calculated center of the complete official City of Auburn parcel 0807260000025005, PIN 60478, independently matched through the City Address Authority to the operator facility street 1571 W Samford Avenue. The original literal Census query has zero matches and is retained. The center is a bounded source parcel reference, without a surveyed roof, legal title, operating computing or full campus claim. Existing status group unknown remains unchanged. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Approximate county reference parcel center", "reference_parcel": { "identifier": "0807260000025005", "identifier_field": "PARCEL", "objectid": 1193849, "agency": "City of Auburn GIS, with Lee County parcel attributes", "reference_method": "calculated_polygon_centroid", "not_survey_quality": true, "legal_title_verified": false, "independent_building_identity": false, "full_campus_verified": false, "operator_ownership_verified": false, "geometry_acquisition_date": null }, "operator_coordinates_adopted": false, "census_range_adopted": false } }, "notes": [ "The operator names 1571 W Samford Avenue. The literal Census query returns zero. An independent exact City Address Authority query returns one City address at that complete street. Its spatial parcel join and an independent complete situs and PIN query return the same single parcel. The parcel STRNUM is null and STRNAM contains the complete street, so the original split situs query also returns zero. The January 20, 2026 City agenda separately names Project Apollo data center expansion at 1571 and a substation at 1501; the substation is excluded. Source layer dates and address creation metadata are not facility milestones.", "Explicit source bound reference only. Existing status group unknown remains unchanged. No new computing operation, operator role, title, owner, tenant, physical milestone, quantity, certification, roof or complete campus is certified.", "A large industrial or institutional roof and paved areas lie among other buildings, roads, wooded ground and a diagonal transportation corridor. The selected official parcel center is an approximate source area reference only. No visible roof, current workload, expansion completion or legal title is certified.", "The inherited general area coordinate and county display were not reviewed physical facility destinations. The exact independent official sources now support only the bounded reference described in the basis. Earlier coordinates and complete source history remain intact. This is a reference correction, without a claim of physical relocation or a new physical milestone." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/auburn-al/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Named Auburn facility street" }, { "url": "https://investors.corescientific.com/news-events/press-releases/detail/107/core-scientific-announces-expansion-into-auburn-alabama-with-new-high-performance-computing-facility", "host": "investors.corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Original Auburn facility announcement" }, { "url": "https://gis.auburnalabama.org/public/rest/services/Tools/PublicSearch/MapServer/0/query?where=AddressNumber+%3D+1571+AND+UPPER%28StreetName%29+%3D+%27SAMFORD%27&outFields=OBJECTID%2CFacilityID%2CAddressNumber%2CStreetName%2CFullStreet%2CFullAddress%2CMailingCity%2CState%2CZip%2CAddressAuthority%2CAddressClassification%2CAddressPointType%2CCreatedDate&returnGeometry=true&outSR=4326&f=json", "host": "gis.auburnalabama.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Independent City Address Authority point for the exact operator street" }, { "url": "https://gis.auburnalabama.org/public/rest/services/PublicService/Parcels/MapServer/0/query?geometry=-85.51275405445307%2C32.60119153688463&geometryType=esriGeometryPoint&inSR=4326&spatialRel=esriSpatialRelIntersects&outFields=OBJECTID%2CPARCEL%2CPIN%2CSTRNUM%2CSTRNAM%2CACRES_COUNTY%2CACRES&returnGeometry=true&outSR=4326&f=json", "host": "gis.auburnalabama.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete spatial intersection joins the City address authority to one parcel" }, { "url": "https://gis.auburnalabama.org/public/rest/services/PublicService/Parcels/MapServer/0/query?where=PIN+%3D+%2760478%27+AND+UPPER%28STRNAM%29+%3D+%271571+W+SAMFORD+AVE%27&outFields=OBJECTID%2CPARCEL%2CPIN%2CSTRNUM%2CSTRNAM%2CACRES_COUNTY%2CACRES&returnGeometry=true&outSR=4326&f=json", "host": "gis.auburnalabama.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete exact full situs and PIN parcel query" }, { "url": "https://gis.auburnalabama.org/public/rest/services/PublicService/Parcels/MapServer/0?f=pjson", "host": "gis.auburnalabama.org", "published": "", "date": "", "checked": "2026-10-23", "label": "City geometry and Lee County parcel attribute definitions" }, { "url": "https://api2.auburnalabama.org/ePacket/2726/file/7556", "host": "api2.auburnalabama.org", "published": "", "date": "", "checked": "2026-10-23", "label": "January 20, 2026 agenda separates data center 1571 and substation 1501" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1571+W+Samford+Ave%2C+Auburn%2C+AL+36832&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete literal Census street response and county context" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-85.51924474605134%2C32.59610928853755%2C-85.50751525394865%2C32.605990711462454&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting with unknown image acquisition date" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Approximate source parcel reference, not a roof or complete campus", "summary": "Auburn · Lee · Source context reviewed", "event_evidence": [ { "date": "2025-02-19", "text": "The February 19, 2025 publication date of the original company release announces entry into the existing Auburn AUBix facility and a planned launch. This is not the exact physical opening, completion of every expansion or an independently verified delivered capacity.", "kind": "announced", "sources": [ { "url": "https://investors.corescientific.com/news-events/press-releases/detail/107/core-scientific-announces-expansion-into-auburn-alabama-with-new-high-performance-computing-facility", "host": "investors.corescientific.com", "published": "2025-02-19", "date": "2025-02-19", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ] }, { "id": "core-scientific-austin-tx", "state": "tx", "kind": "facility", "name": "Core Scientific Austin Data Center (Austin 1)", "group": "operating", "status": "Operator-listed service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Travis" ], "city": "Austin", "address": "", "who": "Core Scientific", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Publishedpostalcode/citycombinationrequiresgeographicverification; retainverbatimandholdcanonicalcounty/coordinate. AdvertisedcapacitynotmeasuredIT. