{
  "schema_version": 1,
  "source_compilation_context": {
    "az": {
      "attribution": {
        "inventory": {
          "name": "Compute Atlas",
          "creator": "Edward Kubiak",
          "url": "https://www.compute-atlas.com/api",
          "license": "CC BY 4.0",
          "license_url": "https://creativecommons.org/licenses/by/4.0/",
          "snapshot_url": "https://www.compute-atlas.com/api/facilities",
          "retrieved": "2026-10-14",
          "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37",
          "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally."
        },
        "counties": "U.S. Census Bureau county boundaries (public domain)",
        "research": "Field-specific source context. See the linked source and limits on each record."
      },
      "source_data_url": "https://datacentersatlas.com/data/az.json",
      "updated": "2026-10-24"
    }
  },
  "scope": "Retained county context, which can be broad or unresolved. No parcel or municipal jurisdiction is inferred. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.",
  "collection": {
    "kind": "counties",
    "key": "04013",
    "label": "Maricopa County, Arizona"
  },
  "records": [
    {
      "id": "5c-data-centers-phx01-phoenix-az",
      "state": "az",
      "kind": "facility",
      "name": "5C Data Centers PHX01",
      "group": "proposed",
      "status": "City-listed planned development",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Phoenix",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. GPEC historical Phoenix development announcement. Historical planned2025service is not observed opening. Power density is cabinet design capability, not measured average or campus load. No street/parcel in reviewed release. Regional EDO reporting developer announcement, not independent engineering certification. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2026-07-01",
          "Phoenix City Council adopted the 5C special permit waiver item as revised by the July 1 Law Department memo. This is a scoped land use waiver action, not all permits, a construction start or an opening."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.gpec.org/news/5c-data-centers-new-data-center-region-in-phoenix/",
          "host": "gpec.org",
          "date": "2024-09-19",
          "published": "2024-09-19",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://webapi.legistar.com/v1/phoenix/matters/35495/texts/35595",
          "host": "webapi.legistar.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Reviewed government record"
        },
        {
          "url": "https://webapi.legistar.com/v1/phoenix/matters/35495/histories",
          "host": "webapi.legistar.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Reviewed government record"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2802+W.+Palm+Lane%2C+Phoenix%2C+AZ&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Complete literal Census street response and county context"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-112.12531984835196%2C33.46468728853755%2C-112.11347415164805%2C33.47456871146245&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Actually viewed setting with unknown image acquisition date"
        }
      ],
      "loc": {
        "lng": -112.119397,
        "lat": 33.469628,
        "precision": "address",
        "basis": "The original City of Phoenix matter 35495 identifies the proposed 5C data center property street at 2802 W. Palm Lane, Phoenix, Arizona. One complete literal Census street range supplies only a calculated reference in Maricopa County. It selects no individual building or complete two parcel boundary. Existing status group proposed remains unchanged. Imagery acquisition date is unknown and may predate construction."
      },
      "reviewed_evidence": [
        {
          "overlay": "primary-source-review-round9-2026-10-14.json",
          "scope": "GPEC historical Phoenix development announcement",
          "fields": {
            "release_dateline": "2024-09-18",
            "page_published_date": "2024-09-19",
            "page_updated_date": "2025-03-31",
            "site_code": "PHX01",
            "planned_critical_it_mw": 20,
            "planned_area_sqft": 140000,
            "maximum_supported_power_density_kw_per_cabinet": 132,
            "historical_target_service_year": 2025
          },
          "notes": [
            "Historical planned2025service is not observed opening. Power density is cabinet design capability, not measured average or campus load. No street/parcel in reviewed release. Regional EDO reporting developer announcement, not independent engineering certification.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.gpec.org/news/5c-data-centers-new-data-center-region-in-phoenix/",
              "host": "gpec.org",
              "date": "2024-09-19",
              "published": "2024-09-19",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 4",
          "scope": "Phoenix identifies the 5C proposal at 2802 West Palm Lane and records July 1, 2026 council adoption of a binding waiver item as revised. This establishes a city listed planned development and a scoped land use action. It does not establish construction, an opening, issued building permits or all final waiver terms. The current 5C regional capacity table is not assigned to this individual facility.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "city_listed_planned_development",
              "scope": "Phoenix identifies the 5C proposal at 2802 West Palm Lane and records July 1, 2026 council adoption of a binding waiver item as revised. This establishes a city listed planned development and a scoped land use action. It does not establish construction, an opening, issued building permits or all final waiver terms. The current 5C regional capacity table is not assigned to this individual facility."
            },
            "local_rule_context": {
              "matter": "26-1460",
              "adopted_action_on": "2026-07-01",
              "instrument_scope": "Waiver of special permit enforcement, adopted as revised",
              "final_revised_terms_reviewed": false,
              "all_permits_or_operation_established": false
            }
          },
          "notes": [
            "Phoenix identifies the 5C proposal at 2802 West Palm Lane and records July 1, 2026 council adoption of a binding waiver item as revised. This establishes a city listed planned development and a scoped land use action. It does not establish construction, an opening, issued building permits or all final waiver terms. The current 5C regional capacity table is not assigned to this individual facility."
          ],
          "sources": [
            {
              "url": "https://webapi.legistar.com/v1/phoenix/matters/35495/texts/35595",
              "host": "webapi.legistar.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            },
            {
              "url": "https://webapi.legistar.com/v1/phoenix/matters/35495/histories",
              "host": "webapi.legistar.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 55, October 23, 2026",
          "scope": "Explicit source bound reference only. Existing status group proposed remains unchanged. No new computing operation, operator role, title, owner, tenant, physical milestone, quantity, certification, roof or complete campus is certified.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -112.119397,
                "lat": 33.469628,
                "precision": "address",
                "basis": "The original City of Phoenix matter 35495 identifies the proposed 5C data center property street at 2802 W. Palm Lane, Phoenix, Arizona. One complete literal Census street range supplies only a calculated reference in Maricopa County. It selects no individual building or complete two parcel boundary. Existing status group proposed remains unchanged. Imagery acquisition date is unknown and may predate construction."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "2802 W. Palm Lane, Phoenix, AZ",
              "county_fips": [
                "04013"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The original City matter text explicitly names 5C, its proposed data center and property at 2802 W. Palm Lane, with APNs 108 15 002D and 108 15 002B. The operator regional page does not independently publish this street. City Manager and staff recommendations on the requested waiver do not certify an issued permit, approved computing, legal owner or actual current operation. The June 16, 2026 text modification timestamp is metadata, without an invented publication or vote day. Other providers with a PHX01 code are excluded.",
            "Explicit source bound reference only. Existing status group proposed remains unchanged. No new computing operation, operator role, title, owner, tenant, physical milestone, quantity, certification, roof or complete campus is certified.",
            "Large industrial or commercial roof forms and yards lie beside dense residential blocks. The City filed property street supplies a calculated range reference only, without selecting a particular roof, full two parcel boundary or currently operating computing building.",
            "The inherited general area coordinate and county display were not reviewed physical facility destinations. The exact independent official sources now support only the bounded reference described in the basis. Earlier coordinates and complete source history remain intact. This is a reference correction, without a claim of physical relocation or a new physical milestone."
          ],
          "sources": [
            {
              "url": "https://webapi.legistar.com/v1/phoenix/matters/35495/texts/35595",
              "host": "webapi.legistar.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Named computing facility or project street in original source body"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2802+W.+Palm+Lane%2C+Phoenix%2C+AZ&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Complete literal Census street response and county context"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-112.12531984835196%2C33.46468728853755%2C-112.11347415164805%2C33.47456871146245&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Actually viewed setting with unknown image acquisition date"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Calculated official source street reference, not a surveyed roof or parcel",
      "summary": "Phoenix · Maricopa · Source context reviewed",
      "status_scope": "Phoenix identifies the 5C proposal at 2802 West Palm Lane and records July 1, 2026 council adoption of a binding waiver item as revised. This establishes a city listed planned development and a scoped land use action. It does not establish construction, an opening, issued building permits or all final waiver terms. The current 5C regional capacity table is not assigned to this individual facility.",
      "event_evidence": [
        {
          "date": "2026-07-01",
          "text": "Phoenix City Council adopted the 5C special permit waiver item as revised by the July 1 Law Department memo. This is a scoped land use waiver action, not all permits, a construction start or an opening.",
          "kind": "approved",
          "sources": [
            {
              "url": "https://webapi.legistar.com/v1/phoenix/matters/35495/texts/35595",
              "host": "webapi.legistar.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            },
            {
              "url": "https://webapi.legistar.com/v1/phoenix/matters/35495/histories",
              "host": "webapi.legistar.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            }
          ]
        }
      ]
    },
    {
      "id": "aligned-peoria-campus-az",
      "state": "az",
      "kind": "facility",
      "name": "Aligned Data Centers Peoria Campus",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Peoria",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Aligned Peoria planning report. Syndicated PhoenixBusinessJournal report not adopted city permit. Existing district permits data-center uses, but no specific final site approval/commissioning proven. No explicit critical IT MW, full capex or current construction adopted. Publication day absent from retained body; not inferred from other outlets. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.abc15.com/news/business/aligned-data-centers-moves-ahead-with-two-building-campus-in-peoria",
          "host": "abc15.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.34908,
        "lng": -112.49142,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round13-2026-10-14.json",
          "scope": "Aligned Peoria planning report",
          "fields": {
            "project": "Aligned Peoria campus",
            "location": "75th Avenue and ButlerDrive, Peoria, Arizona",
            "reported_site_acres": 95,
            "reported_proposed_buildings": 2,
            "reported_combined_area_sqft_approx": 916000,
            "reported_stage": "planning documents filed"
          },
          "notes": [
            "Syndicated PhoenixBusinessJournal report not adopted city permit. Existing district permits data-center uses, but no specific final site approval/commissioning proven. No explicit critical IT MW, full capex or current construction adopted. Publication day absent from retained body; not inferred from other outlets.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.abc15.com/news/business/aligned-data-centers-moves-ahead-with-two-building-campus-in-peoria",
              "host": "abc15.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Peoria · Maricopa · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "aligned-phx-01-02-03-az",
      "state": "az",
      "kind": "facility",
      "name": "Aligned PHX-01/02/03",
      "group": "operating",
      "status": "Operator-listed service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Phoenix",
      "address": "",
      "who": "Aligned Data Centers",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Generator/UPS component ratings are not facility-wide MW. Shared address with PHX05 requires campus/building deduplication. Operator groups PHX01/02/03 at one address and lists PHX05 at the same address. Establish campus relationship before counting. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. named operator source. Microgridgeneration63MWnotdata-centerIT. Voltage69kVisnotcapacity.2016nearlycomplete/soonstatementsnotcurrentstatus.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://aligneddc.com/phoenix/",
          "host": "aligneddc.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://aligneddc.com/power-reliability-is-a-big-driver-for-aligned-data-centers-in-phoenix/",
          "host": "aligneddc.com",
          "date": "2016-03-16",
          "published": "2016-03-16",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://aligneddc.com/phoenix-data-centers/",
          "host": "aligneddc.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Reviewed operator source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2500+W+Union+Hills+Drive%2C+Phoenix%2C+AZ+85027&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street method and limits"
        },
        {
          "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPImagery/ImageServer/exportImage?bbox=-112.11511339190726%2C33.65207234617703%2C-112.10863823625876%2C33.65746221322697&bboxSR=4326&imageSR=4326&size=1000%2C1000&format=jpg&f=image",
          "host": "imagery.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Aerial setting context only, acquisition date not established"
        }
      ],
      "loc": {
        "lat": 33.654767279702,
        "lng": -112.111875814083,
        "precision": "address",
        "basis": "Published Aligned facility address 2500 W Union Hills Drive, Phoenix, AZ 85027 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "field-verification-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "street": "2500 W Union Hills Drive",
            "city": "Phoenix",
            "campus_acres": 55
          },
          "notes": [
            "Generator/UPS component ratings are not facility-wide MW.",
            "Shared address with PHX05 requires campus/building deduplication.",
            "Operator groups PHX01/02/03 at one address and lists PHX05 at the same address. Establish campus relationship before counting.",
            "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://aligneddc.com/phoenix/",
              "host": "aligneddc.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "remaining-operators-review-round5-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "historical_substation_voltage_kv": 69,
            "historical_microgrid_project_mw": 63,
            "historical_location": "Union Hills Drive and I17"
          },
          "notes": [
            "Microgridgeneration63MWnotdata-centerIT. Voltage69kVisnotcapacity.2016nearlycomplete/soonstatementsnotcurrentstatus.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://aligneddc.com/power-reliability-is-a-big-driver-for-aligned-data-centers-in-phoenix/",
              "host": "aligneddc.com",
              "date": "2016-03-16",
              "published": "2016-03-16",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 7",
          "scope": "The current Aligned Phoenix page explicitly lists PHX01, PHX02 and PHX03 together at the Union Hills Drive campus, with continuous access and an uptime service commitment. Operator listed service describes this current listing. It does not establish full utilization, commissioning of every phase or a dated opening. Other Phoenix and Chandler campus codes remain separate.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_service",
              "scope": "The current Aligned Phoenix page explicitly lists PHX01, PHX02 and PHX03 together at the Union Hills Drive campus, with continuous access and an uptime service commitment. Operator listed service describes this current listing. It does not establish full utilization, commissioning of every phase or a dated opening. Other Phoenix and Chandler campus codes remain separate."
            }
          },
          "notes": [
            "The current Aligned Phoenix page explicitly lists PHX01, PHX02 and PHX03 together at the Union Hills Drive campus, with continuous access and an uptime service commitment. Operator listed service describes this current listing. It does not establish full utilization, commissioning of every phase or a dated opening. Other Phoenix and Chandler campus codes remain separate.",
            "No campus total, service offer or approval is converted into an observed operating capacity, exact site point or verified opening day."
          ],
          "sources": [
            {
              "url": "https://aligneddc.com/phoenix-data-centers/",
              "host": "aligneddc.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 12, October 22, 2026",
          "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 33.654767279702,
                "lng": -112.111875814083,
                "precision": "address",
                "basis": "Published Aligned facility address 2500 W Union Hills Drive, Phoenix, AZ 85027 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "2500 W Union Hills Drive, Phoenix, AZ 85027",
              "county_fips": [
                "04013"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The current official numeric facility section identifies this existing research record. All prior native address and status wrappers remain exact. Corporate headquarters, related facility cards and operator map coordinates are excluded.",
            "The numeric street, name, type and directions are explicitly matched to the single Census result. State and existing county agree. The image center is on or beside a street in an industrial or office setting. Nearby housing is not selected as a facility reference. No roof, parcel or title is identified from appearance.",
            "Official USGS aerial setting context was visually reviewed. The acquisition date is not established and may predate construction. No aerial coordinate, commissioning date, current operation, property ownership, surveyed roof or full campus is adopted.",
            "The operator binds the PHX 01/02/03 campus section to one service street address. One calculated street reference is used for the existing combined record, without three building pins or a complete campus boundary."
          ],
          "sources": [
            {
              "url": "https://aligneddc.com/phoenix-data-centers/",
              "host": "aligneddc.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Official named PHX-01/02/03 numeric street section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2500+W+Union+Hills+Drive%2C+Phoenix%2C+AZ+85027&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street method and limits"
            },
            {
              "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPImagery/ImageServer/exportImage?bbox=-112.11511339190726%2C33.65207234617703%2C-112.10863823625876%2C33.65746221322697&bboxSR=4326&imageSR=4326&size=1000%2C1000&format=jpg&f=image",
              "host": "imagery.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Aerial setting context only, acquisition date not established"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 13, October 23, 2026",
          "scope": "Aligned Data Centers explicitly lists this named code or campus in its own location portfolio. Operator is the attributed provider brand relationship, not an independently established legal entity, property owner or commissioning finding for every phase. Listed availability, design standards and service guarantees do not prove delivered power or current operation. No status, location, physical date, technical quantity or environmental outcome is promoted. The page distinguishes multiple campus codes. The relationship covers only the retained named combined codes, with no count of distinct physical sites or transfer to the other listed campuses.",
          "fields": {
            "company_association": {
              "name": "Aligned Data Centers",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Aligned Data Centers explicitly lists this named code or campus in its own location portfolio. Operator is the attributed provider brand relationship, not an independently established legal entity, property owner or commissioning finding for every phase. Listed availability, design standards and service guarantees do not prove delivered power or current operation. No status, location, physical date, technical quantity or environmental outcome is promoted. The page distinguishes multiple campus codes. The relationship covers only the retained named combined codes, with no count of distinct physical sites or transfer to the other listed campuses."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Aligned Data Centers explicitly lists this named code or campus in its own location portfolio. Operator is the attributed provider brand relationship, not an independently established legal entity, property owner or commissioning finding for every phase. Listed availability, design standards and service guarantees do not prove delivered power or current operation. No status, location, physical date, technical quantity or environmental outcome is promoted. The page distinguishes multiple campus codes. The relationship covers only the retained named combined codes, with no count of distinct physical sites or transfer to the other listed campuses.",
            "Source dates remain separate from physical milestones and the retained status field."
          ],
          "sources": [
            {
              "url": "https://aligneddc.com/phoenix/",
              "host": "aligneddc.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party exact named code or campus text, scoped provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Phoenix · Maricopa · Source context reviewed",
      "status_scope": "The current Aligned Phoenix page explicitly lists PHX01, PHX02 and PHX03 together at the Union Hills Drive campus, with continuous access and an uptime service commitment. Operator listed service describes this current listing. It does not establish full utilization, commissioning of every phase or a dated opening. Other Phoenix and Chandler campus codes remain separate."
    },
    {
      "id": "aligned-phx13-glendale-az",
      "state": "az",
      "kind": "facility",
      "name": "Aligned PHX-13",
      "group": "building",
      "status": "Operator-reported construction",
      "raw_status": "under construction",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Glendale",
      "address": "",
      "who": "Aligned Data Centers",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.. Glendale Star May12,2025, updatedJune10, reproduces city-submitted PHX13 groundbreaking context.72MW is this planned facility, one of four on100acre campus; no explicit criticalITbasis and no72times4 inference.230kV is transmission voltage. This is groundbreaking, not energization.73%water reduction against formerrosefarm, renewablepower andclosedloop statements are promoter claims, not audited annual usage. Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.glendalestar.com/news/aligned-data-centers-breaks-ground/article_4c7a2620-ccc3-4821-a236-dbfedb40ae85.html",
          "host": "glendalestar.com",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://aligneddc.com/video-resources/how-precast-powers-speed-ami-in-action-at-phx-13/",
          "host": "aligneddc.com",
          "published": "2025-07-02",
          "date": "2025-07-02",
          "checked": "2026-10-17",
          "label": "Reviewed source context"
        },
        {
          "url": "https://www.glendaleaz.gov/Business/Economic-Development/Economic-Development-News/2025/Aligned-Data-Centers-Breaks-Ground-on-Phx-13-Facility",
          "host": "www.glendaleaz.gov",
          "published": "2025-04-15",
          "date": "2025-04-15",
          "checked": "2026-10-17",
          "label": "Reviewed source context"
        }
      ],
      "loc": {
        "lat": 33.40119,
        "lng": -112.54831,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "national-acquisitions-regulatory-stage-and-site-crosswalks-round81-2026-10-15.json",
          "scope": "Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.",
          "fields": {},
          "notes": [
            "Glendale Star May12,2025, updatedJune10, reproduces city-submitted PHX13 groundbreaking context.72MW is this planned facility, one of four on100acre campus; no explicit criticalITbasis and no72times4 inference.230kV is transmission voltage. This is groundbreaking, not energization.73%water reduction against formerrosefarm, renewablepower andclosedloop statements are promoter claims, not audited annual usage.",
            "Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified."
          ],
          "sources": [
            {
              "url": "https://www.glendalestar.com/news/aligned-data-centers-breaks-ground/article_4c7a2620-ccc3-4821-a236-dbfedb40ae85.html",
              "host": "glendalestar.com",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "encore-2026-10-17-batch2",
          "scope": "Limited source identity and stage review; not whole-record certification, parcel verification or a physical-site census.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator-reported_construction",
              "scope": "Aligned’s PHX-13 description reports precast construction at the Glendale facility. Its publication date is July 2, 2025; the October 15, 2025 modification date is separate. Glendale’s April 15, 2025 groundbreaking account corroborates project identity. These are construction reports, not proof of energization or completion. Reported design and water-saving claims are not metered use; the unavailable water PDF supplies no facts."
            }
          },
          "notes": [
            "Aligned’s PHX-13 description reports precast construction at the Glendale facility. Its publication date is July 2, 2025; the October 15, 2025 modification date is separate. Glendale’s April 15, 2025 groundbreaking account corroborates project identity. These are construction reports, not proof of energization or completion. Reported design and water-saving claims are not metered use; the unavailable water PDF supplies no facts."