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://corescientific.com/high-density-data-centers/austin-tx/", "host": "corescientific.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" }, { "url": "https://data.texas.gov/resource/msah-s2rv.json?%24where=%28indus_type_cd_name+like+%27518210%25%27+OR+indus_type_cd_name+like+%27541513%25%27+OR+indus_typ_cd+in+%28%27518210%27%2C%27541513%27%29+OR+indus_typ_cd_1+in+%28%277374%27%2C%277376%27%29+OR+upper%28reg_ent_name%29+like+%27%25DATA%25CENTER%25%27+OR+upper%28reg_ent_name%29+like+%27%25DATA%25CENTRE%25%27+OR+upper%28reg_ent_desc_txt%29+like+%27%25DATA%25CENTER%25%27+OR+upper%28reg_ent_desc_txt%29+like+%27%25DATA%25CENTRE%25%27%29&%24order=ref_num_txt%2Cprogram_code%2Cadditional_id_text%2Cref_num_txt_1%2Caffil_begin_dt&%24limit=5000", "host": "data.texas.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Texas Commission on Environmental Quality source context" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 30.3347, "lng": -97.78184, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "advertised_total_power_capacity_mw": 20, "campus_acres": 38, "total_area_sqft": 312000, "published_address_verbatim": "3301 Hibbetts Rd, Austin, TX78275", "power_basis": "totalpowercapacity, not explicitlycriticalIT" }, "notes": [ "Publishedpostalcode/citycombinationrequiresgeographicverification; retainverbatimandholdcanonicalcounty/coordinate. AdvertisedcapacitynotmeasuredIT.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/austin-tx/", "host": "corescientific.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "overnight-discovery-2026-10-17", "scope": "Source-scoped official discovery and annual-filing comparison; research-context associations do not certify distinct physical sites or current whole-campus activity.", "fields": { "issuer_annual_utility_context": { "issuer": "Core Scientific", "reporting_period": "2025-12-31", "source_rows": [ { "location": "Austin, Texas", "utility": "Austin Energy", "gross_utility_capacity_mw": 20 } ], "scope": "Annual gross utility-capacity context only; not critical IT, current load, an opened phase or an unambiguous physical-site boundary. No typed MW fact or summed campus total added." } }, "notes": [ "No status, address, map point, jurisdiction, operating date or technical quantity is promoted in this review. Annual filings retain their reporting periods; a fresh retrieval is not a fresh physical-site certification." ], "sources": [ { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "texas-registry-2026-10-17", "scope": "Official Texas registry source context, with initial eligibility and component triage. Not a physical-site census or current-stage review.", "fields": { "texas_registry_air_context": { "regulated_entity": "RN105022842", "registry_name": [ "AUSTIN DATA CENTER 1" ], "program_contexts": [ { "program": "AIRNSR", "identifiers": [ "79943" ] } ], "association_scope": "3301 Hibbetts and SDC-Austin customer context match the current Core Scientific Austin 1 street address. Operator postal-code discrepancy remains; no point/address promotion.", "limits": "Registry authorizations, emissions reporting and historical customer affiliations can overlap. ACTIVE is a registry value, not proof of signed permit issuance, current operation, title or complete campus buildout. No generator MW, coordinates, street address or physical stage is promoted." } }, "notes": [ "AIRNSR and AIROP entries are registry contexts, not substitutes for signed permits. AIREI is emissions reporting, not a permit. Customer and status dates are not opening, completion or current ownership dates.", "The extract is a selected portion of Central Registry and the name/industry query is incomplete for all generator permits. Nonmatches are not evidence of absence." ], "sources": [ { "url": "https://data.texas.gov/resource/msah-s2rv.json?%24where=%28indus_type_cd_name+like+%27518210%25%27+OR+indus_type_cd_name+like+%27541513%25%27+OR+indus_typ_cd+in+%28%27518210%27%2C%27541513%27%29+OR+indus_typ_cd_1+in+%28%277374%27%2C%277376%27%29+OR+upper%28reg_ent_name%29+like+%27%25DATA%25CENTER%25%27+OR+upper%28reg_ent_name%29+like+%27%25DATA%25CENTRE%25%27+OR+upper%28reg_ent_desc_txt%29+like+%27%25DATA%25CENTER%25%27+OR+upper%28reg_ent_desc_txt%29+like+%27%25DATA%25CENTRE%25%27%29&%24order=ref_num_txt%2Cprogram_code%2Cadditional_id_text%2Cref_num_txt_1%2Caffil_begin_dt&%24limit=5000", "host": "data.texas.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Texas Commission on Environmental Quality source context" }, { "url": "https://corescientific.com/high-density-data-centers/austin-tx/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific source context" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 9", "scope": "The current Core Scientific facility page lists Austin 1 as a named high density colocation offering with campus features and customer contact. Operator listed service describes this current commercial listing, not independent commissioning, delivered AI workload, occupancy, every advertised capacity or a dated opening. Existing location and classification remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_service", "scope": "The current Core Scientific facility page lists Austin 1 as a named high density colocation offering with campus features and customer contact. Operator listed service describes this current commercial listing, not independent commissioning, delivered AI workload, occupancy, every advertised capacity or a dated opening. Existing location and classification remain unchanged." } }, "notes": [ "The current Core Scientific facility page lists Austin 1 as a named high density colocation offering with campus features and customer contact. Operator listed service describes this current commercial listing, not independent commissioning, delivered AI workload, occupancy, every advertised capacity or a dated opening. Existing location and classification remain unchanged.", "No campus total, service offer or approval is converted into an observed operating capacity, exact site point or verified opening day." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/austin-tx/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 31, October 23, 2026", "scope": "Core Scientific identifies the same named Austin 1 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown.", "fields": { "company_association": { "name": "Core Scientific", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Core Scientific identifies the same named Austin 1 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." }, "provider_role": "operator" }, "notes": [ "Core Scientific identifies the same named Austin 1 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/austin-tx/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Austin · Travis · Source context reviewed", "status_scope": "The current Core Scientific facility page lists Austin 1 as a named high density colocation offering with campus features and customer contact. Operator listed service describes this current commercial listing, not independent commissioning, delivered AI workload, occupancy, every advertised capacity or a dated opening. Existing location and classification remain unchanged.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "48453" } }, { "id": "core-scientific-calvert-city-ky", "kind": "facility", "name": "Core Scientific Calvert City Data Center (Calvert 1, 2 & 3)", "group": "operating", "status": "Operating", "crypto": true, "type": "crypto/HPC", "counties": [ "Marshall" ], "city": "Calvert City", "address": "1035 Shar-Cal Road, Calvert City", "who": "Core Scientific", "opened": "", "tier": "", "note": "Three buildings on about 15 acres, around 60,000 square feet, with 150 MW of total power capacity according to the operator.", "sources": [ { "url": "https://corescientific.com/high-density-data-centers/calvert-city-ky/", "host": "corescientific.com", "date": "" }, { "url": "https://www.areadevelopment.com/newsitems/11-14-2019/core-scientific-calvert-city-kentucky.shtml", "host": "areadevelopment.com", "date": "" }, { "url": "https://www.prnewswire.com/news-releases/core-scientific-opens-world-class-blockchain-hosting-facility-in-calvert-city-ky-300956631.html", "host": "prnewswire.com", "date": "" }, { "url": "https://www.datacentermap.com/usa/kentucky/calvert-city/core-scientific-calvert-city/", "host": "datacentermap.com", "date": "" }, { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": null, "state": "KY", "precision_label": "Site point withheld pending location review", "summary": "Marshall County · Core Scientific", "reviewed_evidence": [ { "overlay": "overnight-discovery-2026-10-17", "scope": "Source-scoped official discovery and annual-filing comparison; research-context associations do not certify distinct physical sites or current whole-campus activity.", "fields": { "issuer_annual_utility_context": { "issuer": "Core Scientific", "reporting_period": "2025-12-31", "source_rows": [ { "location": "Paducah-Calvert City, Kentucky", "utility": "Tennessee Valley Authority", "gross_utility_capacity_mw": 150 } ], "scope": "Annual gross utility-capacity context only; not critical IT, current load, an opened phase or an unambiguous physical-site boundary. No typed MW fact or summed campus total added." } }, "notes": [ "No status, address, map point, jurisdiction, operating date or technical quantity is promoted in this review. Annual filings retain their reporting periods; a fresh retrieval is not a fresh physical-site certification." ], "sources": [ { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Company role source check 31, October 23, 2026", "scope": "Core Scientific identifies the same named Calvert 1, 2, & 3 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown. The existing Kentucky who wrapper remains byte exact. Calvert 1, 2 and 3 are retained as one inherited research context; the separate future HPC conversion is not merged or admitted.", "fields": { "company_association": { "name": "Core Scientific", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Core Scientific identifies the same named Calvert 1, 2, & 3 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown. The existing Kentucky who wrapper remains byte exact. Calvert 1, 2 and 3 are retained as one inherited research context; the separate future HPC conversion is not merged or admitted." }, "provider_role": "operator" }, "notes": [ "Core Scientific identifies the same named Calvert 1, 2, & 3 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown. The existing Kentucky who wrapper remains byte exact. Calvert 1, 2 and 3 are retained as one inherited research context; the separate future HPC conversion is not merged or admitted." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/calvert-city-ky/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_aerial_location_hold", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "reason": "The calculated rural street reference does not clearly establish the campus location in reviewed aerial context. Retain the published address; withhold the point pending independent site-location evidence. This is not an absence or operating-status finding." } }, { "id": "core-scientific-calvert-hpc-conversion", "kind": "project", "name": "Core Scientific Calvert City future colocation capacity", "group": "proposed", "status": "Proposed", "raw_status": "proposed", "crypto": false, "type": "existing-site conversion / capacity marketing", "counties": [ "Marshall" ], "city": "Calvert City", "who": "Core Scientific", "end_user": "", "mw": 100, "power": "approximately 100 MW", "power_note": "operator leasable colocation power, not contracted/operating IT", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "", "date": "2026-05-06", "events": [], "timeline": [], "sources": [ { "url": "https://investors.corescientific.com/sec-filings/all-sec-filings/content/0001628280-26-031246/q1fy26earningsdeck.htm", "host": "investors.corescientific.com", "date": "2026-05-06" } ], "loc": { "lat": 36.8833, "lng": -88.32918, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "state": "KY", "precision_label": "Exact site not published; shown at county level", "summary": "Marshall County · 100 MW · Core Scientific", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "county_context_only", "county_display": "21157" } }, { "id": "core-scientific-denton-tx", "state": "tx", "kind": "facility", "name": "Core Scientific Denton Data Center (Denton 1)", "group": "operating", "status": "Operator-listed service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Denton" ], "city": "Denton", "address": "", "who": "Core Scientific", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. FuturelargeAIcomputerexpectationnotproofall394MWconvertedfromminingoroperatingAI. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://corescientific.com/high-density-data-centers/denton-texas/", "host": "corescientific.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://comptroller.texas.gov/taxes/data-centers/data-center-lists.php", "host": "comptroller.texas.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Current qualifying data-center and large-project registered lists" }, { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" }, { "url": "https://data.texas.gov/resource/t34q-qzi3.json?%24where=%28indus_type_cd_name+like+%27518210%25%27+OR+indus_type_cd_name+like+%27541513%25%27+OR+indus_typ_cd+in+%28%27518210%27%2C%27541513%27%29+OR+indus_typ_cd_1+in+%28%277374%27%2C%277376%27%29+OR+upper%28reg_ent_name%29+like+%27%25DATA%25CENTER%25%27+OR+upper%28reg_ent_name%29+like+%27%25DATA%25CENTRE%25%27+OR+upper%28reg_ent_desc_txt%29+like+%27%25DATA%25CENTER%25%27+OR+upper%28reg_ent_desc_txt%29+like+%27%25DATA%25CENTRE%25%27%29&%24order=ref_num_txt%2Cprogram_code%2Cadditional_id_text%2Cref_num_txt_1%2Caffil_begin_dt&%24limit=5000", "host": "data.texas.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Texas Commission on Environmental Quality source context" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 33.20558, "lng": -97.11677, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "published_address": "8171 Jim Christal Rd, Denton, TX76207", "advertised_total_power_capacity_mw": 394, "campus_acres": 78, "total_area_sqft": 423831, "power_basis": "totalpowercapacity, not explicitlycriticalIT" }, "notes": [ "FuturelargeAIcomputerexpectationnotproofall394MWconvertedfromminingoroperatingAI.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/denton-texas/", "host": "corescientific.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "overnight-discovery-2026-10-17", "scope": "Source-scoped official discovery and annual-filing comparison; research-context associations do not certify distinct physical sites or current whole-campus activity.", "fields": { "texas_current_program_contexts": { "checked": "2026-10-17", "reference_rows": [ { "association_scope": "The program row names Denton and Core Scientific/CoreWeave. The issuer table identifies Dallas-Denton; the current Core Scientific Denton 1 page explicitly places Denton in the north Dallas market. This is a source-context bridge, not a phase, address, title or full-campus equivalence.", "registered_name": "Denton Data Center", "program": "Qualifying large data center project", "registration_number": "LD394824-OC2" } ], "scope": "Current source cells reconciled to earlier explicit associations, plus separately reviewed new bridges. Earlier operator reviews retain their own dates. No current tax savings, physical completion or coordinates inferred." }, "issuer_annual_utility_context": { "issuer": "Core Scientific", "reporting_period": "2025-12-31", "source_rows": [ { "location": "Dallas-Denton, Texas", "utility": "Denton Municipal Electric", "gross_utility_capacity_mw": 394 } ], "scope": "Annual gross utility-capacity context only; not critical IT, current load, an opened phase or an unambiguous physical-site boundary. No typed MW fact or summed campus total added." } }, "notes": [ "No status, address, map point, jurisdiction, operating date or technical quantity is promoted in this review. Annual filings retain their reporting periods; a fresh retrieval is not a fresh physical-site certification." ], "sources": [ { "url": "https://comptroller.texas.gov/taxes/data-centers/data-center-lists.php", "host": "comptroller.texas.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Current qualifying data-center and large-project registered lists" }, { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" }, { "url": "https://corescientific.com/high-density-data-centers/denton-texas/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "texas-registry-2026-10-17", "scope": "Official Texas registry source context, with initial eligibility and component triage. Not a physical-site census or current-stage review.", "fields": { "texas_registry_air_context": { "regulated_entity": "RN111355798", "registry_name": [ "CORE SCIENTIFIC DATA CENTER SITE 1 AND 2 DENTON TEXAS" ], "program_contexts": [ { "program": "AIRNSR", "identifiers": [ "178949", "179143" ] } ], "association_scope": "Core Scientific named Denton Site 1 and 2 with AI address 8171 Jim Christal agrees with the current Denton 1 operator page. Grouped source scope does not establish two distinct sites.", "limits": "Registry authorizations, emissions reporting and historical customer affiliations can overlap. ACTIVE is a registry value, not proof of signed permit issuance, current operation, title or complete campus buildout. No generator MW, coordinates, street address or physical stage is promoted." } }, "notes": [ "AIRNSR and AIROP entries are registry contexts, not substitutes for signed permits. AIREI is emissions reporting, not a permit. Customer and status dates are not opening, completion or current ownership dates.", "The extract is a selected portion of Central Registry and the name/industry query is incomplete for all generator permits. Nonmatches are not evidence of absence." ], "sources": [ { "url": "https://data.texas.gov/resource/t34q-qzi3.json?