          ],
          "sources": [
            {
              "url": "https://aligneddc.com/video-resources/how-precast-powers-speed-ami-in-action-at-phx-13/",
              "host": "aligneddc.com",
              "published": "2025-07-02",
              "date": "2025-07-02",
              "checked": "2026-10-17",
              "label": "Reviewed source context"
            },
            {
              "url": "https://www.glendaleaz.gov/Business/Economic-Development/Economic-Development-News/2025/Aligned-Data-Centers-Breaks-Ground-on-Phx-13-Facility",
              "host": "www.glendaleaz.gov",
              "published": "2025-04-15",
              "date": "2025-04-15",
              "checked": "2026-10-17",
              "label": "Reviewed source context"
            }
          ],
          "checked": "2026-10-17",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 13, October 23, 2026",
          "scope": "Aligned Data Centers describes development of this named campus in its own source. Developer is the attributed provider brand relationship, not proof of current construction, completed works, operating service, legal ownership or a confirmed parcel. No status, location, physical date, quantity or environmental outcome is promoted. The video page text identifies the PHX-13 build and the company construction management role. Only that written relationship is used; no video inspection or installed work is certified.",
          "fields": {
            "company_association": {
              "name": "Aligned Data Centers",
              "role": "developer",
              "identity_scope": "provider_brand_only",
              "scope": "Aligned Data Centers describes development of this named campus in its own source. Developer is the attributed provider brand relationship, not proof of current construction, completed works, operating service, legal ownership or a confirmed parcel. No status, location, physical date, quantity or environmental outcome is promoted. The video page text identifies the PHX-13 build and the company construction management role. Only that written relationship is used; no video inspection or installed work is certified."
            },
            "provider_role": "developer"
          },
          "notes": [
            "Aligned Data Centers describes development of this named campus in its own source. Developer is the attributed provider brand relationship, not proof of current construction, completed works, operating service, legal ownership or a confirmed parcel. No status, location, physical date, quantity or environmental outcome is promoted. The video page text identifies the PHX-13 build and the company construction management role. Only that written relationship is used; no video inspection or installed work is certified.",
            "Source dates remain separate from physical milestones and the retained status field."
          ],
          "sources": [
            {
              "url": "https://aligneddc.com/video-resources/how-precast-powers-speed-ami-in-action-at-phx-13/",
              "host": "aligneddc.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party exact named code or campus text, scoped provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": false,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Glendale · Maricopa · Source context reviewed",
      "status_scope": "Aligned’s PHX-13 description reports precast construction at the Glendale facility. Its publication date is July 2, 2025; the October 15, 2025 modification date is separate. Glendale’s April 15, 2025 groundbreaking account corroborates project identity. These are construction reports, not proof of energization or completion. Reported design and water-saving claims are not metered use; the unavailable water PDF supplies no facts.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "apple-mesa-az",
      "state": "az",
      "kind": "facility",
      "name": "Apple Mesa Data Center (Global Command Center)",
      "group": "operating",
      "status": "Operating phase",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Mesa",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. historical industrial trade-zone application only. Foreign-trade subzone application for an Apple facility does not identify 2014data-center use, current operating status, ITMW or incentive amount received. No data-center opening inferred from industrial application. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.federalregister.gov/documents/full_text/text/2014/01/23/2014-01296.txt",
          "host": "federalregister.gov",
          "date": "2014-01-23",
          "published": "2014-01-23",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.apple.com/environment/pdf/Apple_Environmental_Progress_Report_2026.pdf",
          "host": "www.apple.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 33.24039,
        "lng": -112.48188,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "government-primary-review-round7-2026-10-14.json",
          "scope": "historical industrial trade-zone application only",
          "fields": {
            "historical_apple_site_address": "3740 SSignal Butte Road, Mesa, Arizona",
            "historical_ftz_application_area_acres": 83.17,
            "foreign_trade_zone_application_docket_date": "2014-01-14"
          },
          "notes": [
            "Foreign-trade subzone application for an Apple facility does not identify 2014data-center use, current operating status, ITMW or incentive amount received. No data-center opening inferred from industrial application.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.federalregister.gov/documents/full_text/text/2014/01/23/2014-01296.txt",
              "host": "federalregister.gov",
              "date": "2014-01-23",
              "published": "2014-01-23",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 11",
          "scope": "Apple identifies Mesa among its owned and operated data centers in its 2026 environmental report and provides a Mesa operating electricity account for 2025. Operating phase describes the reported existing data center, not every possible building, all capacity, continuous uptime or a certified exact opening day. The water stewardship certification is supporting context and is not the basis of operation.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "issuer_reported_existing_operation",
              "scope": "Apple identifies Mesa among its owned and operated data centers in its 2026 environmental report and provides a Mesa operating electricity account for 2025. Operating phase describes the reported existing data center, not every possible building, all capacity, continuous uptime or a certified exact opening day. The water stewardship certification is supporting context and is not the basis of operation."
            },
            "historical_date_scope": {
              "source_pages_visually_read": [
                53,
                96
              ],
              "report_year": 2026,
              "operating_account_year": 2025,
              "exact_opening_day_established": false,
              "source_date_descriptions": "Page 96 describes coming online in 2016 and separately gives March 2017 for customer service in its footnote. These are retained as distinct source descriptions without manufacturing a day or changing the native opening field.",
              "renewable_generation_dates_not_data_center_opening_dates": true
            }
          },
          "notes": [
            "Apple identifies Mesa among its owned and operated data centers in its 2026 environmental report and provides a Mesa operating electricity account for 2025. Operating phase describes the reported existing data center, not every possible building, all capacity, continuous uptime or a certified exact opening day. The water stewardship certification is supporting context and is not the basis of operation.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones."
          ],
          "sources": [
            {
              "url": "https://www.apple.com/environment/pdf/Apple_Environmental_Progress_Report_2026.pdf",
              "host": "www.apple.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Mesa · Maricopa · Source context reviewed",
      "status_scope": "Apple identifies Mesa among its owned and operated data centers in its 2026 environmental report and provides a Mesa operating electricity account for 2025. Operating phase describes the reported existing data center, not every possible building, all capacity, continuous uptime or a certified exact opening day. The water stewardship certification is supporting context and is not the basis of operation.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "arizona-land-consulting-balterra-tonopah-az",
      "state": "az",
      "kind": "facility",
      "name": "Balterra",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Tonopah",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Combined development estimate includes entertainment, residential and other uses. No dedicated data-center capex or tenant inferred. Later approval-stage account supersedes August planning-stage article. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2026-08-06",
          "The county report records the Planning and Zoning Commission recommendation for Balterra CPA260007 and Z260018 on August 6, 2026. This is the commission hearing outcome, not final Board approval, a construction permit or a physical opening."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://azbex.com/planning-development/tonopah-mixed-use-development-rezoning/",
          "host": "azbex.com",
          "date": "2026-09-09",
          "published": "2026-09-09",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10496?fileID=102598",
          "host": "www.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Reviewed government record"
        }
      ],
      "loc": {
        "lat": 33.45512,
        "lng": -112.41011,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round22-2026-10-14.json",
          "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.",
          "fields": {
            "reported_context": "AZBEX reports September 2 mixed-use plan/rezoning approvals for Balterra and Camelback Creek; site plans still required.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Combined development estimate includes entertainment, residential and other uses. No dedicated data-center capex or tenant inferred. Later approval-stage account supersedes August planning-stage article.",
            "Original executed approvals, current operator disclosures and subsequent decisions take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://azbex.com/planning-development/tonopah-mixed-use-development-rezoning/",
              "host": "azbex.com",
              "date": "2026-09-09",
              "published": "2026-09-09",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 11",
          "scope": "The county Balterra report records the August 6 commission recommendation and schedules September 2 Board consideration. It says no plan of development is incorporated and subsequent development approval is needed before construction permitting. The Board decision portal could not be read in this review. A recommendation, attached draft resolution and scheduled hearing do not establish a final Board vote, issued construction permits or operation. Physical stage remains unclear.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "planning_recommendation_final_board_and_physical_stage_held",
              "scope": "The county Balterra report records the August 6 commission recommendation and schedules September 2 Board consideration. It says no plan of development is incorporated and subsequent development approval is needed before construction permitting. The Board decision portal could not be read in this review. A recommendation, attached draft resolution and scheduled hearing do not establish a final Board vote, issued construction permits or operation. Physical stage remains unclear."
            },
            "regulatory_scope": {
              "cases": [
                "CPA260007",
                "Z260018"
              ],
              "commission_recommendation_on": "2026-08-06",
              "board_consideration_scheduled_on": "2026-09-02",
              "final_board_outcome_verified": false,
              "conditions_are_proposed_project_conditions_not_countywide_rules": true
            }
          },
          "notes": [
            "The county Balterra report records the August 6 commission recommendation and schedules September 2 Board consideration. It says no plan of development is incorporated and subsequent development approval is needed before construction permitting. The Board decision portal could not be read in this review. A recommendation, attached draft resolution and scheduled hearing do not establish a final Board vote, issued construction permits or operation. Physical stage remains unclear.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones."
          ],
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10496?fileID=102598",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Tonopah · Maricopa · Source context reviewed",
      "event_evidence": [
        {
          "date": "2026-08-06",
          "text": "The county report records the Planning and Zoning Commission recommendation for Balterra CPA260007 and Z260018 on August 6, 2026. This is the commission hearing outcome, not final Board approval, a construction permit or a physical opening.",
          "kind": "hearing",
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10496?fileID=102598",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "arizona-land-consulting-camelback-creek-tonopah-az",
      "state": "az",
      "kind": "facility",
      "name": "Camelback Creek",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Tonopah",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. September 9 article reports later rezoning approval, not a finalized site plan or secured energized power. General mixed-use allowances are not a tenant commitment. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2026-08-06",
          "The county report records the commission recommendation for Camelback Creek CPA260008 and Z260019 on August 6, 2026. This is the commission hearing outcome. September 2 Board consideration was scheduled, and a final Board vote, construction permit and operation are not established by this report."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://azbex.com/planning-development/320-acre-warehouse-data-center-master-plan-proposed-in-far-west-valley/",
          "host": "azbex.com",
          "date": "2026-08-04",
          "published": "2026-08-04",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10497?fileID=102599",
          "host": "www.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Reviewed government record"
        },
        {
          "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10507?fileID=102687",
          "host": "www.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Reviewed government record"
        },
        {
          "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=APN_DASH+%3D+%27506-35-029A%27&outFields=OBJECTID%2CAPN%2CAPN_DASH%2CPHYSICAL_ADDRESS%2CPHYSICAL_CITY%2CPHYSICAL_ZIP%2CLAND_SIZE%2CSTR&returnGeometry=true&outSR=4326&f=json",
          "host": "gis.mcassessor.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Exact complete official parcel query, calculated center only"
        },
        {
          "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-112.95150574034739%2C33.506959288537544%2C-112.93965425965263%2C33.51684071146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
          "host": "imagery.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Actually viewed setting, imagery acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -112.94558,
        "lat": 33.5119,
        "precision": "approximate",
        "basis": "Approximate calculated center of official source parcel 506-35-029A independently joined to the original named computing or mixed use planning filing. Complete one source parcel named in Camelback Creek, not an exact roof, title or computing footprint. Parcel center and boundary are source references only, with no certified roof, tenant, complete campus or whole parcel computing use. Every original role, status, quantity and date remains unchanged. Imagery acquisition date is unknown and may predate construction."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round22-2026-10-14.json",
          "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.",
          "fields": {
            "reported_context": "AZBEX describes Camelback Creek planning request with no end users secured and utility extensions/feasibility studies needed.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "September 9 article reports later rezoning approval, not a finalized site plan or secured energized power. General mixed-use allowances are not a tenant commitment.",
            "Original executed approvals, current operator disclosures and subsequent decisions take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://azbex.com/planning-development/320-acre-warehouse-data-center-master-plan-proposed-in-far-west-valley/",
              "host": "azbex.com",
              "date": "2026-08-04",
              "published": "2026-08-04",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 11",
          "scope": "The county report records the August 6 commission recommendation for Camelback Creek and schedules September 2 Board consideration. A later handout expressly records opposition received after the earlier report. Its proposed development and utility conditions are not proof of final approval or compliance. The Board decision portal could not be read. Current physical stage and final Board outcome remain unclear.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "planning_recommendation_later_public_concerns_and_final_outcome_hold",
              "scope": "The county report records the August 6 commission recommendation for Camelback Creek and schedules September 2 Board consideration. A later handout expressly records opposition received after the earlier report. Its proposed development and utility conditions are not proof of final approval or compliance. The Board decision portal could not be read. Current physical stage and final Board outcome remain unclear."
            },
            "opposition_record_sequence": {
              "earlier_report_says_no_known_opposition": true,
              "later_handout_records_opposition": true,
              "handout_document_date": "2026-09-02",
              "letter_count_not_a_unique_person_count": true,
              "final_board_outcome_verified": false
            }
          },
          "notes": [
            "The county report records the August 6 commission recommendation for Camelback Creek and schedules September 2 Board consideration. A later handout expressly records opposition received after the earlier report. Its proposed development and utility conditions are not proof of final approval or compliance. The Board decision portal could not be read. Current physical stage and final Board outcome remain unclear.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones."
          ],
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10497?fileID=102599",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            },
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10507?fileID=102687",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 70, 2026-10-24",
          "scope": "Complete one source parcel named in Camelback Creek, not an exact roof, title or computing footprint. All original source dates, group, status, quantities, jurisdiction and prior coordinates remain exact in history. Approximate source reference only.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -112.94558,
                "lat": 33.5119,
                "precision": "approximate",
                "basis": "Approximate calculated center of official source parcel 506-35-029A independently joined to the original named computing or mixed use planning filing. Complete one source parcel named in Camelback Creek, not an exact roof, title or computing footprint. Parcel center and boundary are source references only, with no certified roof, tenant, complete campus or whole parcel computing use. Every original role, status, quantity and date remains unchanged. Imagery acquisition date is unknown and may predate construction."
              },
              "reference_method": "Approximate county reference parcel center",
              "reference_parcel": "506-35-029A",
              "operator_coordinates_adopted": false,
              "census_range_adopted": false
            }
          },
          "notes": [
            "Complete one source parcel named in Camelback Creek, not an exact roof, title or computing footprint. All original source dates, group, status, quantities, jurisdiction and prior coordinates remain exact in history. Approximate source reference only.",
            "The inherited general area coordinate was not independently admitted as a reviewed computing source reference. The original official named planning filing independently identifies source parcel 506-35-029A. The exact complete official parcel query returns the full source geometry; no owner mail, hearing venue, applicant office or neighboring parcel is selected. Complete one source parcel named in Camelback Creek, not an exact roof, title or computing footprint. The unchanged calculated center and every source vertex are inside the unchanged county 04013. The measured correction is 1556.1 metres. Source setting pixels supply no coordinates, construction status, completed computing use, legal title or complete campus.",
            "The source setting shows desert and agricultural rectangles, local roads and scattered structures. No computing roof or present construction state is selected. Acquisition date is unknown."
          ],
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10497?fileID=102599",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Original named computing or mixed use filing with explicit source parcel identifier"
            },
            {
              "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=APN_DASH+%3D+%27506-35-029A%27&outFields=OBJECTID%2CAPN%2CAPN_DASH%2CPHYSICAL_ADDRESS%2CPHYSICAL_CITY%2CPHYSICAL_ZIP%2CLAND_SIZE%2CSTR&returnGeometry=true&outSR=4326&f=json",
              "host": "gis.mcassessor.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Exact complete official parcel query, calculated center only"
            },
            {
              "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-112.95150574034739%2C33.506959288537544%2C-112.93965425965263%2C33.51684071146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
              "host": "imagery.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Actually viewed setting, imagery acquisition date unknown"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Approximate source parcel reference, not a roof or complete campus",
      "summary": "Tonopah · Maricopa · Source context reviewed",
      "event_evidence": [
        {
          "date": "2026-08-06",
          "text": "The county report records the commission recommendation for Camelback Creek CPA260008 and Z260019 on August 6, 2026. This is the commission hearing outcome. September 2 Board consideration was scheduled, and a final Board vote, construction permit and operation are not established by this report.",
          "kind": "hearing",
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10497?fileID=102599",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            }
          ]
        }
      ]
    },
    {
      "id": "arizona-land-consulting-hassayampa-ranch-tonopah-az",
      "state": "az",
      "kind": "facility",
      "name": "Hassayampa Ranch Data Center",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Tonopah",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. Dec12,2025BerryRiddellrepublicationcreditsazcentralJohnLeosandquotesitsownclientrepresentative. Dec10countyland-usechange2000unincorporatedacnearTonopahoutsideBuckeye;subsequentrezoning/siteplanningstillneeded.25B/1GWproposalundefinedbasis,51Mlanddealseparate. NotfullyapprovedconstructionorESA.2008unbuilt5700homesplanhistoricalnotDCsize. PinalEloy33B3300acVermaSrprojectSEPARATE;no58Bcombinedcampus. Opposition100signaturesreportednotrepresentativesurvey. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.",
      "date": "",
      "events": [
        [
          "2026-03-05",
          "The county report records a March 5, 2026 commission recommendation on Hassayampa Ranch Z250047. The recommendation and scheduled April 8 Board consideration do not establish a final Board vote, construction permits, a start of work or customer operation."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://berryriddell.com/25b-data-center-planned-west-of-phoenix-wins-key-approval-from-county/",
          "host": "berryriddell.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10211?fileID=99867",
          "host": "www.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Reviewed government record"
        },
        {
          "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=APN_DASH+IN+%28%27504-03-010A%27%2C%27504-03-010B%27%29&outFields=OBJECTID%2CAPN%2CAPN_DASH%2CPHYSICAL_ADDRESS%2CPHYSICAL_CITY%2CPHYSICAL_ZIP%2CLAND_SIZE%2CSTR&returnGeometry=true&outSR=4326&f=json",
          "host": "gis.mcassessor.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Exact complete official parcel query, calculated center only"
        },
        {
          "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-112.77531571843218%2C33.50663928853755%2C-112.76346428156782%2C33.516520711462455&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
          "host": "imagery.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Actually viewed setting, imagery acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -112.76939,
        "lat": 33.51158,
        "precision": "approximate",
        "basis": "Approximate calculated center of official source parcel 504-03-010B independently joined to the original named computing or mixed use planning filing. One complete source parcel B within the named filing. Separate parcel A is retained and excluded from this bounded reference; no full campus or complete rezoning boundary is claimed. Parcel center and boundary are source references only, with no certified roof, tenant, complete campus or whole parcel computing use. Every original role, status, quantity and date remains unchanged. Imagery acquisition date is unknown and may predate construction."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json",
          "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.",
          "fields": {
            "dated_reported_context": "Dec12,2025BerryRiddellrepublicationcreditsazcentralJohnLeosandquotesitsownclientrepresentative. Dec10countyland-usechange2000unincorporatedacnearTonopahoutsideBuckeye;subsequentrezoning/siteplanningstillneeded.25B/1GWproposalundefinedbasis,51Mlanddealseparate. NotfullyapprovedconstructionorESA.2008unbuilt5700homesplanhistoricalnotDCsize. PinalEloy33B3300acVermaSrprojectSEPARATE;no58Bcombinedcampus. Opposition100signaturesreportednotrepresentativesurvey."
          },
          "notes": [
            "Dec12,2025BerryRiddellrepublicationcreditsazcentralJohnLeosandquotesitsownclientrepresentative. Dec10countyland-usechange2000unincorporatedacnearTonopahoutsideBuckeye;subsequentrezoning/siteplanningstillneeded.25B/1GWproposalundefinedbasis,51Mlanddealseparate. NotfullyapprovedconstructionorESA.2008unbuilt5700homesplanhistoricalnotDCsize. PinalEloy33B3300acVermaSrprojectSEPARATE;no58Bcombinedcampus. Opposition100signaturesreportednotrepresentativesurvey.",
            "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations."
          ],
          "sources": [
            {
              "url": "https://berryriddell.com/25b-data-center-planned-west-of-phoenix-wins-key-approval-from-county/",
              "host": "berryriddell.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 11",
          "scope": "The county report records a March 5 commission recommendation on Hassayampa Ranch Z250047 and schedules April 8 Board consideration. Its staff analysis describes industrial land use and public concerns. A comprehensive plan designation and rezoning recommendation are separate from final Board action, building permits and physical construction or operation. Current physical stage and the final rezoning outcome remain unclear.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "rezoning_recommendation_final_action_and_current_stage_held",
              "scope": "The county report records a March 5 commission recommendation on Hassayampa Ranch Z250047 and schedules April 8 Board consideration. Its staff analysis describes industrial land use and public concerns. A comprehensive plan designation and rezoning recommendation are separate from final Board action, building permits and physical construction or operation. Current physical stage and the final rezoning outcome remain unclear."
            },
            "regulatory_scope": {
              "case": "Z250047",
              "commission_recommendation_on": "2026-03-05",
              "board_consideration_scheduled_on": "2026-04-08",
              "land_use_designation_not_same_as_rezoning_or_construction_permit": true,
              "final_board_outcome_verified": false
            }
          },
          "notes": [
            "The county report records a March 5 commission recommendation on Hassayampa Ranch Z250047 and schedules April 8 Board consideration. Its staff analysis describes industrial land use and public concerns. A comprehensive plan designation and rezoning recommendation are separate from final Board action, building permits and physical construction or operation. Current physical stage and the final rezoning outcome remain unclear.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones."