%24where=%28indus_type_cd_name+like+%27518210%25%27+OR+indus_type_cd_name+like+%27541513%25%27+OR+indus_typ_cd+in+%28%27518210%27%2C%27541513%27%29+OR+indus_typ_cd_1+in+%28%277374%27%2C%277376%27%29+OR+upper%28reg_ent_name%29+like+%27%25DATA%25CENTER%25%27+OR+upper%28reg_ent_name%29+like+%27%25DATA%25CENTRE%25%27+OR+upper%28reg_ent_desc_txt%29+like+%27%25DATA%25CENTER%25%27+OR+upper%28reg_ent_desc_txt%29+like+%27%25DATA%25CENTRE%25%27%29&%24order=ref_num_txt%2Cprogram_code%2Cadditional_id_text%2Cref_num_txt_1%2Caffil_begin_dt&%24limit=5000", "host": "data.texas.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Texas Commission on Environmental Quality source context" }, { "url": "https://corescientific.com/high-density-data-centers/denton-texas/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific source context" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 9", "scope": "The current Core Scientific facility page lists Denton 1 as a named high density colocation offering with campus features and customer contact. Operator listed service describes this current commercial listing, not independent commissioning, delivered AI workload, occupancy, every advertised capacity or a dated opening. Existing location and classification remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_service", "scope": "The current Core Scientific facility page lists Denton 1 as a named high density colocation offering with campus features and customer contact. Operator listed service describes this current commercial listing, not independent commissioning, delivered AI workload, occupancy, every advertised capacity or a dated opening. Existing location and classification remain unchanged." } }, "notes": [ "The current Core Scientific facility page lists Denton 1 as a named high density colocation offering with campus features and customer contact. Operator listed service describes this current commercial listing, not independent commissioning, delivered AI workload, occupancy, every advertised capacity or a dated opening. Existing location and classification remain unchanged.", "No campus total, service offer or approval is converted into an observed operating capacity, exact site point or verified opening day." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/denton-texas/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 31, October 23, 2026", "scope": "Core Scientific identifies the same named Denton 1 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown.", "fields": { "company_association": { "name": "Core Scientific", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Core Scientific identifies the same named Denton 1 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." }, "provider_role": "operator" }, "notes": [ "Core Scientific identifies the same named Denton 1 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/denton-texas/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Denton · Denton · Source context reviewed", "status_scope": "The current Core Scientific facility page lists Denton 1 as a named high density colocation offering with campus features and customer contact. Operator listed service describes this current commercial listing, not independent commissioning, delivered AI workload, occupancy, every advertised capacity or a dated opening. Existing location and classification remain unchanged.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "48121" } }, { "id": "core-scientific-grand-forks-nd", "state": "nd", "kind": "facility", "name": "Core Scientific Grand Forks Data Center (Grand Forks 1)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Grand Forks" ], "city": "Grand Forks", "address": "", "who": "Core Scientific", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Operatorofferingnotindependentlyverifiedcurrentenergizedload/AIoccupancy. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://corescientific.com/high-density-data-centers/grand-forks-nd/", "host": "corescientific.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://investors.corescientific.com/sec-filings/all-sec-filings/content/0001628280-26-013305/core-20251231.htm", "host": "investors.corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 47.92187, "lng": -97.45703, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "published_address": "5601 11th Ave S, Grand Forks, ND58201", "advertised_total_power_capacity_mw": 100, "campus_acres": 20, "total_area_sqft": 90000, "power_basis": "totalpowercapacity, not explicitlycriticalIT" }, "notes": [ "Operatorofferingnotindependentlyverifiedcurrentenergizedload/AIoccupancy.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/grand-forks-nd/", "host": "corescientific.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "overnight-discovery-2026-10-17", "scope": "Source-scoped official discovery and annual-filing comparison; research-context associations do not certify distinct physical sites or current whole-campus activity.", "fields": { "issuer_annual_utility_context": { "issuer": "Core Scientific", "reporting_period": "2025-12-31", "source_rows": [ { "location": "Grand Forks, North Dakota", "utility": "Nodak Electric Cooperative, Inc.", "gross_utility_capacity_mw": 100 } ], "scope": "Annual gross utility-capacity context only; not critical IT, current load, an opened phase or an unambiguous physical-site boundary. No typed MW fact or summed campus total added." } }, "notes": [ "No status, address, map point, jurisdiction, operating date or technical quantity is promoted in this review. Annual filings retain their reporting periods; a fresh retrieval is not a fresh physical-site certification." ], "sources": [ { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Company role source check 31, October 23, 2026", "scope": "Core Scientific identifies the same named Grand Forks 1 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown.", "fields": { "company_association": { "name": "Core Scientific", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Core Scientific identifies the same named Grand Forks 1 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." }, "provider_role": "operator" }, "notes": [ "Core Scientific identifies the same named Grand Forks 1 data center on its current first party location page and lists the facility in its own location portfolio. Operator per source records the advertised provider brand relationship; service marketing does not independently certify current computing, commissioning, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/grand-forks-nd/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 71", "scope": "The complete original current provider facility and roster bodies identify Grand Forks 1 and describe advertised infrastructure and nationwide colocation offerings. The selected original annual filing table lists utility power by location as of December 31, 2025. A power capacity table and aggregate AI factories under development do not independently establish this exact site current commissioned high density service, completed conversion or computing load. The precise present physical scope remains held; an old mining or current general product description is not transferred to every component.", "fields": { "current_stage_evidence": { "outcome": "named_grandforks_infrastructure_current_commissioned_scope_held", "scope": "The complete original current provider facility and roster bodies identify Grand Forks 1 and describe advertised infrastructure and nationwide colocation offerings. The selected original annual filing table lists utility power by location as of December 31, 2025. A power capacity table and aggregate AI factories under development do not independently establish this exact site current commissioned high density service, completed conversion or computing load. The precise present physical scope remains held; an old mining or current general product description is not transferred to every component." }, "source_read_scope": { "complete_original_current_facility_and_roster_bodies_read": true, "original_annual_filing_selected_utility_power_table_and_surrounding_process_text_read": true, "complete_annual_filing_not_claimed": true, "utility_capacity_not_commissioned_computing": true, "no_capacity_or_ai_conversion_certification": true } }, "notes": [ "The complete original current provider facility and roster bodies identify Grand Forks 1 and describe advertised infrastructure and nationwide colocation offerings. The selected original annual filing table lists utility power by location as of December 31, 2025. A power capacity table and aggregate AI factories under development do not independently establish this exact site current commissioned high density service, completed conversion or computing load. The precise present physical scope remains held; an old mining or current general product description is not transferred to every component.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/grand-forks-nd/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Reviewed operator source" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Reviewed operator source" }, { "url": "https://investors.corescientific.com/sec-filings/all-sec-filings/content/0001628280-26-013305/core-20251231.htm", "host": "investors.corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Grand Forks · Grand Forks · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "38035" } }, { "id": "core-scientific-marble-cherokee-county-nc", "state": "nc", "kind": "facility", "name": "Core Scientific Marble Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Cherokee" ], "city": "Marble", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. WUNCApr10,2026originalreport/photosApr7namesCoreScientificMarbleAIconversiondistinctfromMurphyHarshawcrypto. FailedCoreSci/CoreWeavecorporatemergernotproofHPCleasecanceled.170+dieselgeneratorcountnotMW;250000feetversussevenacnotreconciledarea.268000USD2024taxreceiptreportednotannual2026forecast;oldfactory2015closingnotDCclosure. Andrewssewerhookupdenialmayorquote notwholecampuspermitdenial;proposedsepticnotapproved. Threewells/12hlimitstatementnotactualgallonsorindependentlyverifiedregulation. Januaryrenewaldiscussionresultednoaction,notAIban. PrimeBlocknameabsentcurrentarticle;HarshawregionalcontextonlyforselectedPrimeBlock. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wunc.org/2026-04-10/cherokee-county-residents-were-upset-about-crypto-mines-then-came-ai", "host": "wunc.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" } ], "loc": { "lat": 35.13372, "lng": -84.06375, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "WUNCApr10,2026originalreport/photosApr7namesCoreScientificMarbleAIconversiondistinctfromMurphyHarshawcrypto. FailedCoreSci/CoreWeavecorporatemergernotproofHPCleasecanceled.170+dieselgeneratorcountnotMW;250000feetversussevenacnotreconciledarea.268000USD2024taxreceiptreportednotannual2026forecast;oldfactory2015closingnotDCclosure. Andrewssewerhookupdenialmayorquote notwholecampuspermitdenial;proposedsepticnotapproved. Threewells/12hlimitstatementnotactualgallonsorindependentlyverifiedregulation. Januaryrenewaldiscussionresultednoaction,notAIban. PrimeBlocknameabsentcurrentarticle;HarshawregionalcontextonlyforselectedPrimeBlock." }, "notes": [ "WUNCApr10,2026originalreport/photosApr7namesCoreScientificMarbleAIconversiondistinctfromMurphyHarshawcrypto. FailedCoreSci/CoreWeavecorporatemergernotproofHPCleasecanceled.170+dieselgeneratorcountnotMW;250000feetversussevenacnotreconciledarea.268000USD2024taxreceiptreportednotannual2026forecast;oldfactory2015closingnotDCclosure. Andrewssewerhookupdenialmayorquote notwholecampuspermitdenial;proposedsepticnotapproved. Threewells/12hlimitstatementnotactualgallonsorindependentlyverifiedregulation. Januaryrenewaldiscussionresultednoaction,notAIban. PrimeBlocknameabsentcurrentarticle;HarshawregionalcontextonlyforselectedPrimeBlock.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.wunc.org/2026-04-10/cherokee-county-residents-were-upset-about-crypto-mines-then-came-ai", "host": "wunc.