          ],
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10211?fileID=99867",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 70, 2026-10-24",
          "scope": "One complete source parcel B within the named filing. Separate parcel A is retained and excluded from this bounded reference; no full campus or complete rezoning boundary is claimed. All original source dates, group, status, quantities, jurisdiction and prior coordinates remain exact in history. Approximate source reference only.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -112.76939,
                "lat": 33.51158,
                "precision": "approximate",
                "basis": "Approximate calculated center of official source parcel 504-03-010B independently joined to the original named computing or mixed use planning filing. One complete source parcel B within the named filing. Separate parcel A is retained and excluded from this bounded reference; no full campus or complete rezoning boundary is claimed. Parcel center and boundary are source references only, with no certified roof, tenant, complete campus or whole parcel computing use. Every original role, status, quantity and date remains unchanged. Imagery acquisition date is unknown and may predate construction."
              },
              "reference_method": "Approximate county reference parcel center",
              "reference_parcel": "504-03-010B",
              "operator_coordinates_adopted": false,
              "census_range_adopted": false
            }
          },
          "notes": [
            "One complete source parcel B within the named filing. Separate parcel A is retained and excluded from this bounded reference; no full campus or complete rezoning boundary is claimed. All original source dates, group, status, quantities, jurisdiction and prior coordinates remain exact in history. Approximate source reference only.",
            "The inherited general area coordinate was not independently admitted as a reviewed computing source reference. The original official named planning filing independently identifies source parcel 504-03-010B. The exact complete official parcel query returns the full source geometry; no owner mail, hearing venue, applicant office or neighboring parcel is selected. One complete source parcel B within the named filing. Separate parcel A is retained and excluded from this bounded reference; no full campus or complete rezoning boundary is claimed. The unchanged calculated center and every source vertex are inside the unchanged county 04013. The measured correction is 0.5 metres. Source setting pixels supply no coordinates, construction status, completed computing use, legal title or complete campus.",
            "The source setting shows mostly open desert, drainage patterns, tracks and a few structures toward the edge. It does not certify development, current construction or a computing roof. Acquisition date is unknown."
          ],
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10211?fileID=99867",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Original named computing or mixed use filing with explicit source parcel identifier"
            },
            {
              "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=APN_DASH+IN+%28%27504-03-010A%27%2C%27504-03-010B%27%29&outFields=OBJECTID%2CAPN%2CAPN_DASH%2CPHYSICAL_ADDRESS%2CPHYSICAL_CITY%2CPHYSICAL_ZIP%2CLAND_SIZE%2CSTR&returnGeometry=true&outSR=4326&f=json",
              "host": "gis.mcassessor.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Exact complete official parcel query, calculated center only"
            },
            {
              "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-112.77531571843218%2C33.50663928853755%2C-112.76346428156782%2C33.516520711462455&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
              "host": "imagery.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Actually viewed setting, imagery acquisition date unknown"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Approximate source parcel reference, not a roof or complete campus",
      "summary": "Tonopah · Maricopa · Source context reviewed",
      "event_evidence": [
        {
          "date": "2026-03-05",
          "text": "The county report records a March 5, 2026 commission recommendation on Hassayampa Ranch Z250047. The recommendation and scheduled April 8 Board consideration do not establish a final Board vote, construction permits, a start of work or customer operation.",
          "kind": "hearing",
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10211?fileID=99867",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            }
          ]
        }
      ]
    },
    {
      "id": "aws-laveen-az",
      "state": "az",
      "kind": "facility",
      "name": "AWS Laveen Data Center Campus",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Laveen",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Reported 277 million USD is land transaction, not project capex or commissioned facility. Other Valley acquisitions and market MW totals do not belong to this site. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.aztechcouncil.org/amazon-buys-massive-valley-site-for-potential-data-center/",
          "host": "aztechcouncil.org",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.3222,
        "lng": -112.64336,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round22-2026-10-14.json",
          "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.",
          "fields": {
            "reported_context": "Phoenix Business Journal reporting republished by Arizona Technology Council describes Amazon Laveen acquisition and potential data center use.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Reported 277 million USD is land transaction, not project capex or commissioned facility. Other Valley acquisitions and market MW totals do not belong to this site.",
            "Original executed approvals, current operator disclosures and subsequent decisions take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.aztechcouncil.org/amazon-buys-massive-valley-site-for-potential-data-center/",
              "host": "aztechcouncil.org",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Laveen · Maricopa · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "centersquare-phx3-az",
      "state": "az",
      "kind": "facility",
      "name": "Centersquare PHX3",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Mesa",
      "address": "",
      "who": "Csquare",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. PhoenixmarketlabelnotcityPhoenix. PHX1section40546area/13.3MWUPSnotPHX3. RatingsdifferentbasesnotIToradditive. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.csquare.com/data-centers/phoenix",
          "host": "csquare.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.csquare.com/hubfs/Centersquare%20website/docs/Csquare-PHX-SpecSheet.pdf",
          "host": "www.csquare.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Current named PHX3 operator specification sheet address"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1301+West+University+Drive%2C+Mesa%2C+AZ+85201&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Calculated Census street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-111.86243750573784%2C33.418951237050535%2C-111.85490346470415%2C33.42523941527547&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Aerial setting context only, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -111.858670485221,
        "lat": 33.422095326163,
        "precision": "address",
        "basis": "Published Centersquare facility address 1301 West University Drive, Mesa, AZ 85201 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "operator_site_code": "PHX3",
            "published_city": "Mesa, Arizona",
            "raised_floor_sqft": 50256,
            "utility_power_mw": 17.3,
            "ups_capacity_mw": 8,
            "generator_capacity_mw": 11.5
          },
          "notes": [
            "PhoenixmarketlabelnotcityPhoenix. PHX1section40546area/13.3MWUPSnotPHX3. RatingsdifferentbasesnotIToradditive.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.csquare.com/data-centers/phoenix",
              "host": "csquare.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "Csquare lists current colocation, connectivity and on-site support for its specifically named PHX3 in Mesa facility. Source naming is retained as context; no provider-brand, address, point, capacity or certification field is promoted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "Csquare lists current colocation, connectivity and on-site support for its specifically named PHX3 in Mesa facility. Source naming is retained as context; no provider-brand, address, point, capacity or certification field is promoted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "Csquare lists current colocation, connectivity and on-site support for its specifically named PHX3 in Mesa facility. Source naming is retained as context; no provider-brand, address, point, capacity or certification field is promoted."
          ],
          "sources": [
            {
              "url": "https://www.csquare.com/data-centers/phoenix",
              "host": "www.csquare.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 15, October 23, 2026",
          "scope": "Current official operator street reference only. All native protected facts and canonical address remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -111.858670485221,
                "lat": 33.422095326163,
                "precision": "address",
                "basis": "Published Centersquare facility address 1301 West University Drive, Mesa, AZ 85201 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "1301 West University Drive, Mesa, AZ 85201",
              "county_fips": [
                "04013"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The current official market page names the exact facility code and links the operator specification sheet. The named PDF facility address section was rendered and actually viewed. Related facilities, corporate offices and PDF map coordinates are excluded.",
            "The unique Census street range is a calculated address reference inside the existing state and county. Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. The street reference does not locate a surveyed roof, legal parcel, full campus, tenant suite or floor.",
            "Canonical address, stage, status, physical dates, quantities, company roles, jurisdiction and all unrelated wrappers remain exact. Current specifications and marketing do not certify commissioning or current operation.",
            "The retained Census method capture remains dated October 22. Actual operator, match and aerial captures are dated October 23. No source retrieval date is silently advanced."
          ],
          "sources": [
            {
              "url": "https://www.csquare.com/hubfs/Centersquare%20website/docs/Csquare-PHX-SpecSheet.pdf",
              "host": "www.csquare.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current named PHX3 operator specification sheet address"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1301+West+University+Drive%2C+Mesa%2C+AZ+85201&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Calculated Census street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-111.86243750573784%2C33.418951237050535%2C-111.85490346470415%2C33.42523941527547&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Aerial setting context only, acquisition date unknown"
            },
            {
              "url": "https://www.csquare.com/data-centers/phoenix",
              "host": "www.csquare.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current official market page names PHX3 and links the exact specification sheet"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check26, October23,2026",
          "scope": "The current Csquare provider website names this retained facility code and offers colocation and customer support. Operator per source identifies the provider brand only, not legal property ownership, a legal operating entity or sole operation of the whole building. Existing Centersquare record names are retained. No legal alias, corporate succession, identity merger, new physical building, status, point, street address, jurisdiction, power, water, equipment, certification or completion finding is adopted. Source marketing figures and service levels are not independent measurements. The page publication date remains unknown; retrieval is not an opening date. Only the named PHX3 service context is reviewed. Other codes on the shared market page keep their separate records and source scopes.",
          "fields": {
            "company_association": {
              "name": "Csquare",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "The current Csquare provider website names this retained facility code and offers colocation and customer support. Operator per source identifies the provider brand only, not legal property ownership, a legal operating entity or sole operation of the whole building. Existing Centersquare record names are retained. No legal alias, corporate succession, identity merger, new physical building, status, point, street address, jurisdiction, power, water, equipment, certification or completion finding is adopted. Source marketing figures and service levels are not independent measurements. The page publication date remains unknown; retrieval is not an opening date. Only the named PHX3 service context is reviewed. Other codes on the shared market page keep their separate records and source scopes."
            },
            "provider_role": "operator"
          },
          "notes": [
            "The current Csquare provider website names this retained facility code and offers colocation and customer support. Operator per source identifies the provider brand only, not legal property ownership, a legal operating entity or sole operation of the whole building. Existing Centersquare record names are retained. No legal alias, corporate succession, identity merger, new physical building, status, point, street address, jurisdiction, power, water, equipment, certification or completion finding is adopted. Source marketing figures and service levels are not independent measurements. The page publication date remains unknown; retrieval is not an opening date. Only the named PHX3 service context is reviewed. Other codes on the shared market page keep their separate records and source scopes."
          ],
          "sources": [
            {
              "url": "https://www.csquare.com/data-centers/phoenix",
              "host": "www.csquare.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current named PHX3 provider relationship"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Mesa · Maricopa · Source context reviewed",
      "status_scope": "Csquare lists current colocation, connectivity and on-site support for its specifically named PHX3 in Mesa facility. Source naming is retained as context; no provider-brand, address, point, capacity or certification field is promoted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "compass-goodyear-campus-az",
      "state": "az",
      "kind": "facility",
      "name": "Compass Datacenters Goodyear Campus",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Goodyear",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.. Historical Q42019 delivery forecast is not observed opening. Initial72MW lies within full campus, not422MW.230kV substation voltage not MW; ultimate350MW basis not explicitly critical IT. Subsequent original decisions and current operator disclosures take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2023-12-12",
          "Sundt published its Compass Goodyear progress report on December 12, 2023. It described a December 8 Building 3 completion celebration and other halls with future commissioning. This is the report publication date, not a verified data center service opening or completion of every campus phase."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://azbigmedia.com/business/economic-development/compass-datacenters-will-build-225-acre-goodyear-campus/",
          "host": "azbigmedia.com",
          "date": "2019-07-11",
          "published": "2019-07-11",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.compassdatacenters.com/data-center-markets/",
          "host": "www.compassdatacenters.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Reviewed operator source"
        },
        {
          "url": "https://www.sundt.com/2023/sundt-team-completes-building-at-compass-datacenters-campus-celebrating-major-milestone-with-toy-drive-for-local-nonprofits/",
          "host": "www.sundt.com",
          "published": "2023-12-12",
          "date": "2023-12-12",
          "checked": "2026-10-22",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 33.25649,
        "lng": -112.34586,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round24-2026-10-14.json",
          "scope": "Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.",
          "fields": {
            "reported_context": "AZ Big Media reports Compass Goodyear agreement and first-phase72MW IT target, with350MW ultimate eight-building campus.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Historical Q42019 delivery forecast is not observed opening. Initial72MW lies within full campus, not422MW.230kV substation voltage not MW; ultimate350MW basis not explicitly critical IT.",
            "Subsequent original decisions and current operator disclosures take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://azbigmedia.com/business/economic-development/compass-datacenters-will-build-225-acre-goodyear-campus/",
              "host": "azbigmedia.com",
              "date": "2019-07-11",
              "published": "2019-07-11",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 11",
          "scope": "Compass currently markets a developing Goodyear campus. Sundt reported completed and turned over buildings in December 2023 while describing other halls with future 2024 commissioning. Construction completion and handover do not establish customer operation, a present phase breakdown or delivered marketed capacity. The campus physical stage remains unclear.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "development_and_historical_handover_current_stage_held",
              "scope": "Compass currently markets a developing Goodyear campus. Sundt reported completed and turned over buildings in December 2023 while describing other halls with future 2024 commissioning. Construction completion and handover do not establish customer operation, a present phase breakdown or delivered marketed capacity. The campus physical stage remains unclear."
            },
            "construction_scope": {
              "contractor_report_publication": "2023-12-12",
              "exact_customer_service_opening_verified": false,
              "forecast_commissioning_not_promoted": true
            }
          },
          "notes": [
            "Compass currently markets a developing Goodyear campus. Sundt reported completed and turned over buildings in December 2023 while describing other halls with future 2024 commissioning. Construction completion and handover do not establish customer operation, a present phase breakdown or delivered marketed capacity. The campus physical stage remains unclear.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones."
          ],
          "sources": [
            {
              "url": "https://www.compassdatacenters.com/data-center-markets/",
              "host": "www.compassdatacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed operator source"
            },
            {
              "url": "https://www.sundt.com/2023/sundt-team-completes-building-at-compass-datacenters-campus-celebrating-major-milestone-with-toy-drive-for-local-nonprofits/",
              "host": "www.sundt.com",
              "published": "2023-12-12",
              "date": "2023-12-12",
              "checked": "2026-10-22",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Goodyear · Maricopa · Source context reviewed",
      "event_evidence": [
        {
          "date": "2023-12-12",
          "text": "Sundt published its Compass Goodyear progress report on December 12, 2023. It described a December 8 Building 3 completion celebration and other halls with future commissioning. This is the report publication date, not a verified data center service opening or completion of every campus phase.",
          "kind": "announced",
          "sources": [
            {
              "url": "https://www.sundt.com/2023/sundt-team-completes-building-at-compass-datacenters-campus-celebrating-major-milestone-with-toy-drive-for-local-nonprofits/",
              "host": "www.sundt.com",
              "published": "2023-12-12",
              "date": "2023-12-12",
              "checked": "2026-10-22",
              "label": "Reviewed operator source"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "cyrusone-chandler-phx1-phx8-az",
      "state": "az",
      "kind": "facility",
      "name": "CyrusOne Chandler Campus (PHX1-PHX8)",
      "group": "operating",
      "status": "Operating phase",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Chandler",
      "address": "",
      "who": "CyrusOne",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Multi-building Chandler campus values; not individual building totals or measured operating load. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.cyrusone.com/data-centers/north-america/chandler-arizona",
          "host": "cyrusone.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.53158,
        "lng": -112.54048,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round4-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "advertised_campus_technical_it_space_sqft": 2000000,
            "advertised_campus_total_it_capacity_mw": 169
          },
          "notes": [
            "Multi-building Chandler campus values; not individual building totals or measured operating load.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.cyrusone.com/data-centers/north-america/chandler-arizona",
              "host": "cyrusone.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "CyrusOne lists current services and staffed support at its named Chandler PHX1 to PHX8 campus. This is a service phase within the existing campus, not certification of every hall. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operating_phase",
              "scope": "CyrusOne lists current services and staffed support at its named Chandler PHX1 to PHX8 campus. This is a service phase within the existing campus, not certification of every hall. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "CyrusOne lists current services and staffed support at its named Chandler PHX1 to PHX8 campus. This is a service phase within the existing campus, not certification of every hall."
          ],
          "sources": [
            {
              "url": "https://www.cyrusone.com/data-centers/north-america/chandler-arizona",
              "host": "www.cyrusone.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 10, October 23, 2026",
          "scope": "CyrusOne presents this named facility or campus in its own service portfolio. Operator is the attributed provider brand role, not a separately established legal operating entity, property owner or finding that every building and phase is operating. No status, location, physical date, capacity, certification, resource use, current utility price or environmental outcome is promoted. The source and retained record cover multiple named facilities on a campus. The relationship does not resolve or count individual buildings or certify each phase.",
          "fields": {
            "company_association": {
              "name": "CyrusOne",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "CyrusOne presents this named facility or campus in its own service portfolio. Operator is the attributed provider brand role, not a separately established legal operating entity, property owner or finding that every building and phase is operating. No status, location, physical date, capacity, certification, resource use, current utility price or environmental outcome is promoted. The source and retained record cover multiple named facilities on a campus. The relationship does not resolve or count individual buildings or certify each phase."
            },
            "provider_role": "operator"
          },
          "notes": [
            "CyrusOne presents this named facility or campus in its own service portfolio. Operator is the attributed provider brand role, not a separately established legal operating entity, property owner or finding that every building and phase is operating. No status, location, physical date, capacity, certification, resource use, current utility price or environmental outcome is promoted. The source and retained record cover multiple named facilities on a campus. The relationship does not resolve or count individual buildings or certify each phase.",
            "Source dates remain separate from physical milestones and the retained status field."
          ],
          "sources": [
            {
              "url": "https://www.cyrusone.com/data-centers/north-america/chandler-arizona",
              "host": "www.cyrusone.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party named facility portfolio or campus development source, scoped relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Chandler · Maricopa · Source context reviewed",
      "status_scope": "CyrusOne lists current services and staffed support at its named Chandler PHX1 to PHX8 campus. This is a service phase within the existing campus, not certification of every hall. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "digital-realty-phx-tempe-az",
      "state": "az",
      "kind": "facility",
      "name": "Digital Realty PHX (Tempe)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Tempe",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Regional page lists Phoenix PHX10 and Chandler PHX15, not a named Tempe facility. Do not copy their area/power to the imported Tempe record. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.digitalrealty.com/data-centers/americas/phoenix",
          "host": "digitalrealty.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.16793,
        "lng": -112.5855,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round4-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {},
          "notes": [
            "Regional page lists Phoenix PHX10 and Chandler PHX15, not a named Tempe facility. Do not copy their area/power to the imported Tempe record.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.digitalrealty.com/data-centers/americas/phoenix",
              "host": "digitalrealty.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "encore-2026-10-17-batch1",
          "scope": "Limited source identity and stage review; not whole-record certification, parcel verification or a physical-site census.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "unresolved",
              "scope": "The current Digital Realty Phoenix directory lists PHX10 in Phoenix and PHX15 in Chandler. Neither identifies the inherited Tempe context. Absence from this portfolio page is not proof of closure, and another Phoenix-area facility is not substituted."
            }
          },
          "notes": [
            "The current Digital Realty Phoenix directory lists PHX10 in Phoenix and PHX15 in Chandler. Neither identifies the inherited Tempe context. Absence from this portfolio page is not proof of closure, and another Phoenix-area facility is not substituted."
          ],
          "sources": [
            {
              "url": "https://www.digitalrealty.com/data-centers/americas/phoenix",
              "host": "www.digitalrealty.com",
              "published": "",
              "date": "",
              "checked": "2026-10-17",
              "label": "Reviewed primary source"
            }
          ],
          "checked": "2026-10-17",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 7",
          "scope": "The current Digital Realty Phoenix market page lists PHX10 in Phoenix and PHX15 in Chandler. This review does not establish which code, if either, matches the inherited Tempe record. The market list does not resolve the record current stage or establish a new address or municipality.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "phoenix_market_tempe_identity_hold",
              "scope": "The current Digital Realty Phoenix market page lists PHX10 in Phoenix and PHX15 in Chandler. This review does not establish which code, if either, matches the inherited Tempe record. The market list does not resolve the record current stage or establish a new address or municipality."
            }
          },
          "notes": [
            "The current Digital Realty Phoenix market page lists PHX10 in Phoenix and PHX15 in Chandler. This review does not establish which code, if either, matches the inherited Tempe record. The market list does not resolve the record current stage or establish a new address or municipality.",
            "No campus total, service offer or approval is converted into an observed operating capacity, exact site point or verified opening day."