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "overnight-discovery-2026-10-17", "scope": "Source-scoped official discovery and annual-filing comparison; research-context associations do not certify distinct physical sites or current whole-campus activity.", "fields": { "issuer_annual_utility_context": { "issuer": "Core Scientific", "reporting_period": "2025-12-31", "source_rows": [ { "location": "Marble, North Carolina", "utility": "Murphy Electric Power Board", "gross_utility_capacity_mw": 35 }, { "location": "Marble, North Carolina", "utility": "Duke Energy", "gross_utility_capacity_mw": 82 } ], "scope": "Annual gross utility-capacity context only; not critical IT, current load, an opened phase or an unambiguous physical-site boundary. No typed MW fact or summed campus total added." } }, "notes": [ "No status, address, map point, jurisdiction, operating date or technical quantity is promoted in this review. Annual filings retain their reporting periods; a fresh retrieval is not a fresh physical-site certification." ], "sources": [ { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" } ], "checked": "2026-10-17", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Marble · Cherokee · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37039" } }, { "id": "core-scientific-muskogee-ok", "state": "ok", "kind": "facility", "name": "Core Scientific Muskogee Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Muskogee" ], "city": "Muskogee", "address": "", "who": "Core Scientific", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. 100MWongoingdevelopmentnotenergizedclaim.500+MWsubstationpotentialnotdatacenterITandnotadditiveto100. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://corescientific.com/high-density-data-centers/muskogee-ok/", "host": "corescientific.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 35.61643, "lng": -95.37978, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "published_address": "1525 W43rd Street South, Muskogee, OK74401", "ongoing_development_capacity_mw": 100, "substation_potential_mw_min_exclusive": 500, "campus_acres": 65, "total_area_sqft": 138000, "power_basis": "developmentpower versus substationpotential" }, "notes": [ "100MWongoingdevelopmentnotenergizedclaim.500+MWsubstationpotentialnotdatacenterITandnotadditiveto100.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/muskogee-ok/", "host": "corescientific.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "overnight-discovery-2026-10-17", "scope": "Source-scoped official discovery and annual-filing comparison; research-context associations do not certify distinct physical sites or current whole-campus activity.", "fields": { "issuer_annual_utility_context": { "issuer": "Core Scientific", "reporting_period": "2025-12-31", "source_rows": [ { "location": "Muskogee, Oklahoma", "utility": "Oklahoma Gas & Electric", "gross_utility_capacity_mw": 100 } ], "scope": "Annual gross utility-capacity context only; not critical IT, current load, an opened phase or an unambiguous physical-site boundary. No typed MW fact or summed campus total added." } }, "notes": [ "No status, address, map point, jurisdiction, operating date or technical quantity is promoted in this review. Annual filings retain their reporting periods; a fresh retrieval is not a fresh physical-site certification." ], "sources": [ { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Company role source check 31, October 23, 2026", "scope": "Core Scientific identifies the same named Muskogee 1 data center on its current first party location page and lists the facility in its own location portfolio. Its Muskogee page explicitly describes ongoing development. Developer per source records that provider relationship; it does not establish completion or computing operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown.", "fields": { "company_association": { "name": "Core Scientific", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Core Scientific identifies the same named Muskogee 1 data center on its current first party location page and lists the facility in its own location portfolio. Its Muskogee page explicitly describes ongoing development. Developer per source records that provider relationship; it does not establish completion or computing operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." }, "provider_role": "developer" }, "notes": [ "Core Scientific identifies the same named Muskogee 1 data center on its current first party location page and lists the facility in its own location portfolio. Its Muskogee page explicitly describes ongoing development. Developer per source records that provider relationship; it does not establish completion or computing operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/muskogee-ok/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://corescientific.com/high-density-data-centers/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 76", "scope": "The complete original named facility page describes ongoing computing development and expected future hosting delivery. Design features, power and expected delivery do not independently establish commissioned AI hosting. Existing mining and a later AI development component are not silently treated as the same completed computing phase. The bounded current page does not establish the complete present physical computing disposition of the inherited campus, which remains held.", "fields": { "current_stage_evidence": { "outcome": "named_muskogee_development_phase_service_held", "scope": "The complete original named facility page describes ongoing computing development and expected future hosting delivery. Design features, power and expected delivery do not independently establish commissioned AI hosting. Existing mining and a later AI development component are not silently treated as the same completed computing phase. The bounded current page does not establish the complete present physical computing disposition of the inherited campus, which remains held." }, "source_read_scope": { "complete_original_named_muskogee_page_body_read": true, "expected_hosting_and_design_not_commissioned_ai": true, "legacy_mining_and_ai_component_not_merged": true, "no_capacity_role_or_component_changes": true } }, "notes": [ "The complete original named facility page describes ongoing computing development and expected future hosting delivery. Design features, power and expected delivery do not independently establish commissioned AI hosting. Existing mining and a later AI development component are not silently treated as the same completed computing phase. The bounded current page does not establish the complete present physical computing disposition of the inherited campus, which remains held.