          ],
          "sources": [
            {
              "url": "https://www.digitalrealty.com/data-centers/americas/phoenix",
              "host": "www.digitalrealty.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": false,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Tempe · Maricopa · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "digital-realty-phx15-az",
      "state": "az",
      "kind": "facility",
      "name": "Digital Realty PHX15",
      "group": "operating",
      "status": "Operating phase",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Chandler",
      "address": "2121 South Price Road Chandler, AZ 85286",
      "who": "Digital Realty",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Named facility page and total-building-size field matched. Gross building size is not IT white space. Current advertisement does not certify utilization, uptime, opening date or independently measured power. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.digitalrealty.com/data-centers/americas/phoenix/phx15",
          "host": "digitalrealty.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2121+South+Price+Road+Chandler%2C+AZ+85286&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Published-address street-range query for Digital Realty PHX15"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-17",
          "label": "Census geocoder method: calculated address-range locations, not surveyed buildings"
        }
      ],
      "loc": {
        "lng": -111.889083396547,
        "lat": 33.27455502094,
        "precision": "address",
        "basis": "Published operating address matched to a Census street range; calculated location, not a surveyed parcel or building center."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round4-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "operator_facility_code": "PHX15",
            "published_address": "2121 South Price Road Chandler, AZ 85286",
            "advertised_building_sqft": 508000
          },
          "notes": [
            "Named facility page and total-building-size field matched. Gross building size is not IT white space. Current advertisement does not certify utilization, uptime, opening date or independently measured power.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.digitalrealty.com/data-centers/americas/phoenix/phx15",
              "host": "digitalrealty.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Digital Realty U.S. property review October 16",
          "scope": "Explicit current provider-code, service-component and published-address review. No physical-site census, ownership, current metered demand, full-campus delivery or coordinate certification.",
          "fields": {
            "operator_location_codes": [
              "PHX15"
            ],
            "current_service_scope": "Digital Realty currently markets colocation and connectivity services under PHX15. This supports an operating service component in the existing research context, not complete campus delivery, full-building operation, legal ownership, present vacancy or a commissioned IT-load figure.",
            "identity_scope": "The provider-qualified code and published locality match this existing ID. Codes used by CoreSite, Equinix, NTT or other providers are not interchangeable. Shared street addresses or carrier hotels do not certify separate physical sites or establish whole-building ownership.",
            "technical_scope": "The current listing is a commercial service/specification source. No current critical IT MW, utility-service authorization, annual energy, measured water series or construction/opening day is normalized from generic power, cooling, density, certification or renewable-energy claims.",
            "location_scope": "The published address is source context only. Inherited coordinates, precision, city/county jurisdiction and parcel identity are unchanged; the point has not been matched to the street address.",
            "published_address_PHX15": "2121 South Price Road Chandler, AZ 85286"
          },
          "notes": [
            "Operating phase refers to a currently marketed service component at the named code/address, not a site inspection or complete campus.",
            "The current property pages are undated. Review date is not a publication day, physical opening day or technical-capacity as-of date. Existing addresses were blank; no inherited point is upgraded by assumption."
          ],
          "sources": [
            {
              "url": "https://www.digitalrealty.com/data-centers/americas/phoenix/phx15",
              "host": "www.digitalrealty.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Current Digital Realty PHX15 property page"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "Digital Realty address and location review October 16",
          "scope": "Explicit provider-qualified address and location review. Street-range points and partial county reference areas are different methods; neither certifies a roof, owner, complete campus or distinct physical site.",
          "fields": {
            "published_coordinate_context": {
              "code": "PHX15",
              "operator_point": [
                -111.8869478,
                33.2748503
              ],
              "scope": "Publisher map metadata, not a surveyed roof, parcel boundary, title, technical-capacity or opening assertion."
            },
            "census_address_context": {
              "query_address": "2121 South Price Road Chandler, AZ 85286",
              "match_count": 1,
              "match": {
                "matchedAddress": "2121 S PRICE RD, CHANDLER, AZ, 85286",
                "coordinates": {
                  "x": -111.889083396547,
                  "y": 33.27455502094
                },
                "addressComponents": {
                  "zip": "85286",
                  "streetName": "PRICE",
                  "preType": "",
                  "city": "CHANDLER",
                  "preDirection": "S",
                  "suffixDirection": "",
                  "fromAddress": "2001",
                  "state": "AZ",
                  "suffixType": "RD",
                  "toAddress": "2299",
                  "suffixQualifier": "",
                  "preQualifier": ""
                },
                "tigerLine": {
                  "side": "L",
                  "tigerLineId": "611861795"
                }
              },
              "benchmark": "Public_AR_Current",
              "vintage": "Current_Current",
              "scope": "Calculated address-range point, not a building center, parcel, suite or actual operation verification."
            },
            "coordinate_comparison": {
              "operator_to_census_m": 201.2,
              "operator_to_inherited_m": 29.9,
              "scope": "Derived distance comparison only; proximity alone does not resolve provider or physical-site identity."
            },
            "location_hold": {
              "decision": "retain_approximate_pending_explicit_review",
              "reason": "The Census range is retained as a candidate; explicit parcel/building or coordinate-discrepancy review remains open. No automatic promotion from a successful address match."
            }
          },
          "notes": [
            "Current marketed-service stage, operator code, published address, all technical quantities and dated events remain unchanged.",
            "Publication dates are unknown. Retrieval dates, Census Current_Current naming, county tax year, edit timestamps and physical milestones are separate scopes."
          ],
          "sources": [
            {
              "url": "https://www.digitalrealty.com/data-centers/americas/phoenix/phx15",
              "host": "www.digitalrealty.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Current Digital Realty PHX15 property page"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2121+South+Price+Road+Chandler%2C+AZ+85286&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Published-address street-range query for Digital Realty PHX15"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "overnight-locations-2026-10-17",
          "scope": "Published-address and street-location review only. Existing stage, identity, quantities and legal jurisdiction remain separate; no physical-site census or parcel certification.",
          "fields": {
            "published_address_review": {
              "provider": "Digital Realty",
              "code": "PHX15",
              "published_address": "2121 South Price Road Chandler, AZ 85286",
              "visible_address_context": "PHX15\n2121 South Price Road Chandler, AZ 85286",
              "scope": "Named provider service/address context; current ownership, delivered whole-campus capacity and distinct physical-site identity are not certified."
            },
            "census_street_reference": {
              "query": {
                "address": {
                  "address": "2121 South Price Road Chandler, AZ 85286"
                },
                "vintage": {
                  "isDefault": true,
                  "id": "4",
                  "vintageName": "Current_Current",
                  "vintageDescription": "Current Vintage - Current Benchmark"
                },
                "benchmark": {
                  "isDefault": true,
                  "benchmarkDescription": "Public Address Ranges - Current Benchmark",
                  "id": "4",
                  "benchmarkName": "Public_AR_Current"
                }
              },
              "matches": [
                {
                  "tigerLine": {
                    "side": "L",
                    "tigerLineId": "611861795"
                  },
                  "coordinates": {
                    "x": -111.889083396547,
                    "y": 33.27455502094
                  },
                  "addressComponents": {
                    "zip": "85286",
                    "streetName": "PRICE",
                    "preType": "",
                    "city": "CHANDLER",
                    "preDirection": "S",
                    "suffixDirection": "",
                    "fromAddress": "2001",
                    "state": "AZ",
                    "suffixType": "RD",
                    "toAddress": "2299",
                    "suffixQualifier": "",
                    "preQualifier": ""
                  },
                  "matchedAddress": "2121 S PRICE RD, CHANDLER, AZ, 85286"
                }
              ],
              "method": "Interpolated Census street address range, not roof, parcel or proof a structure exists."
            },
            "operator_coordinate_context": {
              "point": [
                -111.8869478,
                33.2748503
              ],
              "operator_to_census_m": 201.2,
              "adopted": false,
              "scope": "Embedded operator map coordinates retained as a separate source claim; not independently certified building or parcel geometry."
            },
            "location_review_decision": {
              "decision": "adopt_census_street_address",
              "reason": "Individually reviewed provider-qualified code and visible address block match the Census house number, street, postal locality, state and ZIP context. Adopt the calculated street-address reference, not operator embedded coordinates, a roof or a surveyed parcel.",
              "prior_to_census_m": 231.0,
              "not_a_roof_or_parcel": true,
              "physical_site_count_eligible": false,
              "held_scope": "Specific location/address discrepancy, not inferred closure or absence of a facility."
            }
          },
          "notes": [
            "Individually reviewed provider-qualified code and visible address block match the Census house number, street, postal locality, state and ZIP context. Adopt the calculated street-address reference, not operator embedded coordinates, a roof or a surveyed parcel."
          ],
          "sources": [
            {
              "url": "https://www.digitalrealty.com/data-centers/americas/phoenix/phx15",
              "host": "www.digitalrealty.com",
              "published": "",
              "date": "",
              "checked": "2026-10-17",
              "label": "Current Digital Realty PHX15 named property and published address"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2121+South+Price+Road+Chandler%2C+AZ+85286&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-17",
              "label": "Census address-range response for PHX15"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-17",
              "label": "Census geocoder method: calculated address-range locations, not surveyed buildings"
            }
          ],
          "checked": "2026-10-17",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check48, October24,2026",
          "scope": "Digital Realty identifies the named PHX15 facility and its published service street in the main body of its own location page and advertises its own colocation space and facility services. Operator per source records the Digital Realty provider brand for that component only. Existing who value and its complete source wrapper remain exact. The service street is identity context only and does not newly admit a location, parcel or roof. Existing status, location, address, county, quantities, dates and component identity remain exact. Advertised area, density, redundancy, renewable percentages, certifications, resilience and market superlatives are not independently verified measurements, legal title or environmental outcomes. Carrier and cloud connections do not identify every tenant or connected property owner. Metropolitan market labels do not replace the stated service municipality. The source publication date is unknown.",
          "fields": {
            "company_association": {
              "name": "Digital Realty",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Digital Realty identifies the named PHX15 facility and its published service street in the main body of its own location page and advertises its own colocation space and facility services. Operator per source records the Digital Realty provider brand for that component only. Existing who value and its complete source wrapper remain exact. The service street is identity context only and does not newly admit a location, parcel or roof. Existing status, location, address, county, quantities, dates and component identity remain exact. Advertised area, density, redundancy, renewable percentages, certifications, resilience and market superlatives are not independently verified measurements, legal title or environmental outcomes. Carrier and cloud connections do not identify every tenant or connected property owner. Metropolitan market labels do not replace the stated service municipality. The source publication date is unknown."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Digital Realty identifies the named PHX15 facility and its published service street in the main body of its own location page and advertises its own colocation space and facility services. Operator per source records the Digital Realty provider brand for that component only. Existing who value and its complete source wrapper remain exact. The service street is identity context only and does not newly admit a location, parcel or roof. Existing status, location, address, county, quantities, dates and component identity remain exact. Advertised area, density, redundancy, renewable percentages, certifications, resilience and market superlatives are not independently verified measurements, legal title or environmental outcomes. Carrier and cloud connections do not identify every tenant or connected property owner. Metropolitan market labels do not replace the stated service municipality. The source publication date is unknown."
          ],
          "sources": [
            {
              "url": "https://www.digitalrealty.com/data-centers/americas/phoenix/phx15",
              "host": "www.digitalrealty.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address matched to a Census street range; not surveyed",
      "summary": "Chandler · Maricopa · Source context reviewed",
      "status_scope": "Digital Realty currently markets colocation and connectivity services under PHX15. This supports an operating service component in the existing research context, not complete campus delivery, full-building operation, legal ownership, present vacancy or a commissioned IT-load figure."
    },
    {
      "id": "edgecore-mesa-az",
      "state": "az",
      "kind": "facility",
      "name": "EdgeCore Mesa Data Center Campus",
      "group": "operating",
      "status": "Operating phase",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Hyperscale data center campus",
      "counties": [
        "Maricopa"
      ],
      "city": "Mesa",
      "address": "",
      "who": "EdgeCore Digital Infrastructure",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "Advertised five-building campus IT envelope; PH01 26 MW is a historical included component, not additional capacity. Current delivered, occupied and available shares are unknown. Technical as-of date is not published. No utility, backup-generation or metered-use figure is inferred.",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.. A quote combines constructing and commissioning 206 MW while the body says one building operates and two are being built. Do not call all 206 MW operating. The additional capacity lies inside the ultimate plan. Designed-to-earn labels are not completed certifications. Current original approvals, disclosures and later outcomes take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2025-07-24",
          "EdgeCore announced $235 million ABS financing backed by stabilized, leased PH01 (26 MW reported IT). This is a financing announcement, not a physical opening day, expenditure or incentive."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://azbigmedia.com/real-estate/edgecore-expands-mesa-data-center-campus-to-over-450-mw/",
          "host": "azbigmedia.com",
          "date": "2025-05-27",
          "published": "2025-05-27",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://edgecore.com/locations/phoenix-data-center",
          "host": "edgecore.com",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Reviewed operator campus page"
        },
        {
          "url": "https://edgecore.com/resources/press-releases/edgecore-digital-infrastructure-completes-235-million-abs-financing",
          "host": "edgecore.com",
          "published": "2025-07-24",
          "date": "2025-07-24",
          "checked": "2026-10-16",
          "label": "Dated operator announcement"
        },
        {
          "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=SUBNAME%3D%27EDGECORE+MESA+1%27&outFields=OBJECTID%2CAPN%2CAPN_DASH%2CFLOOR%2COWNER_NAME%2CPHYSICAL_ADDRESS%2CPHYSICAL_CITY%2CLONGITUDE%2CLATITUDE%2CLAND_SIZE%2CMCRNUM%2CSUBNAME%2CLOT_NUM%2CSTR%2CDEED_DATE%2CMCR_BOOK%2CMCR_PAGE&returnGeometry=true&outSR=4326&returnZ=false&returnM=false&orderByFields=APN&resultRecordCount=1000&f=json",
          "host": "gis.mcassessor.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "maricopa edgecore subdivision geometries"
        },
        {
          "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=SUBNAME%3D%27EDGECORE+MESA+1%27&returnIdsOnly=true&f=json",
          "host": "gis.mcassessor.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "maricopa edgecore subdivision ids"
        },
        {
          "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0?f=json",
          "host": "gis.mcassessor.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "maricopa parcel layer"
        },
        {
          "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer?f=json",
          "host": "gis.mcassessor.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "maricopa parcel service"
        },
        {
          "url": "https://mesa.legistar.com/View.ashx?GUID=2793FEDB-D8A6-49FF-B6D0-B9C25146A68A&ID=14253300&M=F",
          "host": "mesa.legistar.com",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "next mesa vicinity sub25 00294"
        },
        {
          "url": "https://mesa.legistar.com/View.ashx?G=6D482A9C-B912-4765-B79B-550C367FA729&GUID=428D264B-0B0C-414A-8C9F-DCD5EA9DB2FC&ID=1248172&M=M",
          "host": "mesa.legistar.com",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "next mesa minutes 20250616"
        },
        {
          "url": "https://mesa.legistar.com/View.ashx?GUID=CB3C8188-A445-4567-B4A4-FF446A05A849&ID=6329051&M=F",
          "host": "mesa.legistar.com",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "next mesa final plat 2018"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3856+S+Everton+Ter%2C+Mesa%2C+AZ+85212&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "census mesa everton"
        }
      ],
      "loc": {
        "lat": 33.3443,
        "lng": -111.62197,
        "precision": "approximate",
        "basis": "Approximate partial-campus reference centered on the cited county EdgeCore Mesa I subdivision polygons at the 3856 S Everton Terrace context, excluding the separately named substation parcel. Matches city plat context; not a roof, surveyed boundary, complete 84-acre campus or verified physical-site count.",
        "source_url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=SUBNAME%3D%27EDGECORE+MESA+1%27&outFields=OBJECTID%2CAPN%2CAPN_DASH%2CFLOOR%2COWNER_NAME%2CPHYSICAL_ADDRESS%2CPHYSICAL_CITY%2CLONGITUDE%2CLATITUDE%2CLAND_SIZE%2CMCRNUM%2CSUBNAME%2CLOT_NUM%2CSTR%2CDEED_DATE%2CMCR_BOOK%2CMCR_PAGE&returnGeometry=true&outSR=4326&returnZ=false&returnM=false&orderByFields=APN&resultRecordCount=1000&f=json"
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round26-2026-10-14.json",
          "scope": "Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.",
          "fields": {
            "reported_context": "AZ Big Media reproduces EdgeCore's Mesa land expansion and ultimate capacity plan above 450 MW.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "A quote combines constructing and commissioning 206 MW while the body says one building operates and two are being built. Do not call all 206 MW operating. The additional capacity lies inside the ultimate plan. Designed-to-earn labels are not completed certifications.",
            "Current original approvals, disclosures and later outcomes take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://azbigmedia.com/real-estate/edgecore-expands-mesa-data-center-campus-to-over-450-mw/",
              "host": "azbigmedia.com",
              "date": "2025-05-27",
              "published": "2025-05-27",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "edgecore-depth-2026-10-16",
          "scope": "Selected operator campus/phase and technical-envelope review; no whole-state refresh, exact location, legal ownership or physical-site count certification.",
          "fields": {
            "market_identity": "The Phoenix market page explicitly identifies the Mesa campus; this is the existing Mesa research record, not Florence/Dobson Farms or a new Phoenix site.",
            "campus_envelope": {
              "critical_it_mw": 496,
              "building_count_claim": 5,
              "gross_square_feet_claim": 2700000,
              "acres_claim": 84
            },
            "ph01_historical_context": {
              "announcement_date": "2025-07-24",
              "reported_it_capacity_mw": 26,
              "reported_state": "fully stabilized and fully leased to one unnamed hyperscale tenant",
              "finance_usd": 235000000,
              "scope": "ABS financing, not project expenditure, incentive, current debt balance or a physical opening day. PH01 capacity is inside, never additional to, the campus envelope."
            },
            "water_scope": "Below .01 L/kWh is an operator industry-benchmark WUE claim, with no measured consumption series or verified technical period.",
            "identity_review_scope": "Existing named campus matched by brand and published locality/context only. No precise address, title, physical-site census or point correction is adopted."
          },
          "notes": [
            "Campus figures overlap with their components and older plans. Do not sum them or call them available, energized, approved or metered power.",
            "Published/review dates and forecasts are not accomplished construction or opening dates. Existing coordinates and location precision remain unverified and unchanged."
          ],
          "sources": [
            {
              "url": "https://edgecore.com/locations/phoenix-data-center",
              "host": "edgecore.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Reviewed operator campus page"
            },
            {
              "url": "https://edgecore.com/resources/press-releases/edgecore-digital-infrastructure-completes-235-million-abs-financing",
              "host": "edgecore.com",
              "published": "2025-07-24",
              "date": "2025-07-24",
              "checked": "2026-10-16",
              "label": "Dated operator announcement"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "edgecore-location-2026-10-16",
          "scope": "Explicit partial-campus reference-area correction only, with source-address search context. No status, quantity, current title, legal jurisdiction, full campus footprint, admission or exact pin upgrade.",
          "fields": {
            "location_review_decision": "Replace the inherited residential-area center with a cited partial EdgeCore Mesa I subdivision reference area. Existing operating-phase, capacity, address, jurisdiction and identity fields remain unchanged. The new point is approximate, not a roof or legal survey.",
            "county_reference_parcel_context": {
              "selected_apns": [
                "30431955",
                "30431956",
                "30431957",
                "30431959"
              ],
              "named_unit_contexts": [
                "30431955",
                "30431956",
                "30431957"
              ],
              "reference_remainder_apn": "30431959",
              "remainder_owner_field_blank": true,
              "subdivision": "EDGECORE MESA 1",
              "mcr_reference": "1868-47",
              "section": "15 1S 7E",
              "published_reference_address": "3856 S Everton Ter, Mesa, AZ 85212",
              "scope": "Four reference polygon parts, including a remainder polygon whose owner/address fields are blank. The association is inferred from the named subdivision, geometry, legal section and city map, not company-name matching or a title certification. Named parcels are not three independently verified physical buildings."
            },
            "separate_substation_reference": {
              "excluded_apn": "30431958",
              "listed_owner": "MECP1 MESA SUBSTATION 1 LLC",
              "scope": "Separate substation reference is excluded from the selected display center. Its name does not establish generation, utility allocation, energized capacity or a verified legal owner of the wider campus."
            },
            "county_area_field_limits": "The remainder record has a 1,740,000 LAND_SIZE field despite its geometry having exclusions. Do not sum land-size fields, use them as centroid weights, assign a verified acreage unit, or equate the selected reference with the current 84-acre operator campus.",
            "city_plat_reference_scope": {
              "case": "SUB25-00294",
              "project": "Edgecore Mesa I, A Condominium Plat",
              "stated_acres": "39.9 plus or minus",
              "location_context": "Approximately 1600 feet south of the southwest Elliot Road / South Everton Terrace corner.",
              "city_minutes_observed_action_date": "2025-06-16",
              "scope": "Complete minutes pages 1 and 9 show the starred final-plat item within a six-aye consent action; the one-page vicinity map was visually reviewed in full. This is a particular plat context, not verified later recording, effective legal boundaries, full-campus permission, building occupancy or an opening day."
            },
            "historical_plat_scope": "The three-page Eastmark DU5 parcels 5-1/5-2 map identifies MECP1 Mesa 1 LLC c/o EdgeCore and Section 15, Township 1 South, Range 7 East. It shows 51.803 acres and a March 29, 2018 map date, with blank approval/acknowledgment areas. This is historical map/identity context, not proof of final recording, current title, complete campus boundaries or an accomplished building milestone.",
            "census_reference_address_scope": {
              "query_address": "3856 S Everton Ter, Mesa, AZ 85212",
              "matched_address": "3856 S EVERTON TER, MESA, AZ, 85212",
              "street_range_coordinates": [
                -111.618515808457,
                33.34734629926
              ],
              "tiger_line_id": "658410345",
              "distance_to_reference_center_m": 466.6,
              "inside_selected_reference": false,
              "scope": "One Census interpolated street-range match, outside the selected county reference polygons. It corroborates postal street context only and is not selected as a parcel or roof point."
            },
            "location_limits": "The selected subdivision reference is a partial marketed campus context, not a complete current 84-acre/five-building footprint. No title, legal municipality, precise parcel pin, PH01 roof, current imagery date, construction completion, energized capacity or operating phase is inferred from the geometry or aerial view."
          },
          "notes": [
            "The inherited center is retained as a sourced prior location alternative. The replacement is a display inference from primary city/county context, not a surveyed point.",
            "Three named unit contexts, an owner-blank remainder, and a separately named substation are different source units. No building/site count, ownership aggregation, measured power or acreage sum is inferred.",
            "The Census street point is outside the selected reference. Published/retrieval, map and meeting dates are separate scopes; imagery date and current construction extent are unknown."
          ],
          "sources": [
            {
              "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=SUBNAME%3D%27EDGECORE+MESA+1%27&outFields=OBJECTID%2CAPN%2CAPN_DASH%2CFLOOR%2COWNER_NAME%2CPHYSICAL_ADDRESS%2CPHYSICAL_CITY%2CLONGITUDE%2CLATITUDE%2CLAND_SIZE%2CMCRNUM%2CSUBNAME%2CLOT_NUM%2CSTR%2CDEED_DATE%2CMCR_BOOK%2CMCR_PAGE&returnGeometry=true&outSR=4326&returnZ=false&returnM=false&orderByFields=APN&resultRecordCount=1000&f=json",
              "host": "gis.mcassessor.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "maricopa edgecore subdivision geometries"
            },
            {
              "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=SUBNAME%3D%27EDGECORE+MESA+1%27&returnIdsOnly=true&f=json",
              "host": "gis.mcassessor.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "maricopa edgecore subdivision ids"
            },
            {
              "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0?f=json",
              "host": "gis.mcassessor.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "maricopa parcel layer"
            },
            {
              "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer?f=json",
              "host": "gis.mcassessor.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "maricopa parcel service"
            },
            {
              "url": "https://mesa.legistar.com/View.ashx?GUID=2793FEDB-D8A6-49FF-B6D0-B9C25146A68A&ID=14253300&M=F",
              "host": "mesa.legistar.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "next mesa vicinity sub25 00294"
            },
            {
              "url": "https://mesa.legistar.com/View.ashx?G=6D482A9C-B912-4765-B79B-550C367FA729&GUID=428D264B-0B0C-414A-8C9F-DCD5EA9DB2FC&ID=1248172&M=M",
              "host": "mesa.legistar.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "next mesa minutes 20250616"
            },
            {
              "url": "https://mesa.legistar.com/View.ashx?GUID=CB3C8188-A445-4567-B4A4-FF446A05A849&ID=6329051&M=F",
              "host": "mesa.legistar.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "next mesa final plat 2018"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3856+S+Everton+Ter%2C+Mesa%2C+AZ+85212&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "census mesa everton"
            },
            {
              "url": "https://edgecore.com/locations/phoenix-data-center",
              "host": "edgecore.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "edgecore phoenix current"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 20, October 23, 2026",
          "scope": "EdgeCore Digital Infrastructure explicitly describes this named campus or component on its own website. The attributed provider brand relationship is not a finding of the legal operator or owner, independent safety verification, surveyed title or completed construction. No status, location, address, physical milestone, quantity, water use, air permit, measured harm, incentive or tenant identity is promoted. The Phoenix page explicitly names Mesa and says EdgeCore builds and operates its facilities. Five marketed campus buildings and full capacity are not certified as delivered. Marketed water effectiveness and sustainability claims remain attributed claims rather than independent findings.",
          "fields": {
            "company_association": {
              "name": "EdgeCore Digital Infrastructure",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "EdgeCore Digital Infrastructure explicitly describes this named campus or component on its own website. The attributed provider brand relationship is not a finding of the legal operator or owner, independent safety verification, surveyed title or completed construction. No status, location, address, physical milestone, quantity, water use, air permit, measured harm, incentive or tenant identity is promoted. The Phoenix page explicitly names Mesa and says EdgeCore builds and operates its facilities. Five marketed campus buildings and full capacity are not certified as delivered. Marketed water effectiveness and sustainability claims remain attributed claims rather than independent findings."
            },
            "provider_role": "operator"
          },
          "notes": [
            "EdgeCore Digital Infrastructure explicitly describes this named campus or component on its own website. The attributed provider brand relationship is not a finding of the legal operator or owner, independent safety verification, surveyed title or completed construction. No status, location, address, physical milestone, quantity, water use, air permit, measured harm, incentive or tenant identity is promoted. The Phoenix page explicitly names Mesa and says EdgeCore builds and operates its facilities. Five marketed campus buildings and full capacity are not certified as delivered. Marketed water effectiveness and sustainability claims remain attributed claims rather than independent findings.",
            "First publication dates are not established. Current retrieval and advertised build out are not physical milestones."
          ],
          "sources": [
            {
              "url": "https://edgecore.com/locations/phoenix-data-center",
              "host": "edgecore.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party explicitly named campus, scoped provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Approximate partial-campus reference, not the exact parcel",
      "summary": "Mesa · Maricopa · Source context reviewed",
      "status_scope": "Current operator describes operating its Mesa data centers; the July 24, 2025 release identifies stabilized, leased PH01. This supports an operating phase only. Delivery, occupancy and energized share of all five marketed buildings and the 496 MW envelope are not established.",
      "event_evidence": [
        {
          "date": "2025-07-24",
          "text": "EdgeCore announced $235 million ABS financing backed by stabilized, leased PH01 (26 MW reported IT). This is a financing announcement, not a physical opening day, expenditure or incentive.",
          "kind": "announced",
          "sources": [
            {
              "url": "https://edgecore.com/resources/press-releases/edgecore-digital-infrastructure-completes-235-million-abs-financing",
              "host": "edgecore.com",
              "published": "2025-07-24",
              "date": "2025-07-24",
              "checked": "2026-10-16",
              "label": "Dated operator announcement"
            }
          ]
        }
      ],
      "typed_power_facts": [
        {
          "measure": "it_capacity",
          "value": 496,
          "unit": "MW",
          "as_of": null,
          "basis": "operator_reported_capacity",
          "scope": "Advertised five-building campus IT envelope; PH01 26 MW is a historical included component, not additional capacity. Current delivered, occupied and available shares are unknown.",
          "observed_on": "2026-10-16",
          "as_of_basis": "not_published",
          "sources": [
            "https://edgecore.com/locations/phoenix-data-center"
          ]
        }
      ],
      "search_extra": "3856 S Everton Ter; 3856 South Everton Terrace; EdgeCore Mesa I; SUB25-00294; MCR 1868-47; county partial-subdivision reference, not a verified operator postal address."
    },
    {
      "id": "edged-mesa-az",
      "state": "az",
      "kind": "facility",
      "name": "Edged Mesa Data Center",
      "group": "operating",
      "status": "Operator-announced opening",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Mesa",
      "address": "",
      "who": "Edged",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. ReleaseApril2saysunveiledyesterday.138Mgallonsforecastwatersavingsnotmeasuredconsumption. Phoenixmarketlabelnotcity; mayorzero-waterquotenotproofnopotable/domesticuse. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://edged.us/news/edged-us-opens-waterless-ai-ready-data-center-in-the-heart-of-arizonas-silicon-desert-tech-corridor",
          "host": "edged.us",
          "date": "2026-04-02",
          "published": "2026-04-02",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://edged.us/phoenix",
          "host": "edged.us",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "First party named campus and scoped operator relationship"
        }
      ],
      "loc": {
        "lat": 33.42393,
        "lng": -112.28645,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "opening_event_date": "2026-04-01",
            "published_city": "Mesa, Arizona",
            "critical_capacity_mw": 36
          },
          "notes": [
            "ReleaseApril2saysunveiledyesterday.138Mgallonsforecastwatersavingsnotmeasuredconsumption. Phoenixmarketlabelnotcity; mayorzero-waterquotenotproofnopotable/domesticuse.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://edged.us/news/edged-us-opens-waterless-ai-ready-data-center-in-the-heart-of-arizonas-silicon-desert-tech-corridor",
              "host": "edged.us",
              "date": "2026-04-02",
              "published": "2026-04-02",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "Edged announced the opening of its named Mesa facility in an April 2, 2026 release describing the previous day as the unveiling. The opening is operator-reported; advertised load, water savings, measured use and every hall being energized are not independently certified. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_announced_opening",
              "scope": "Edged announced the opening of its named Mesa facility in an April 2, 2026 release describing the previous day as the unveiling. The opening is operator-reported; advertised load, water savings, measured use and every hall being energized are not independently certified. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
              "reported_stage_date": {
                "date": "2026-04-01",
                "basis": "operator_reported_opening",
                "status_label": "Operator-announced opening",
                "source_scope": "April 2 release explicitly describes the unveiling as yesterday; independent commissioning and all halls are not certified."
              }
            }
          },
          "notes": [
            "Edged announced the opening of its named Mesa facility in an April 2, 2026 release describing the previous day as the unveiling. The opening is operator-reported; advertised load, water savings, measured use and every hall being energized are not independently certified."
          ],
          "sources": [
            {
              "url": "https://edged.us/news/edged-us-opens-waterless-ai-ready-data-center-in-the-heart-of-arizonas-silicon-desert-tech-corridor",
              "host": "edged.us",
              "published": "2026-04-02",
              "date": "2026-04-02",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check25, October23,2026",
          "scope": "Edged presents this named facility or retained campus on its own website. The relationship is the attributed provider brand only, not legal property ownership or the identity of a legal operating entity. No status, location, street address, quantity, cooling consumption, emissions, permit, certification, tenant identity or completion date is changed. Marketing design and efficiency statements are not measured findings. Retrieval does not establish an opening date. The provider markets Phoenix and explicitly names Mesa. Its current address wording differs from the earlier record source and remains a separate location research lead. The availability quarter is not an opening or closure finding.",
          "fields": {
            "company_association": {
              "name": "Edged",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Edged presents this named facility or retained campus on its own website. The relationship is the attributed provider brand only, not legal property ownership or the identity of a legal operating entity. No status, location, street address, quantity, cooling consumption, emissions, permit, certification, tenant identity or completion date is changed. Marketing design and efficiency statements are not measured findings. Retrieval does not establish an opening date. The provider markets Phoenix and explicitly names Mesa. Its current address wording differs from the earlier record source and remains a separate location research lead. The availability quarter is not an opening or closure finding."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Edged presents this named facility or retained campus on its own website. The relationship is the attributed provider brand only, not legal property ownership or the identity of a legal operating entity. No status, location, street address, quantity, cooling consumption, emissions, permit, certification, tenant identity or completion date is changed. Marketing design and efficiency statements are not measured findings. Retrieval does not establish an opening date. The provider markets Phoenix and explicitly names Mesa. Its current address wording differs from the earlier record source and remains a separate location research lead. The availability quarter is not an opening or closure finding."
          ],
          "sources": [
            {
              "url": "https://edged.us/phoenix",
              "host": "edged.us",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party named campus and scoped operator relationship"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Mesa · Maricopa · Source context reviewed",
      "status_scope": "Edged announced the opening of its named Mesa facility in an April 2, 2026 release describing the previous day as the unveiling. The opening is operator-reported; advertised load, water savings, measured use and every hall being energized are not independently certified. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "flexential-phoenix-deer-valley-az",
      "state": "az",
      "kind": "facility",
      "name": "Flexential Phoenix - Deer Valley",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Phoenix",
      "address": "",
      "who": "Flexential",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.. Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396",
          "host": "flexential.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf",
          "host": "www.flexential.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Original issued certificate computing location table, historical street context only"
        },
        {
          "url": "https://www.flexential.com/system/files/file/2020-03/2019-type-2-SOC-3-final-report.pdf",
          "host": "www.flexential.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Original named computing facility list, historical location context only"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1850+W+Deer+Valley+Road%2C+Phoenix%2C+Arizona+85027&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Complete unique literal published street range, raw version retained"
        },
        {
          "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-112.10523757087147%2C33.67897028853755%2C-112.09336242912853%2C33.688851711462455&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
          "host": "imagery.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Actually viewed source setting, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -112.0993,
        "lat": 33.683911,
        "precision": "address",
        "basis": "Operator facility documents identify 1850 W Deer Valley Road, Phoenix, Arizona 85027. One complete unique Census street range supports this calculated reference inside Maricopa County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round14-2026-10-14.json",
          "scope": "Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.",
          "fields": {
            "operator_named_facility": "Flexential Phoenix - Deer Valley",
            "publisher_reported_footprint_sqft": 109476,
            "publisher_reported_critical_power_mw": 5.02,
            "power_basis": "operator critical load UPS capacity; Douglasville sections call it critical power",
            "current_measured_demand_mw": null,
            "commissioning_date": null,
            "exact_address_verified_by_this_document": false
          },
          "notes": [
            "Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396",
              "host": "flexential.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 64, 2026-10-24",
          "scope": "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -112.0993,
                "lat": 33.683911,
                "precision": "address",
                "basis": "Operator facility documents identify 1850 W Deer Valley Road, Phoenix, Arizona 85027. One complete unique Census street range supports this calculated reference inside Maricopa County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "1850 W Deer Valley Road, Phoenix, Arizona 85027",
              "county_fips": [
                "04013"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.",
            "The inherited general area coordinate was not an independently reviewed computing street reference. The original operator published computing location documents and complete unique literal Census street evidence support this bounded reference inside the retained county. The measured correction is 123.1 metres. All original source wordings, dates, predecessor coordinates and versions remain retained. Existing status group unknown and every other fact stay unchanged. This is a reference correction without physical relocation, a new operation, selected roof, tenant floor, legal title or complete campus certification.",
            "Industrial and commercial blocks lie around a road crossing, with an airport runway toward the northeast. Separate roofs and parking areas are visible. No roof coordinate, computing activity or property boundary is selected."
          ],
          "sources": [
            {
              "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf",
              "host": "www.flexential.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Original issued certificate computing location table, historical street context only"
            },
            {
              "url": "https://www.flexential.com/system/files/file/2020-03/2019-type-2-SOC-3-final-report.pdf",
              "host": "www.flexential.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Original named computing facility list, historical location context only"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1850+W+Deer+Valley+Road%2C+Phoenix%2C+Arizona+85027&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Complete unique literal published street range, raw version retained"
            },
            {
              "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-112.10523757087147%2C33.67897028853755%2C-112.09336242912853%2C33.688851711462455&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
              "host": "imagery.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Actually viewed source setting, acquisition date unknown"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check63, October24,2026",
          "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 9 and 10. The Phoenix Deer Valley profile identifies Flexential colocation and connectivity services at this retained named location. Its photograph is identity context and is not a selected roof, parcel or surveyed boundary. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted.",
          "fields": {
            "company_association": {
              "name": "Flexential",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 9 and 10. The Phoenix Deer Valley profile identifies Flexential colocation and connectivity services at this retained named location. Its photograph is identity context and is not a selected roof, parcel or surveyed boundary. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Flexential identifies the named location in the original fleet guide, PDF pages 9 and 10. The Phoenix Deer Valley profile identifies Flexential colocation and connectivity services at this retained named location. Its photograph is identity context and is not a selected roof, parcel or surveyed boundary. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted."
          ],
          "sources": [
            {
              "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396",
              "host": "www.flexential.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Calculated street reference, not a roof or tenant floor",
      "summary": "Phoenix · Maricopa · Source context reviewed"
    },
    {
      "id": "google-redhawk-mesa-az",
      "state": "az",
      "kind": "facility",
      "name": "Google Redhawk Mesa Data Center Campus",
      "group": "operating",
      "status": "Operating phase",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Mesa",
      "address": "",
      "who": "Google",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "Annual 2025 operator-reported water totals; planned air cooling does not establish zero water use.",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Mesa RedHawk unexecuted city-signature development draft. Boilerplateexecutedlanguageanddatedfilenamecannotoverrideblankexecutionfields. Recitalownershipnotindependentrecordeddeedproof. No numericITMW,currentGoogletenant/parceloroperatingstatusestablishedbyreviewedsections. Otherlease/deedtemplatesin99pagepacketnotexecutedsalesorincentives. Proposedwater/leaseprivilegesnotcurrentapprovedbenefitsfromthiscopy. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Google 2026 quarterly performance table; named regional campus scope. Operator-reported period metrics, not an October operating inspection, current MW load or building-specific measurement. Regional values are not assigned to a separate expansion or street-address record. Blank TTM remains unknown. No status, location precision or whole-campus completion upgrade; publication date unknown.",
      "date": "",
      "events": [
        [
          "2024-03-14",
          "Google announced an Arizona grid-energy agreement and described planned Mesa air cooling. The announcement is not a proved opening day or 430 MW of site IT capacity."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://legistar1.granicus.com/Mesa/attachments/e2e1b966-a066-4ba7-b9a6-ec11167a332d.pdf",
          "host": "legistar1.granicus.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://datacenters.google/efficiency/",
          "host": "datacenters.google",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.datacenters.google/efficiency/",
          "host": "www.datacenters.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Google efficiency tables: 2026 Q2, not the first table"
        },
        {
          "url": "https://sustainability.google/files/google-2026-environmental-report.pdf",
          "host": "sustainability.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Google 2026 Environmental Report"
        },
        {
          "url": "https://blog.google/company-news/outreach-and-initiatives/sustainability/google-carbon-free-data-center-arizona-/",
          "host": "blog.google",
          "published": "2024-03-14",
          "date": "2024-03-14",
          "checked": "2026-10-16",
          "label": "Mesa cooling design and grid-energy announcement"
        },
        {
          "url": "https://www.datacenters.google/locations/",
          "host": "www.datacenters.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Current Google location directory; flags are not status proof"
        }
      ],
      "loc": {
        "lat": 33.43739,
        "lng": -112.70536,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "public-institution-review-round11-2026-10-14.json",
          "scope": "Mesa RedHawk unexecuted city-signature development draft",
          "fields": {
            "document": "City of Mesa and Stone Applications LLC development agreement",
            "county": "Maricopa, Arizona",
            "recital_property_acres_approx": 186,
            "property_use": "proposed data/information processing center",
            "document_year_template": 2019,
            "city_signature_and_notary_fields": "blank on PDFpage35",
            "execution_proven": false,
            "effective_date": null
          },
          "notes": [
            "Boilerplateexecutedlanguageanddatedfilenamecannotoverrideblankexecutionfields. Recitalownershipnotindependentrecordeddeedproof. No numericITMW,currentGoogletenant/parceloroperatingstatusestablishedbyreviewedsections. Otherlease/deedtemplatesin99pagepacketnotexecutedsalesorincentives. Proposedwater/leaseprivilegesnotcurrentapprovedbenefitsfromthiscopy.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://legistar1.granicus.com/Mesa/attachments/e2e1b966-a066-4ba7-b9a6-ec11167a332d.pdf",
              "host": "legistar1.granicus.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Atlas targeted primary-source follow-up",
          "scope": "Google 2026 quarterly performance table; named regional campus scope",
          "fields": {
            "operator_reported_pue_period": "2026-Q2",
            "operator_reported_campus_pue": [
              {
                "source_campus_label": "Mesa, Arizona",
                "quarterly_pue": 1.28,
                "trailing_twelve_month_pue": null
              }
            ]
          },
          "notes": [
            "Operator-reported period metrics, not an October operating inspection, current MW load or building-specific measurement. Regional values are not assigned to a separate expansion or street-address record. Blank TTM remains unknown. No status, location precision or whole-campus completion upgrade; publication date unknown."
          ],
          "sources": [
            {
              "url": "https://datacenters.google/efficiency/",
              "host": "datacenters.google",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "checked": "2026-10-15",
          "capture_sha256": "398f42d55ca9e2ebecd3b24e2dede307ad2d9d3b653469d1efebd135488f9c17",
          "events": [],
          "whole_record_certified": false
        },
        {
          "overlay": "Google pending-location follow-up October 16",
          "scope": "Explicit existing-record identity, source confidence and phase review. No new physical site, parcel, whole-campus completion, whole-state refresh or automatic directory-flag status.",
          "fields": {
            "identity_scope": "Google identifies its first Arizona data center in Mesa; the existing Google Redhawk Mesa record is retained as the regional research context. The inherited Redhawk/Stone Applications parcel association is not independently certified. No Phoenix reporting row or separate leased presence is merged.",
            "pue_reporting": {
              "period": "2026-Q2",
              "source_campus_label": "Mesa, Arizona",
              "quarterly_pue": 1.28,
              "trailing_twelve_month_pue": null,
              "scope": "Operator-reported efficiency ratio at a named campus, not MW, MWh, a building count or full-campus commissioning. Q1 1.22 is a different period. No published 2026 Q3 table was found."