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://corescientific.com/high-density-data-centers/muskogee-ok/", "host": "corescientific.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Muskogee · Muskogee · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "40101" } }, { "id": "core-scientific-pecos-tx", "state": "tx", "kind": "facility", "name": "Core Scientific Pecos AI Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Reeves" ], "city": "Pecos", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Core Scientific two-site gross power increment, no Pecos split. NoPecos-onlysplitinreviewedpassage. HuntCounty430MWseparateproject.350energizedand590MWearly2027deliveryCoreWeaveportfoliofiguresnotPecos-only. Corporatefinancials/1.5GWpipelinecannotbecountedagainasindividualcampusload. NooriginalPecosopeningorexactparceladopted. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-03-02", "Core Scientific published results including a proposed combined power expansion across Dalton and Pecos. March 2 is the publication date. Fleet energized power and a combined expansion figure are not a Pecos opening or an individual site capacity." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://investors.corescientific.com/news-events/press-releases/detail/127/core-scientific-announces-fourth-quarter-fiscal-year-2025-results", "host": "investors.corescientific.com", "date": "2026-03-02", "published": "2026-03-02", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" } ], "loc": { "lat": 31.32298, "lng": -103.69316, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "Core Scientific two-site gross power increment, no Pecos split", "fields": { "issuer": "Core Scientific", "release_date": "2026-03-02", "combined_dalton_pecos_gross_power_increase_mw_approx": 300, "power_basis": "combined gross power increase across Georgia and Texas sites", "pecos_specific_increment_mw": null }, "notes": [ "NoPecos-onlysplitinreviewedpassage. HuntCounty430MWseparateproject.350energizedand590MWearly2027deliveryCoreWeaveportfoliofiguresnotPecos-only. Corporatefinancials/1.5GWpipelinecannotbecountedagainasindividualcampusload. NooriginalPecosopeningorexactparceladopted.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://investors.corescientific.com/news-events/press-releases/detail/127/core-scientific-announces-fourth-quarter-fiscal-year-2025-results", "host": "investors.corescientific.com", "date": "2026-03-02", "published": "2026-03-02", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "overnight-discovery-2026-10-17", "scope": "Source-scoped official discovery and annual-filing comparison; research-context associations do not certify distinct physical sites or current whole-campus activity.", "fields": { "issuer_annual_utility_context": { "issuer": "Core Scientific", "reporting_period": "2025-12-31", "source_rows": [ { "location": "Pecos, Texas", "utility": "Texas New-Mexico Power", "gross_utility_capacity_mw": 300 } ], "scope": "Annual gross utility-capacity context only; not critical IT, current load, an opened phase or an unambiguous physical-site boundary. No typed MW fact or summed campus total added." } }, "notes": [ "No status, address, map point, jurisdiction, operating date or technical quantity is promoted in this review. Annual filings retain their reporting periods; a fresh retrieval is not a fresh physical-site certification." ], "sources": [ { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 9", "scope": "Core Scientific March 2, 2026 results announced a combined gross power expansion across Dalton and Pecos. The combined figure and fleet energized capacity do not establish Pecos specific delivered IT capacity or completion of its proposed expansion. Current physical stage for the inherited Pecos record remains unresolved.", "fields": { "current_stage_evidence": { "outcome": "multi_site_expansion_current_site_stage_held", "scope": "Core Scientific March 2, 2026 results announced a combined gross power expansion across Dalton and Pecos. The combined figure and fleet energized capacity do not establish Pecos specific delivered IT capacity or completion of its proposed expansion. Current physical stage for the inherited Pecos record remains unresolved." } }, "notes": [ "Core Scientific March 2, 2026 results announced a combined gross power expansion across Dalton and Pecos. The combined figure and fleet energized capacity do not establish Pecos specific delivered IT capacity or completion of its proposed expansion. Current physical stage for the inherited Pecos record remains unresolved.", "No campus total, service offer or approval is converted into an observed operating capacity, exact site point or verified opening day." ], "sources": [ { "url": "https://investors.corescientific.com/news-events/press-releases/detail/127/core-scientific-announces-fourth-quarter-fiscal-year-2025-results", "host": "investors.corescientific.com", "published": "2026-03-02", "date": "2026-03-02", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "checked": "2026-10-22", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Pecos · Reeves · Source context reviewed", "event_evidence": [ { "date": "2026-03-02", "text": "Core Scientific published results including a proposed combined power expansion across Dalton and Pecos. March 2 is the publication date. Fleet energized power and a combined expansion figure are not a Pecos opening or an individual site capacity.", "kind": "announced", "sources": [ { "url": "https://investors.corescientific.com/news-events/press-releases/detail/127/core-scientific-announces-fourth-quarter-fiscal-year-2025-results", "host": "investors.corescientific.com", "published": "2026-03-02", "date": "2026-03-02", "checked": "2026-10-22", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "48389" } } ], "compilation_license": "withheld_pending_owner_decision" }