            },
            "current_phase_basis": "An operating component at the named Mesa campus is supported by Google's 2026 Q2 PUE and annual 2025 operational water reporting, alongside its named first Mesa campus announcement. No opening day, exact parcel, full campus completion, present IT load or present water rate is established.",
            "annual_water_reporting": {
              "source_location": "Mesa, AZ",
              "report_year": 2026,
              "reporting_year": 2025,
              "source_page": 97,
              "unit": "Million gallons",
              "withdrawal": 19.4,
              "discharge": 9.7,
              "consumption": 9.7
            },
            "water_method_scope": "Annual 2025 operator-reported totals from report p.97, with method pp.82/87/116. Metered/invoiced data can be supplemented by estimates; row-specific metering completeness is not given. Rounded consumption is withdrawal minus discharge. No daily rate, permit limit, zero use or Phoenix allocation is inferred.",
            "cooling_design_scope": "The March 14, 2024 company announcement describes air-cooled technology planned for Mesa. This is a design statement, not an independent current mechanical inspection or zero water consumption.",
            "grid_energy_scope": "The more-than-430 MW agreement describes new grid resources from three NextEra facilities, not Mesa IT load or campus utility-service authorization. The 80% hourly carbon-free target for 2026 is not an achieved result.",
            "date_scope": "The March 2024 statement gives 2023 construction and a 2025 operational target. The target is not converted into an opening date. Current PUE technical period is Q2, not Q1 or an invented Q3."
          },
          "notes": [
            "Keep each source type, date and confidence visible. Reported activity is not a site inspection, legal permission, complete campus or current metered demand.",
            "All inherited geometry, addresses, jurisdictions, legacy MW, investment, jobs and opening fields remain unchanged."
          ],
          "sources": [
            {
              "url": "https://www.datacenters.google/efficiency/",
              "host": "www.datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Google efficiency tables: 2026 Q2, not the first table"
            },
            {
              "url": "https://sustainability.google/files/google-2026-environmental-report.pdf",
              "host": "sustainability.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Google 2026 Environmental Report"
            },
            {
              "url": "https://blog.google/company-news/outreach-and-initiatives/sustainability/google-carbon-free-data-center-arizona-/",
              "host": "blog.google",
              "published": "2024-03-14",
              "date": "2024-03-14",
              "checked": "2026-10-16",
              "label": "Mesa cooling design and grid-energy announcement"
            },
            {
              "url": "https://www.datacenters.google/locations/",
              "host": "www.datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Current Google location directory; flags are not status proof"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Mesa · Maricopa · Source context reviewed",
      "status_scope": "An operating component at the named Mesa campus is supported by Google's 2026 Q2 PUE and annual 2025 operational water reporting, alongside its named first Mesa campus announcement. No opening day, exact parcel, full campus completion, present IT load or present water rate is established.",
      "event_evidence": [
        {
          "date": "2024-03-14",
          "text": "Google announced an Arizona grid-energy agreement and described planned Mesa air cooling. The announcement is not a proved opening day or 430 MW of site IT capacity.",
          "kind": "announced",
          "sources": [
            {
              "url": "https://blog.google/company-news/outreach-and-initiatives/sustainability/google-carbon-free-data-center-arizona-/",
              "host": "blog.google",
              "published": "2024-03-14",
              "date": "2024-03-14",
              "checked": "2026-10-16",
              "label": "Mesa cooling design and grid-energy announcement"
            }
          ]
        }
      ],
      "typed_water_facts": [
        {
          "measure": "withdrawal",
          "value": 19.4,
          "unit": "million gallons",
          "as_of": null,
          "as_of_basis": "reporting_period",
          "reporting_period": {
            "label": "2025",
            "start": "2025-01-01",
            "end": "2025-12-31"
          },
          "observed_on": "2026-10-16",
          "basis": "operator_reported_total",
          "scope": "Google 2026 Environmental Report p.97: Mesa, AZ, annual 2025 withdrawal. Rounded operator-reported total; methodology permits estimates. Not current/daily use, a permit limit or a per-building/Phoenix allocation. Consumption is withdrawal minus discharge.",
          "sources": [
            "https://sustainability.google/files/google-2026-environmental-report.pdf"
          ]
        },
        {
          "measure": "discharge",
          "value": 9.7,
          "unit": "million gallons",
          "as_of": null,
          "as_of_basis": "reporting_period",
          "reporting_period": {
            "label": "2025",
            "start": "2025-01-01",
            "end": "2025-12-31"
          },
          "observed_on": "2026-10-16",
          "basis": "operator_reported_total",
          "scope": "Google 2026 Environmental Report p.97: Mesa, AZ, annual 2025 discharge. Rounded operator-reported total; methodology permits estimates. Not current/daily use, a permit limit or a per-building/Phoenix allocation. Consumption is withdrawal minus discharge.",
          "sources": [
            "https://sustainability.google/files/google-2026-environmental-report.pdf"
          ]
        },
        {
          "measure": "consumption",
          "value": 9.7,
          "unit": "million gallons",
          "as_of": null,
          "as_of_basis": "reporting_period",
          "reporting_period": {
            "label": "2025",
            "start": "2025-01-01",
            "end": "2025-12-31"
          },
          "observed_on": "2026-10-16",
          "basis": "operator_reported_total",
          "scope": "Google 2026 Environmental Report p.97: Mesa, AZ, annual 2025 consumption. Rounded operator-reported total; methodology permits estimates. Not current/daily use, a permit limit or a per-building/Phoenix allocation. Consumption is withdrawal minus discharge.",
          "sources": [
            "https://sustainability.google/files/google-2026-environmental-report.pdf"
          ]
        },
        {
          "measure": "cooling_type",
          "value": "Air-cooled technology planned in the March 2024 Mesa announcement.",
          "unit": null,
          "as_of": "2024-03-14",
          "as_of_basis": "source_dated",
          "observed_on": "2026-10-16",
          "basis": "operator_reported_statement",
          "scope": "Historical operator design statement, not a current equipment inspection, measured water use or a zero-consumption claim.",
          "sources": [
            "https://blog.google/company-news/outreach-and-initiatives/sustainability/google-carbon-free-data-center-arizona-/"
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "grandilla-foot-creek-491st-thomas-tonopah-az",
      "state": "az",
      "kind": "facility",
      "name": "491st Avenue and Thomas Road Data Center / Solar Site",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Tonopah",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. The report explicitly says no formal data-center development plan. Rezoning and conceptual switchyard/solar/storage uses are not construction, tenant, electrical-service or IT-capacity confirmation. Lack of opposition in submitted materials is not universal public support. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://azbex.com/planning-development/maricopa-county-board-approves-rezoning-for-638-acre-data-center-solar-site/",
          "host": "azbex.com",
          "date": "2026-02-18",
          "published": "2026-02-18",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10131?fileID=99202",
          "host": "www.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Original named computing or mixed use filing with explicit source parcel identifier"
        },
        {
          "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=APN_DASH+IN+%28%27506-30-021A%27%2C%27506-30-024A%27%29&outFields=OBJECTID%2CAPN%2CAPN_DASH%2CPHYSICAL_ADDRESS%2CPHYSICAL_CITY%2CPHYSICAL_ZIP%2CLAND_SIZE%2CSTR&returnGeometry=true&outSR=4326&f=json",
          "host": "gis.mcassessor.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Exact complete official parcel query, calculated center only"
        },
        {
          "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-113.10731374680057%2C33.47782928853755%2C-113.09546625319942%2C33.487710711462455&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
          "host": "imagery.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Actually viewed setting, imagery acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -113.10139,
        "lat": 33.48277,
        "precision": "approximate",
        "basis": "Approximate calculated center of official source parcel 506-30-024A independently joined to the original named computing or mixed use planning filing. One complete source parcel 024A within the named two parcel filing. Parcel 021A includes an expressly excluded approximately 2.12 acre residential portion; that parcel and its cutout are not selected, unioned or reconstructed. Parcel center and boundary are source references only, with no certified roof, tenant, complete campus or whole parcel computing use. Every original role, status, quantity and date remains unchanged. Imagery acquisition date is unknown and may predate construction."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round27-2026-10-14.json",
          "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.",
          "fields": {
            "reported_context": "AZBEX reports rezoning of about 638 acres owned by Grandilla and Foot Creek near 491st Avenue and Thomas Road in the Tonopah area, with a conceptual nine-building, 2.25-million-square-foot data-center layout.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "The report explicitly says no formal data-center development plan. Rezoning and conceptual switchyard/solar/storage uses are not construction, tenant, electrical-service or IT-capacity confirmation. Lack of opposition in submitted materials is not universal public support.",
            "Original approvals and later observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://azbex.com/planning-development/maricopa-county-board-approves-rezoning-for-638-acre-data-center-solar-site/",
              "host": "azbex.com",
              "date": "2026-02-18",
              "published": "2026-02-18",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 70, 2026-10-24",
          "scope": "One complete source parcel 024A within the named two parcel filing. Parcel 021A includes an expressly excluded approximately 2.12 acre residential portion; that parcel and its cutout are not selected, unioned or reconstructed. All original source dates, group, status, quantities, jurisdiction and prior coordinates remain exact in history. Approximate source reference only.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -113.10139,
                "lat": 33.48277,
                "precision": "approximate",
                "basis": "Approximate calculated center of official source parcel 506-30-024A independently joined to the original named computing or mixed use planning filing. One complete source parcel 024A within the named two parcel filing. Parcel 021A includes an expressly excluded approximately 2.12 acre residential portion; that parcel and its cutout are not selected, unioned or reconstructed. Parcel center and boundary are source references only, with no certified roof, tenant, complete campus or whole parcel computing use. Every original role, status, quantity and date remains unchanged. Imagery acquisition date is unknown and may predate construction."
              },
              "reference_method": "Approximate county reference parcel center",
              "reference_parcel": "506-30-024A",
              "operator_coordinates_adopted": false,
              "census_range_adopted": false
            }
          },
          "notes": [
            "One complete source parcel 024A within the named two parcel filing. Parcel 021A includes an expressly excluded approximately 2.12 acre residential portion; that parcel and its cutout are not selected, unioned or reconstructed. All original source dates, group, status, quantities, jurisdiction and prior coordinates remain exact in history. Approximate source reference only.",
            "The inherited general area coordinate was not independently admitted as a reviewed computing source reference. The original official named planning filing independently identifies source parcel 506-30-024A. The exact complete official parcel query returns the full source geometry; no owner mail, hearing venue, applicant office or neighboring parcel is selected. One complete source parcel 024A within the named two parcel filing. Parcel 021A includes an expressly excluded approximately 2.12 acre residential portion; that parcel and its cutout are not selected, unioned or reconstructed. The unchanged calculated center and every source vertex are inside the unchanged county 04013. The measured correction is 3030.8 metres. Source setting pixels supply no coordinates, construction status, completed computing use, legal title or complete campus.",
            "The setting shows agricultural field rectangles, desert patches and roads. No residence cutout is reconstructed and no computing roof or present construction stage is selected. Acquisition date is unknown."
          ],
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10131?fileID=99202",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Original named computing or mixed use filing with explicit source parcel identifier"
            },
            {
              "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=APN_DASH+IN+%28%27506-30-021A%27%2C%27506-30-024A%27%29&outFields=OBJECTID%2CAPN%2CAPN_DASH%2CPHYSICAL_ADDRESS%2CPHYSICAL_CITY%2CPHYSICAL_ZIP%2CLAND_SIZE%2CSTR&returnGeometry=true&outSR=4326&f=json",
              "host": "gis.mcassessor.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Exact complete official parcel query, calculated center only"
            },
            {
              "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-113.10731374680057%2C33.47782928853755%2C-113.09546625319942%2C33.487710711462455&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
              "host": "imagery.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Actually viewed setting, imagery acquisition date unknown"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Approximate source parcel reference, not a roof or complete campus",
      "summary": "Tonopah · Maricopa · Source context reviewed"
    },
    {
      "id": "h5-data-centers-chandler-az",
      "state": "az",
      "kind": "facility",
      "name": "H5 Data Centers Phoenix (Chandler)",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Chandler",
      "address": "",
      "who": "H5 Data Centers",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Source says20watts/cabinet density. This implausible unit is quarantined; never silently convert to20kW. Arizona tax program eligibility is marketing, not a site award or actual benefit. Operator service/design assertions, not an independent uptime or certification audit. Repeated Ashburn42MW/Q32024 promotional footer is excluded from this location. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://h5datacenters.com/phoenix-data-center.html",
          "host": "h5datacenters.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2600+W+Germann+Rd%2C+Chandler%2C+AZ+85286&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street method and limits"
        }
      ],
      "loc": {
        "lat": 33.276091374735,
        "lng": -111.884896577523,
        "precision": "address",
        "basis": "Published H5 Data Centers facility address 2600 W Germann Rd, Chandler, AZ 85286 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "h5-primary-review-round4-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "published_address": "2600 W Germann Rd, Chandler, AZ 85286",
            "advertised_colocation_facility_sqft": 180000,
            "advertised_capacity_mw": 26,
            "power_basis": "capacity; not explicitly gross or critical IT"
          },
          "notes": [
            "Source says20watts/cabinet density. This implausible unit is quarantined; never silently convert to20kW. Arizona tax program eligibility is marketing, not a site award or actual benefit.",
            "Operator service/design assertions, not an independent uptime or certification audit. Repeated Ashburn42MW/Q32024 promotional footer is excluded from this location.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://h5datacenters.com/phoenix-data-center.html",
              "host": "h5datacenters.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "H5 describes current colocation customers and cabinet deployments at its Phoenix-market facility in Chandler. The implausible watts-per-cabinet wording is not adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "H5 describes current colocation customers and cabinet deployments at its Phoenix-market facility in Chandler. The implausible watts-per-cabinet wording is not adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "H5 describes current colocation customers and cabinet deployments at its Phoenix-market facility in Chandler. The implausible watts-per-cabinet wording is not adopted."
          ],
          "sources": [
            {
              "url": "https://h5datacenters.com/phoenix-data-center.html",
              "host": "h5datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 7, October 22, 2026",
          "scope": "Official facility service street reference only. No canonical address, current operation, physical date, capacity, company role, jurisdiction, parcel, complete campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 33.276091374735,
                "lng": -111.884896577523,
                "precision": "address",
                "basis": "Published H5 Data Centers facility address 2600 W Germann Rd, Chandler, AZ 85286 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "2600 W Germann Rd, Chandler, AZ 85286",
              "county_fips": [
                "04013"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named operator facility page publishes this service address in its facility location section. Navigation, related facilities, corporate addresses, embedded maps and operator template coordinates are excluded. The canonical address wrapper remains exact; the published address is retained as reviewed location evidence.",
            "The unique Census street match and retained county boundary agree with the existing county. Street interpolation does not identify a roof, suite, floor, campus boundary, legal parcel, ownership or distinct physical building. Status, dates, quantities and jurisdiction remain unchanged."
          ],
          "sources": [
            {
              "url": "https://h5datacenters.com/phoenix-data-center.html",
              "host": "h5datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Official named facility street address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2600+W+Germann+Rd%2C+Chandler%2C+AZ+85286&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street method and limits"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 12, October 23, 2026",
          "scope": "H5 Data Centers presents this named facility or campus in its own colocation service portfolio. Operator is the attributed provider brand relationship, not an independently established legal operating entity, property owner or confirmation that every building and phase is operating. No status, location, physical date, capacity, certification, outage guarantee, utility price or environmental outcome is promoted. Phoenix is the marketed name; the page states Chandler. This role check does not change the retained municipality or reference.",
          "fields": {
            "company_association": {
              "name": "H5 Data Centers",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "H5 Data Centers presents this named facility or campus in its own colocation service portfolio. Operator is the attributed provider brand relationship, not an independently established legal operating entity, property owner or confirmation that every building and phase is operating. No status, location, physical date, capacity, certification, outage guarantee, utility price or environmental outcome is promoted. Phoenix is the marketed name; the page states Chandler. This role check does not change the retained municipality or reference."
            },
            "provider_role": "operator"
          },
          "notes": [
            "H5 Data Centers presents this named facility or campus in its own colocation service portfolio. Operator is the attributed provider brand relationship, not an independently established legal operating entity, property owner or confirmation that every building and phase is operating. No status, location, physical date, capacity, certification, outage guarantee, utility price or environmental outcome is promoted. Phoenix is the marketed name; the page states Chandler. This role check does not change the retained municipality or reference.",
            "Source dates remain separate from physical milestones and the retained status field."
          ],
          "sources": [
            {
              "url": "https://h5datacenters.com/phoenix-data-center.html",
              "host": "h5datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party named colocation portfolio page, scoped provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Chandler · Maricopa · Source context reviewed",
      "status_scope": "H5 describes current colocation customers and cabinet deployments at its Phoenix-market facility in Chandler. The implausible watts-per-cabinet wording is not adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "meta-mesa-az",
      "state": "az",
      "kind": "facility",
      "name": "Meta Mesa Data Center",
      "group": "operating",
      "status": "Operating phase",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Mesa",
      "address": "",
      "who": "Meta",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Undated operator info sheet. Investment label retains its city/state scope and does not independently establish expenditures at one building. Jobs/funding are operator figures with no separately established observation end-date. Renewables MW concern separate electricity-generation projects, not site IT demand. Water-positive/restoration statements are goals, not measured site water use. PDF retains a once-completed jobs qualifier while page2states the center went online in2025. Do not present the full-build jobs forecast as measured current staffing. Page2online-year statement was text-reviewed separately; no exact opening day established. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://datacenters.atmeta.com/asset/mesa-data-center-info-sheet/",
          "host": "datacenters.atmeta.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.12811,
        "lng": -112.38801,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "direct-pdf-review-round5-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "operator_labeled_data_center_investment_usd": 1200000000,
            "investment_is_lower_bound": false,
            "investment_geographic_label": "Arizona",
            "historic_groundbreaking_year": 2021,
            "peak_construction_workers": 2000,
            "operator_reported_operational_jobs_lower_bound": 200,
            "local_school_nonprofit_direct_funding_usd_lower_bound": 2400000,
            "direct_funding_county_scope": "Maricopa",
            "operational_jobs_qualifier": "once completed",
            "operator_reported_first_online_year": 2025
          },
          "notes": [
            "Undated operator info sheet. Investment label retains its city/state scope and does not independently establish expenditures at one building. Jobs/funding are operator figures with no separately established observation end-date. Renewables MW concern separate electricity-generation projects, not site IT demand. Water-positive/restoration statements are goals, not measured site water use.",
            "PDF retains a once-completed jobs qualifier while page2states the center went online in2025. Do not present the full-build jobs forecast as measured current staffing. Page2online-year statement was text-reviewed separately; no exact opening day established.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://datacenters.atmeta.com/asset/mesa-data-center-info-sheet/",
              "host": "datacenters.atmeta.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "overnight-status-2026-10-16",
          "scope": "Named project and operator-service status review; phase and source limits retained.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "supported_label",
              "label": "Operating phase",
              "basis": "The current named Meta factsheet explicitly states on page 2 that Mesa went online in 2025.",
              "checked_on": "2026-10-16"
            },
            "stage_review_limits": "The year is not converted into an exact opening day. Current delivered capacity, occupied share and completion of all expansion buildings remain unverified; future employment and restoration targets are not actual headcounts or measured offsets."
          },
          "notes": [
            "The year is not converted into an exact opening day. Current delivered capacity, occupied share and completion of all expansion buildings remain unverified; future employment and restoration targets are not actual headcounts or measured offsets.",
            "Current service and project labels are source-scoped research contexts. No entire record, physical site, technical quantity or exact parcel is certified."
          ],
          "sources": [
            {
              "url": "https://datacenters.atmeta.com/asset/mesa-data-center-info-sheet/",
              "host": "datacenters.atmeta.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Reviewed current operator evidence"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 05, October 23, 2026",
          "scope": "Meta presents its named Mesa data center as part of its own infrastructure in its first party fact sheet and describes arranging services for that facility. Operator is the attributed provider brand role, not an independently established legal operating entity, property owner or finding about every building and phase. Forward looking employment figures and company resource claims do not establish current completion, measured use, utility costs or environmental outcomes. No status, location, physical date, technical figure or photograph is promoted.",
          "fields": {
            "company_association": {
              "name": "Meta",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Meta presents its named Mesa data center as part of its own infrastructure in its first party fact sheet and describes arranging services for that facility. Operator is the attributed provider brand role, not an independently established legal operating entity, property owner or finding about every building and phase. Forward looking employment figures and company resource claims do not establish current completion, measured use, utility costs or environmental outcomes. No status, location, physical date, technical figure or photograph is promoted."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Meta presents its named Mesa data center as part of its own infrastructure in its first party fact sheet and describes arranging services for that facility. Operator is the attributed provider brand role, not an independently established legal operating entity, property owner or finding about every building and phase. Forward looking employment figures and company resource claims do not establish current completion, measured use, utility costs or environmental outcomes. No status, location, physical date, technical figure or photograph is promoted.",
            "Source dates remain separate from physical milestones and the retained status field."
          ],
          "sources": [
            {
              "url": "https://datacenters.atmeta.com/asset/mesa-data-center-info-sheet/",
              "host": "datacenters.atmeta.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party named campus fact sheet, visually reviewed PDF page 1"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Mesa · Maricopa · Source context reviewed",
      "status_scope": "Primary source review checked 2026-10-16. The current named Meta factsheet explicitly states on page 2 that Mesa went online in 2025. The year is not converted into an exact opening day. Current delivered capacity, occupied share and completion of all expansion buildings remain unverified; future employment and restoration targets are not actual headcounts or measured offsets.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "microsoft-el-mirage-az",
      "state": "az",
      "kind": "facility",
      "name": "Microsoft El Mirage Data Center Campus",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "El Mirage",
      "address": "",
      "who": "Microsoft",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named source section or explicitly limited regional context; no metered load or exact parcel automatically certified.. Preferred historical link redirects to Arizona regional operator page. It says datacenters operate in both cities, but does not verify individual expansion parcels, size, opening or investment. Global community commitments are not project-specific executed agreements. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://local.microsoft.com/communities/americas/greater-phoenix/",
          "host": "local.microsoft.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.59323,
        "lng": -112.41484,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round16-2026-10-14.json",
          "scope": "Named source section or explicitly limited regional context; no metered load or exact parcel automatically certified.",
          "fields": {
            "operator_named_operating_market": "El Mirage",
            "county_context": "Maricopa",
            "current_exact_building_status": null,
            "site_it_mw": null
          },
          "notes": [
            "Preferred historical link redirects to Arizona regional operator page. It says datacenters operate in both cities, but does not verify individual expansion parcels, size, opening or investment. Global community commitments are not project-specific executed agreements.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://local.microsoft.com/communities/americas/greater-phoenix/",
              "host": "local.microsoft.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 3",
          "scope": "Microsoft explicitly names operation in El Mirage in its Arizona regional page. The earlier review already retains that city service context. The regional statement does not identify an individual building or expansion phase represented by the inherited campus record. Preserve the existing unclear exact stage and do not convert regional service into all campus commissioning.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "unresolved",
              "scope": "Microsoft explicitly names operation in El Mirage in its Arizona regional page. The earlier review already retains that city service context. The regional statement does not identify an individual building or expansion phase represented by the inherited campus record. Preserve the existing unclear exact stage and do not convert regional service into all campus commissioning."
            }
          },
          "notes": [
            "Microsoft explicitly names operation in El Mirage in its Arizona regional page. The earlier review already retains that city service context. The regional statement does not identify an individual building or expansion phase represented by the inherited campus record. Preserve the existing unclear exact stage and do not convert regional service into all campus commissioning."
          ],
          "sources": [
            {
              "url": "https://local.microsoft.com/communities/americas/greater-phoenix/",
              "host": "local.microsoft.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 04, October 22, 2026",
          "scope": "Microsoft explicitly says it operates datacenters in El Mirage and Goodyear. This supports a provider brand operator role for the existing El Mirage city campus context, not an individual building, parcel, legal owner or commissioning finding. The source page modification date is not a physical milestone. Existing status remains unchanged.",
          "fields": {
            "company_association": {
              "name": "Microsoft",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Microsoft explicitly says it operates datacenters in El Mirage and Goodyear. This supports a provider brand operator role for the existing El Mirage city campus context, not an individual building, parcel, legal owner or commissioning finding. The source page modification date is not a physical milestone. Existing status remains unchanged."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Microsoft explicitly says it operates datacenters in El Mirage and Goodyear. This supports a provider brand operator role for the existing El Mirage city campus context, not an individual building, parcel, legal owner or commissioning finding. The source page modification date is not a physical milestone. Existing status remains unchanged.",
            "Source dates remain separate from physical milestones and the retained status field."
          ],
          "sources": [
            {
              "url": "https://local.microsoft.com/communities/americas/greater-phoenix/",
              "host": "local.microsoft.com",
              "published": "2021-08-26",
              "date": "2021-08-26",
              "checked": "2026-10-22",
              "label": "First party named community development or operation statement"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "El Mirage · Maricopa · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "microsoft-goodyear-az",
      "state": "az",
      "kind": "facility",
      "name": "Microsoft Goodyear Data Center Campus",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Goodyear",
      "address": "",
      "who": "Microsoft",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named source section or explicitly limited regional context; no metered load or exact parcel automatically certified.. Preferred historical link redirects to Arizona regional operator page. It says datacenters operate in both cities, but does not verify individual expansion parcels, size, opening or investment. Global community commitments are not project-specific executed agreements. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://local.microsoft.com/communities/americas/greater-phoenix/",
          "host": "local.microsoft.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.21507,
        "lng": -112.72265,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round16-2026-10-14.json",
          "scope": "Named source section or explicitly limited regional context; no metered load or exact parcel automatically certified.",
          "fields": {
            "operator_named_operating_market": "Goodyear",
            "county_context": "Maricopa",
            "current_exact_building_status": null,
            "site_it_mw": null
          },
          "notes": [
            "Preferred historical link redirects to Arizona regional operator page. It says datacenters operate in both cities, but does not verify individual expansion parcels, size, opening or investment. Global community commitments are not project-specific executed agreements.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://local.microsoft.com/communities/americas/greater-phoenix/",
              "host": "local.microsoft.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 3",
          "scope": "Microsoft explicitly names operation in Goodyear in its Arizona regional page. The earlier review already retains that city service context. The regional statement does not identify an individual building or expansion phase represented by the inherited campus record. Preserve the existing unclear exact stage and do not convert regional service into all campus commissioning.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "unresolved",
              "scope": "Microsoft explicitly names operation in Goodyear in its Arizona regional page. The earlier review already retains that city service context. The regional statement does not identify an individual building or expansion phase represented by the inherited campus record. Preserve the existing unclear exact stage and do not convert regional service into all campus commissioning."
            }
          },
          "notes": [
            "Microsoft explicitly names operation in Goodyear in its Arizona regional page. The earlier review already retains that city service context. The regional statement does not identify an individual building or expansion phase represented by the inherited campus record. Preserve the existing unclear exact stage and do not convert regional service into all campus commissioning."
          ],
          "sources": [
            {
              "url": "https://local.microsoft.com/communities/americas/greater-phoenix/",
              "host": "local.microsoft.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 04, October 22, 2026",
          "scope": "Microsoft explicitly says it operates datacenters in El Mirage and Goodyear. This supports a provider brand operator role for the existing Goodyear city campus context, not an individual building, parcel, legal owner or commissioning finding. The source page modification date is not a physical milestone. Existing status remains unchanged.",
          "fields": {
            "company_association": {
              "name": "Microsoft",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Microsoft explicitly says it operates datacenters in El Mirage and Goodyear. This supports a provider brand operator role for the existing Goodyear city campus context, not an individual building, parcel, legal owner or commissioning finding. The source page modification date is not a physical milestone. Existing status remains unchanged."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Microsoft explicitly says it operates datacenters in El Mirage and Goodyear. This supports a provider brand operator role for the existing Goodyear city campus context, not an individual building, parcel, legal owner or commissioning finding. The source page modification date is not a physical milestone. Existing status remains unchanged.",
            "Source dates remain separate from physical milestones and the retained status field."
          ],
          "sources": [
            {
              "url": "https://local.microsoft.com/communities/americas/greater-phoenix/",
              "host": "local.microsoft.com",
              "published": "2021-08-26",
              "date": "2021-08-26",
              "checked": "2026-10-22",
              "label": "First party named community development or operation statement"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Goodyear · Maricopa · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "novva-mesa-az",
      "state": "az",
      "kind": "facility",
      "name": "Novva Mesa Data Center Campus",
      "group": "proposed",
      "status": "Operator-announced development",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Mesa",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Novva Mesa phased development forecasts. Target not observed opening.160acsite and1.3Msqftfootprint are different scopes. Water savings versus hypothetical conventional system are projections, not measured withdrawals; renewable/biofuel designs not current results.300MWheadline not all phase1IT. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.novva.com/media-center/novva-data-centers-announces-new-campus-in-mesa/",
          "host": "novva.com",
          "date": "2024-08-21",
          "published": "2024-08-21",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.28935,
        "lng": -112.21974,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-discovery-review-round8-2026-10-14.json",
          "scope": "Novva Mesa phased development forecasts",
          "fields": {
            "original_announcement_date": "2024-08-21",
            "page_updated_date": "2026-01-13",
            "proposed_campus_acres": 160,
            "headline_planned_capacity_mw": 300,
            "headline_power_basis": "not explicit critical IT",
            "phase1_planned_critical_it_mw": 96,
            "phase1_operation_target": "late2026",
            "planned_investment_usd_min_exclusive": 3000000000,
            "planned_buildout_period": "nextdecade",
            "planned_data_halls": 5,
            "planned_total_building_footprint_sqft": 1300000,
            "expected_staff_approx": 200,
            "published_location": "northwest alignment of Ellsworth and Warner roads, southeast Mesa, Arizona"
          },
          "notes": [
            "Target not observed opening.160acsite and1.3Msqftfootprint are different scopes. Water savings versus hypothetical conventional system are projections, not measured withdrawals; renewable/biofuel designs not current results.300MWheadline not all phase1IT.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.novva.com/media-center/novva-data-centers-announces-new-campus-in-mesa/",
              "host": "novva.com",
              "date": "2024-08-21",
              "published": "2024-08-21",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "status-continuation-2026-10-19",
          "scope": "Novva announces a phased data center campus in Mesa, with an initial launch forecast for late 2026.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_announced_development",
              "scope": "Novva announces a phased data center campus in Mesa, with an initial launch forecast for late 2026."
            }
          },
          "notes": [
            "The forecast and proposed sustainability features do not establish actual commissioning, measured water savings or full-campus completion."
          ],
          "sources": [
            {
              "url": "https://www.novva.com/media-center/novva-data-centers-announces-new-campus-in-mesa/",
              "host": "www.novva.com",
              "published": "2024-08-21",
              "date": "2024-08-21",
              "checked": "2026-10-19",
              "label": "Original source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Mesa · Maricopa · Source context reviewed",
      "status_scope": "Novva announces a phased data center campus in Mesa, with an initial launch forecast for late 2026.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "ntt-global-mesa-az",
      "state": "az",
      "kind": "facility",
      "name": "NTT Global Data Centers Mesa  -  Pacific Proving Technology Park",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Mesa",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Recommendation is not final council approval. The separate 102-acre Elliot Road campus is not this 170-acre proposal. Reported 2.3 million square feet differs from other baseline area descriptions and remains unresolved. A 300-million-USD land purchase is not full construction investment. Closed-loop design and modeled noise measures are not measured water/noise; no later council outcome assumed. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.themesatribune.com/news/big-data-center-in-se-mesa-passes-first-review/article_91081b9b-d2d1-47f6-91d2-b600115e4a55.html",
          "host": "themesatribune.com",
          "date": "2026-05-21",
          "published": "2026-05-21",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.58523,
        "lng": -112.65744,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round28-2026-10-14.json",
          "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.",
          "fields": {
            "reported_context": "The Mesa Tribune reports a four-zero planning-board recommendation for NTT's Pecos/Crismon proposal, with council consideration still expected later and revised landscaping requested.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Recommendation is not final council approval. The separate 102-acre Elliot Road campus is not this 170-acre proposal. Reported 2.3 million square feet differs from other baseline area descriptions and remains unresolved. A 300-million-USD land purchase is not full construction investment. Closed-loop design and modeled noise measures are not measured water/noise; no later council outcome assumed.",
            "Original approvals and later observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.themesatribune.com/news/big-data-center-in-se-mesa-passes-first-review/article_91081b9b-d2d1-47f6-91d2-b600115e4a55.html",
              "host": "themesatribune.com",
              "date": "2026-05-21",
              "published": "2026-05-21",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Mesa · Maricopa · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "ntt-phoenix-ph1-data-center-az",
      "state": "az",
      "kind": "facility",
      "name": "NTT Phoenix PH1 Data Center",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Mesa",
      "address": "",
      "who": "NTT DATA",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. NTT Mesa PH1 site versus campus scope. 36MWnamedbuildingversus240MWcampus;donotassign240toPH1. Futuretensewillfeaturedoesnotdateenergization. Operator tax-incentive summary not independent current statutory interpretation or actual facility benefit.6MWvaultsubunitsnotextraIT. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://services.global.ntt/en-us/services-and-products/global-data-centers/global-locations/americas/phoenix-ph1-data-center",
          "host": "services.global.ntt",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=10256+Elliot+Rd.%2C+Mesa%2C+AZ+85212&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-111.61235765924839%2C33.346895051624536%2C-111.6048298598976%2C33.35318322984947&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Aerial setting context only, acquisition date unknown"
        },
        {
          "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=PHYSICAL_STREET_NUM%3D%2710256%27+AND+UPPER%28PHYSICAL_STREET_NAME%29%3D%27ELLIOT%27&outFields=APN%2CAPN_DASH%2CPHYSICAL_STREET_NUM%2CPHYSICAL_STREET_DIR%2CPHYSICAL_STREET_NAME%2CPHYSICAL_STREET_TYPE%2CPHYSICAL_CITY%2CPHYSICAL_ZIP%2CPHYSICAL_ADDRESS&returnGeometry=true&outSR=4326&f=json",
          "host": "gis.mcassessor.maricopa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "County physical address corroborates East direction only"
        },
        {
          "url": "https://www.nttdata.com/en-hk/services/global-data-centers/global-locations/americas/phoenix-data-centers/phoenix-ph1-data-center",
          "host": "www.nttdata.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "First party exact building code and named service text, scoped provider relationship reviewed"
        }
      ],
      "loc": {
        "lng": -111.608593759573,
        "lat": 33.350039140737,
        "precision": "address",
        "basis": "Published NTT DATA facility address 10256 Elliot Rd., Mesa, AZ 85212 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding. Existing native status remains unknown."
      },
      "reviewed_evidence": [
        {
          "overlay": "primary-source-review-round9-2026-10-14.json",
          "scope": "NTT Mesa PH1 site versus campus scope",
          "fields": {
            "operator_code": "PH1",
            "address": "10256 Elliot Road, Mesa, Arizona85212",
            "critical_it_mw": 36,
            "data_floor_sqft": 126000,
            "campus_acres": 102,
            "campus_planned_data_centers": 7,
            "campus_advertised_power_mw": 240
          },
          "notes": [
            "36MWnamedbuildingversus240MWcampus;donotassign240toPH1. Futuretensewillfeaturedoesnotdateenergization. Operator tax-incentive summary not independent current statutory interpretation or actual facility benefit.6MWvaultsubunitsnotextraIT.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://services.global.ntt/en-us/services-and-products/global-data-centers/global-locations/americas/phoenix-ph1-data-center",
              "host": "services.global.ntt",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 14, October 22, 2026",
          "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted. Existing native status remains unknown.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -111.608593759573,
                "lat": 33.350039140737,
                "precision": "address",
                "basis": "Published NTT DATA facility address 10256 Elliot Rd., Mesa, AZ 85212 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding. Existing native status remains unknown."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "10256 Elliot Rd., Mesa, AZ 85212",
              "county_fips": [
                "04013"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The current official numeric facility section identifies this existing research record. All native stage, status, canonical address, physical milestone, quantity, role, identity and jurisdiction wrappers remain exact. Corporate headquarters and operator map coordinates are excluded.",
            "The unique Census street range is a calculated street reference. Its state and county agree with the existing context. Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. No roof, parcel title, full campus or current operation is inferred.",
            "The operator omits a direction in Elliot Road. A single official county physical address at the same number, street, city and postal code explicitly uses East Elliot Road, agreeing with Census. Parcel APN 30401006N is evidence of this address comparison only. County geometry, title and parcel identity are not adopted. The aerial center is on the named street near open land and industrial forms; imagery may predate construction.",
            "This is a location only decision. The current listing, figures, technical specifications, services, certifications and marketing claims do not establish a physical commissioning event or certify current operation. Native unknown status remains unknown."
          ],
          "sources": [
            {
              "url": "https://services.global.ntt/en-us/services-and-products/global-data-centers/global-locations/americas/phoenix-ph1-data-center",
              "host": "services.global.ntt",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Official named PH1 numeric street section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=10256+Elliot+Rd.%2C+Mesa%2C+AZ+85212&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-111.61235765924839%2C33.346895051624536%2C-111.6048298598976%2C33.35318322984947&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Aerial setting context only, acquisition date unknown"
            },
            {
              "url": "https://gis.mcassessor.maricopa.gov/arcgis/rest/services/Parcels/MapServer/0/query?where=PHYSICAL_STREET_NUM%3D%2710256%27+AND+UPPER%28PHYSICAL_STREET_NAME%29%3D%27ELLIOT%27&outFields=APN%2CAPN_DASH%2CPHYSICAL_STREET_NUM%2CPHYSICAL_STREET_DIR%2CPHYSICAL_STREET_NAME%2CPHYSICAL_STREET_TYPE%2CPHYSICAL_CITY%2CPHYSICAL_ZIP%2CPHYSICAL_ADDRESS&returnGeometry=true&outSR=4326&f=json",
              "host": "gis.mcassessor.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "County physical address corroborates East direction only"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 18, October 23, 2026",
          "scope": "NTT DATA explicitly offers service for this exact named building on its own global data center website. Operator is the attributed provider brand relationship of the NTT DATA global data center business, not independent verification of a legal operating entity, property ownership, whole campus completion or every phase. No current status, precise location, address, physical date, capacity, water, safety, certification, compliance or incentive eligibility is promoted. PH1 is explicitly named in Mesa within the marketed Phoenix region. The page mixes current offers with future feature wording and planned campus buildings. Provider identity does not resolve delivered capacity, commissioning, later PH4 phases or the separately retained general Mesa proposal. The source is a localized English page on the official corporate domain; its locale is not the facility country or jurisdiction. The page explicitly identifies the retained United States city and code.",
          "fields": {
            "company_association": {
              "name": "NTT DATA",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "NTT DATA explicitly offers service for this exact named building on its own global data center website. Operator is the attributed provider brand relationship of the NTT DATA global data center business, not independent verification of a legal operating entity, property ownership, whole campus completion or every phase. No current status, precise location, address, physical date, capacity, water, safety, certification, compliance or incentive eligibility is promoted. PH1 is explicitly named in Mesa within the marketed Phoenix region. The page mixes current offers with future feature wording and planned campus buildings. Provider identity does not resolve delivered capacity, commissioning, later PH4 phases or the separately retained general Mesa proposal. The source is a localized English page on the official corporate domain; its locale is not the facility country or jurisdiction. The page explicitly identifies the retained United States city and code."
            },
            "provider_role": "operator"
          },
          "notes": [
            "NTT DATA explicitly offers service for this exact named building on its own global data center website. Operator is the attributed provider brand relationship of the NTT DATA global data center business, not independent verification of a legal operating entity, property ownership, whole campus completion or every phase. No current status, precise location, address, physical date, capacity, water, safety, certification, compliance or incentive eligibility is promoted. PH1 is explicitly named in Mesa within the marketed Phoenix region. The page mixes current offers with future feature wording and planned campus buildings. Provider identity does not resolve delivered capacity, commissioning, later PH4 phases or the separately retained general Mesa proposal. The source is a localized English page on the official corporate domain; its locale is not the facility country or jurisdiction. The page explicitly identifies the retained United States city and code.",
            "First publication dates are not established. Awards, specifications, current retrieval and stated plans are not physical milestones."
          ],
          "sources": [
            {
              "url": "https://www.nttdata.com/en-hk/services/global-data-centers/global-locations/americas/phoenix-data-centers/phoenix-ph1-data-center",
              "host": "www.nttdata.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party exact building code and named service text, scoped provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, status remains unknown",
      "summary": "Mesa · Maricopa · Source context reviewed"
    },
    {
      "id": "phoenixnap-phx02-phoenix-az",
      "state": "az",
      "kind": "facility",
      "name": "phoenixNAP PHX02",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Phoenix",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. The first University Drive center is separate. Land price is not construction spending; zoning-extension approval is not commissioning. Power basis is unspecified. The stated rack count and rack density imply a very different total from the campus MW; do not reconcile or multiply them into canonical IT. No future completion observed. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://azbex.com/planning-development/new-data-center-planned-in-south-phoenix/",
          "host": "azbex.com",
          "date": "2025-04-04",
          "published": "2025-04-04",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.05276,
        "lng": -112.52982,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round30-2026-10-14.json",
          "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.",
          "fields": {
            "reported_context": "AZBEX reports proposed phoenixNAP PHX02, initial 30 MW inside a potential 50 MW plan, with first-floor completion hoped for in fourth-quarter 2026.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "The first University Drive center is separate. Land price is not construction spending; zoning-extension approval is not commissioning. Power basis is unspecified. The stated rack count and rack density imply a very different total from the campus MW; do not reconcile or multiply them into canonical IT. No future completion observed.",
            "Original approvals and later observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://azbex.com/planning-development/new-data-center-planned-in-south-phoenix/",
              "host": "azbex.com",
              "date": "2025-04-04",
              "published": "2025-04-04",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Phoenix · Maricopa · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "qts-phoenix-2-az",
      "state": "az",
      "kind": "facility",
      "name": "QTS Phoenix 2",
      "group": "proposed",
      "status": "Operator-listed development",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Phoenix",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Multi-building campus total. Same postal address is listed for multiple buildings; no multiplication of 210 MW or automatic address-based collapsing. No commissioned-load inference. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://q.com/data-centers/phoenix-2/",
          "host": "q.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://q.com/data-centers/",
          "host": "q.com",
          "published": "",
          "date": "",
          "checked": "2026-10-19",
          "label": "Operator source for the qualified stage"
        }
      ],
      "loc": {
        "lat": 33.54795,
        "lng": -112.25545,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round4-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "campus_acres": 80,
            "advertised_critical_campus_mw_lower_bound": 210,
            "published_multi_building_address": "1200 N 40th St, Phoenix, AZ 85008"
          },
          "notes": [
            "Multi-building campus total. Same postal address is listed for multiple buildings; no multiplication of 210 MW or automatic address-based collapsing. No commissioned-load inference.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://q.com/data-centers/phoenix-2/",
              "host": "q.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "QTS explicitly lists Phoenix 2 as in development, separate from Phoenix 3 and Phoenix 4. Conflicting building-address wording in the detailed page is not promoted to a location or parcel. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_development",
              "scope": "QTS explicitly lists Phoenix 2 as in development, separate from Phoenix 3 and Phoenix 4. Conflicting building-address wording in the detailed page is not promoted to a location or parcel. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "QTS explicitly lists Phoenix 2 as in development, separate from Phoenix 3 and Phoenix 4. Conflicting building-address wording in the detailed page is not promoted to a location or parcel."
          ],
          "sources": [
            {
              "url": "https://q.com/data-centers/",
              "host": "q.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Phoenix · Maricopa · Source context reviewed",
      "status_scope": "QTS explicitly lists Phoenix 2 as in development, separate from Phoenix 3 and Phoenix 4. Conflicting building-address wording in the detailed page is not promoted to a location or parcel. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "qts-phoenix-4-tolleson-az",
      "state": "az",
      "kind": "facility",
      "name": "QTS Phoenix 4",
      "group": "proposed",
      "status": "In development",
      "raw_status": "in development",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Tolleson",
      "address": "",
      "who": "QTS",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Generic anticipated jobs and water-free design goals are not measured outcomes or an operating-status confirmation. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Named-site current agency/operator stage, reviewed October 15, 2026. The broad In development label does not distinguish permitting from construction. Corporate portfolio operational claims do not prove this site is open. Address text does not confirm inherited coordinates. Publication date of this current page is not established; the review date is not an event date. Displayed status uses the explicitly reviewed current status field; it is a source statement, not a physical inspection.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://q.com/data-centers/phoenix-4/",
          "host": "q.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.36222,
        "lng": -112.80924,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round4-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "published_address": "11753 W Lower Buckeye Rd, Tolleson, AZ 85353",
            "operator_stage": "establishing new campus"
          },
          "notes": [
            "Generic anticipated jobs and water-free design goals are not measured outcomes or an operating-status confirmation.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://q.com/data-centers/phoenix-4/",
              "host": "q.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Atlas targeted primary-source follow-up",
          "scope": "Named-site current agency/operator stage, reviewed October 15, 2026",
          "fields": {
            "current_status": "in development",
            "status_basis": "The Phoenix 4 page says QTS is establishing a new data-center campus and lists a Tolleson location.",
            "filter_scope": "Grouped with proposed/development projects; no final permit or exact construction stage is inferred."
          },
          "notes": [
            "The broad In development label does not distinguish permitting from construction. Corporate portfolio operational claims do not prove this site is open. Address text does not confirm inherited coordinates. Publication date of this current page is not established; the review date is not an event date."
          ],
          "sources": [
            {
              "url": "https://q.com/data-centers/phoenix-4/",
              "host": "q.com",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "checked": "2026-10-15",
          "capture_sha256": "c5bd8fa5d2c657b4bceae96ebd4faab75fd93f5826a365e6089f20801a2bafee",
          "events": [],
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check45, October23,2026",
          "scope": "QTS identifies the named Phoenix 4 campus at its published Tolleson service street and states that it is establishing new campuses. Developer per source identifies the QTS provider brand for the planned project. The previously empty company field is populated only from this exact first party campus page. The service street is identity context only and does not newly admit a location, parcel or roof. Existing status, location, address, county, quantities, dates and component identity remain exact. A development statement does not establish construction, completion, commissioned operation, legal title or a future tenant. Forecast jobs, cooling claims and environmental commitments are not measured outcomes. The source publication date is unknown.",
          "fields": {
            "company_association": {
              "name": "QTS",
              "role": "developer",
              "identity_scope": "provider_brand_only",
              "scope": "QTS identifies the named Phoenix 4 campus at its published Tolleson service street and states that it is establishing new campuses. Developer per source identifies the QTS provider brand for the planned project. The previously empty company field is populated only from this exact first party campus page. The service street is identity context only and does not newly admit a location, parcel or roof. Existing status, location, address, county, quantities, dates and component identity remain exact. A development statement does not establish construction, completion, commissioned operation, legal title or a future tenant. Forecast jobs, cooling claims and environmental commitments are not measured outcomes. The source publication date is unknown."
            },
            "provider_role": "developer"
          },
          "notes": [
            "QTS identifies the named Phoenix 4 campus at its published Tolleson service street and states that it is establishing new campuses. Developer per source identifies the QTS provider brand for the planned project. The previously empty company field is populated only from this exact first party campus page. The service street is identity context only and does not newly admit a location, parcel or roof. Existing status, location, address, county, quantities, dates and component identity remain exact. A development statement does not establish construction, completion, commissioned operation, legal title or a future tenant. Forecast jobs, cooling claims and environmental commitments are not measured outcomes. The source publication date is unknown."
          ],
          "sources": [
            {
              "url": "https://q.com/data-centers/phoenix-4/",
              "host": "q.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Tolleson · Maricopa · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "stack-phx01-avondale-az",
      "state": "az",
      "kind": "facility",
      "name": "STACK Infrastructure PHX01 Campus",
      "group": "operating",
      "status": "Operator-listed service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Avondale",
      "address": "",
      "who": "STACK Infrastructure",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Regional headline 500 MW differs from campus descriptions 225 plus 250 MW. Do not silently reconcile or allocate extra 25 MW. No operating milestone established. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.stackinfra.com/locations/americas/phoenix/",
          "host": "stackinfra.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.stackinfra.com/locations/americas/phoenix/phx01/",
          "host": "www.stackinfra.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 33.11819,
        "lng": -112.2594,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "phx01_avondale_advertised_critical_capacity_mw": 225,
            "regional_advertised_power_mw": 500,
            "regional_campuses": 2,
            "regional_acres": 155
          },
          "notes": [
            "Regional headline 500 MW differs from campus descriptions 225 plus 250 MW. Do not silently reconcile or allocate extra 25 MW. No operating milestone established.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.stackinfra.com/locations/americas/phoenix/",
              "host": "stackinfra.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 11",
          "scope": "The current STACK PHX01 page names the Avondale campus, offers a tour and describes available campus infrastructure. Operator listed service describes this named commercial campus offering. It does not establish fully delivered marketed capacity, every building opening, tenant occupancy or the stage of the distinct PHX02 proposal.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_service",
              "scope": "The current STACK PHX01 page names the Avondale campus, offers a tour and describes available campus infrastructure. Operator listed service describes this named commercial campus offering. It does not establish fully delivered marketed capacity, every building opening, tenant occupancy or the stage of the distinct PHX02 proposal."
            }
          },
          "notes": [
            "The current STACK PHX01 page names the Avondale campus, offers a tour and describes available campus infrastructure. Operator listed service describes this named commercial campus offering. It does not establish fully delivered marketed capacity, every building opening, tenant occupancy or the stage of the distinct PHX02 proposal.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones."
          ],
          "sources": [
            {
              "url": "https://www.stackinfra.com/locations/americas/phoenix/phx01/",
              "host": "www.stackinfra.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 17, October 23, 2026",
          "scope": "STACK Infrastructure explicitly lists this exact named campus or code in its own source. The operator role is an attributed provider brand relationship, not independently verified legal ownership, whole building control or operation of every phase. Current service and future development stay separate. No status, coordinate, address, physical date, power figure, water figure, safety, certification or environmental outcome is promoted. PHX01 explicitly names Avondale. PHX02 and its different marketed city, planned buildings and capacity remain separate.",
          "fields": {
            "company_association": {
              "name": "STACK Infrastructure",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "STACK Infrastructure explicitly lists this exact named campus or code in its own source. The operator role is an attributed provider brand relationship, not independently verified legal ownership, whole building control or operation of every phase. Current service and future development stay separate. No status, coordinate, address, physical date, power figure, water figure, safety, certification or environmental outcome is promoted. PHX01 explicitly names Avondale. PHX02 and its different marketed city, planned buildings and capacity remain separate."
            },
            "provider_role": "operator"
          },
          "notes": [
            "STACK Infrastructure explicitly lists this exact named campus or code in its own source. The operator role is an attributed provider brand relationship, not independently verified legal ownership, whole building control or operation of every phase. Current service and future development stay separate. No status, coordinate, address, physical date, power figure, water figure, safety, certification or environmental outcome is promoted. PHX01 explicitly names Avondale. PHX02 and its different marketed city, planned buildings and capacity remain separate.",
            "Global Stack and Fluidstack are not assigned to STACK Infrastructure by substring matching. Retrieval and publication dates remain separate from physical milestones."
          ],
          "sources": [
            {
              "url": "https://www.stackinfra.com/locations/americas/phoenix/phx01/",
              "host": "www.stackinfra.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party exact code or campus text, scoped provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Avondale · Maricopa · Source context reviewed",
      "status_scope": "The current STACK PHX01 page names the Avondale campus, offers a tour and describes available campus infrastructure. Operator listed service describes this named commercial campus offering. It does not establish fully delivered marketed capacity, every building opening, tenant occupancy or the stage of the distinct PHX02 proposal.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "stack-phx02-phoenix-az",
      "state": "az",
      "kind": "facility",
      "name": "STACK Infrastructure PHX02 Campus",
      "group": "proposed",
      "status": "Developer-listed development",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Phoenix",
      "address": "",
      "who": "STACK Infrastructure",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Designed capacity with dedicated substation, not proof of all buildings operating. Page also uses Skyway location label; exact street and county not established. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.stackinfra.com/locations/americas/phoenix/phx02/",
          "host": "stackinfra.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.68501,
        "lng": -112.50695,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "planned_critical_capacity_mw": 250,
            "planned_buildings": 5,
            "campus_acres": 51,
            "published_market_location": "Central Phoenix"
          },
          "notes": [
            "Designed capacity with dedicated substation, not proof of all buildings operating. Page also uses Skyway location label; exact street and county not established.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.stackinfra.com/locations/americas/phoenix/phx02/",
              "host": "stackinfra.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 7",
          "scope": "The current STACK PHX02 campus page describes a five building campus designed to deliver future critical capacity. Developer listed development describes that named planned campus offering. Tours and the planned capacity do not establish completed buildings, occupied service, commissioning or measured demand. PHX01 remains separate.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "developer_listed_development",
              "scope": "The current STACK PHX02 campus page describes a five building campus designed to deliver future critical capacity. Developer listed development describes that named planned campus offering. Tours and the planned capacity do not establish completed buildings, occupied service, commissioning or measured demand. PHX01 remains separate."
            }
          },
          "notes": [
            "The current STACK PHX02 campus page describes a five building campus designed to deliver future critical capacity. Developer listed development describes that named planned campus offering. Tours and the planned capacity do not establish completed buildings, occupied service, commissioning or measured demand. PHX01 remains separate.",
            "No campus total, service offer or approval is converted into an observed operating capacity, exact site point or verified opening day."
          ],
          "sources": [
            {
              "url": "https://www.stackinfra.com/locations/americas/phoenix/phx02/",
              "host": "www.stackinfra.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 17, October 23, 2026",
          "scope": "STACK Infrastructure explicitly lists this exact named campus or code in its own source. The developer role is an attributed provider brand relationship, not independently verified legal ownership, whole building control or operation of every phase. Current service and future development stay separate. No status, coordinate, address, physical date, power figure, water figure, safety, certification or environmental outcome is promoted. PHX02 is described as a designed five building campus in central Phoenix. The developer relationship is limited to this marketed development; a capacity design and substation description do not establish current commissioning or completed buildings.",
          "fields": {
            "company_association": {
              "name": "STACK Infrastructure",
              "role": "developer",
              "identity_scope": "provider_brand_only",
              "scope": "STACK Infrastructure explicitly lists this exact named campus or code in its own source. The developer role is an attributed provider brand relationship, not independently verified legal ownership, whole building control or operation of every phase. Current service and future development stay separate. No status, coordinate, address, physical date, power figure, water figure, safety, certification or environmental outcome is promoted. PHX02 is described as a designed five building campus in central Phoenix. The developer relationship is limited to this marketed development; a capacity design and substation description do not establish current commissioning or completed buildings."
            },
            "provider_role": "developer"
          },
          "notes": [
            "STACK Infrastructure explicitly lists this exact named campus or code in its own source. The developer role is an attributed provider brand relationship, not independently verified legal ownership, whole building control or operation of every phase. Current service and future development stay separate. No status, coordinate, address, physical date, power figure, water figure, safety, certification or environmental outcome is promoted. PHX02 is described as a designed five building campus in central Phoenix. The developer relationship is limited to this marketed development; a capacity design and substation description do not establish current commissioning or completed buildings.",
            "Global Stack and Fluidstack are not assigned to STACK Infrastructure by substring matching. Retrieval and publication dates remain separate from physical milestones."
          ],
          "sources": [
            {
              "url": "https://www.stackinfra.com/locations/americas/phoenix/phx02/",
              "host": "www.stackinfra.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party exact code or campus text, scoped provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Phoenix · Maricopa · Source context reviewed",
      "status_scope": "The current STACK PHX02 campus page describes a five building campus designed to deliver future critical capacity. Developer listed development describes that named planned campus offering. Tours and the planned capacity do not establish completed buildings, occupied service, commissioning or measured demand. PHX01 remains separate.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "takanock-project-baccara-maricopa-county-az",
      "state": "az",
      "kind": "facility",
      "name": "Project Baccara",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Baccara named county agenda and prior recommendation only. Agenda records recommendation, not May6 Board approval or operating permit. Conditions from preceding unrelated storage project must not be assigned to Baccara. Turbine-stack heights, setbacks and parking ratios are not power MW or total DC area. No measured consumption, investment or opening established. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2026-04-09",
          "The county agenda records an April 9, 2026 commission recommendation on Baccara MCP250007. This is the planning commission outcome, not proof of the scheduled May 6 Board decision, construction permits or operation."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10264?fileID=100345",
          "host": "maricopa.gov",
          "date": "2026-05-06",
          "published": "2026-05-06",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.08417,
        "lng": -112.71248,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "government-primary-review-round7-2026-10-14.json",
          "scope": "Baccara named county agenda and prior recommendation only",
          "fields": {
            "project": "Project Baccara",
            "case": "MCP250007",
            "owner": "Baccara Eagle Land LLC",
            "published_location": "north of Olive Road, approximately half a mile west of Litchfield Road, west Glendale area",
            "planning_commission_recommendation_date": "2026-04-09",
            "planning_commission_recommendation_vote": {
              "for": 8,
              "against": 0
            },
            "board_hearing_agenda_date": "2026-05-06",
            "proposed_uses": [
              "natural-gas generation",
              "backup propane and diesel power",
              "electrical substation",
              "data-center buildings"
            ]
          },
          "notes": [
            "Agenda records recommendation, not May6 Board approval or operating permit. Conditions from preceding unrelated storage project must not be assigned to Baccara. Turbine-stack heights, setbacks and parking ratios are not power MW or total DC area. No measured consumption, investment or opening established.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10264?fileID=100345",
              "host": "maricopa.gov",
              "date": "2026-05-06",
              "published": "2026-05-06",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 11",
          "scope": "Baccara appears on pages 7 through 9 of the multi item county agenda. The item records an April 9 commission recommendation and schedules May 6 Board consideration for MCP250007. Proposed utility, land development, emergency service and environmental review conditions are project conditions in this agenda, not a verified final Board decision, an issued permit, current compliance or a countywide rule. Physical stage remains unclear.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "commission_recommendation_only_final_board_and_physical_stage_held",
              "scope": "Baccara appears on pages 7 through 9 of the multi item county agenda. The item records an April 9 commission recommendation and schedules May 6 Board consideration for MCP250007. Proposed utility, land development, emergency service and environmental review conditions are project conditions in this agenda, not a verified final Board decision, an issued permit, current compliance or a countywide rule. Physical stage remains unclear."
            },
            "regulatory_scope": {
              "case": "MCP250007",
              "county_agenda_pages_visually_read": [
                7,
                8
              ],
              "commission_recommendation_on": "2026-04-09",
              "board_consideration_scheduled_on": "2026-05-06",
              "final_board_outcome_verified": false,
              "conditions_not_general_county_rules": true
            }
          },
          "notes": [
            "Baccara appears on pages 7 through 9 of the multi item county agenda. The item records an April 9 commission recommendation and schedules May 6 Board consideration for MCP250007. Proposed utility, land development, emergency service and environmental review conditions are project conditions in this agenda, not a verified final Board decision, an issued permit, current compliance or a countywide rule. Physical stage remains unclear.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones."
          ],
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10264?fileID=100345",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Maricopa · Source context reviewed",
      "event_evidence": [
        {
          "date": "2026-04-09",
          "text": "The county agenda records an April 9, 2026 commission recommendation on Baccara MCP250007. This is the planning commission outcome, not proof of the scheduled May 6 Board decision, construction permits or operation.",
          "kind": "hearing",
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10264?fileID=100345",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed government record"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "tract-buckeye-tech-corridor-az",
      "state": "az",
      "kind": "facility",
      "name": "Buckeye Tech Corridor",
      "group": "proposed",
      "status": "Operator-listed development",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Buckeye",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original reporter/issuer named-project context, with inference and stages explicit.. DerekStaahl AZFamily originalAugust29,2024 report, URLAugust30notvote/event. Tract2100acreroundedBuckeyepurchase/20Msf15yearbuildout and1.8GWrequiredpower werePLANSwithpowermajorunresolvedhurdle.1.8GWnotexplicitITorenergyperday; publisherdailyplantcomparison isdimensionallyambiguousandnotadopted. Mayor7yearpowerestimate/300jobsforecastnotsecuredsupplyorhiredstaff.20BfuturevalueviaWSJnotactualTractspend. NearbyAPS/newplantpossibilitynotapprovedPPA.9,700homesscrappedplan/waterlessthanhalfcomparisonsattributednotcurrentmeteredvolume. No namedGoogle/Amazon/Microsofttenantconfirmedmerelymayorexamples. Plans/historicalchanges/courtallegations/utilitycustomerinference not all-field,siteITorcurrentoperatingcertification.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.azfamily.com/2024/08/30/developer-wants-power-future-ai-buckeye-with-new-data-center/",
          "host": "azfamily.com",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.tract.com/project/buckeye/",
          "host": "www.tract.com",
          "published": "",
          "date": "",
          "checked": "2026-10-17",
          "label": "Reviewed source context"
        },
        {
          "url": "https://buckeyeaz.granicus.com/services/minutes/reports/23859ad0-eafd-4e39-b582-796e20fdc9cb/attachment",
          "host": "buckeyeaz.granicus.com",
          "published": "",
          "date": "",
          "checked": "2026-10-17",
          "label": "Access-check target"
        }
      ],
      "loc": {
        "lat": 33.39622,
        "lng": -112.14103,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "national-withdrawals-power-redesign-and-review-stage-round79-2026-10-15.json",
          "scope": "Original reporter/issuer named-project context, with inference and stages explicit.",
          "fields": {},
          "notes": [
            "DerekStaahl AZFamily originalAugust29,2024 report, URLAugust30notvote/event. Tract2100acreroundedBuckeyepurchase/20Msf15yearbuildout and1.8GWrequiredpower werePLANSwithpowermajorunresolvedhurdle.1.8GWnotexplicitITorenergyperday; publisherdailyplantcomparison isdimensionallyambiguousandnotadopted.",
            "Mayor7yearpowerestimate/300jobsforecastnotsecuredsupplyorhiredstaff.20BfuturevalueviaWSJnotactualTractspend. NearbyAPS/newplantpossibilitynotapprovedPPA.9,700homesscrappedplan/waterlessthanhalfcomparisonsattributednotcurrentmeteredvolume. No namedGoogle/Amazon/Microsofttenantconfirmedmerelymayorexamples.",
            "Plans/historicalchanges/courtallegations/utilitycustomerinference not all-field,siteITorcurrentoperatingcertification."
          ],
          "sources": [
            {
              "url": "https://www.azfamily.com/2024/08/30/developer-wants-power-future-ai-buckeye-with-new-data-center/",
              "host": "azfamily.com",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "encore-2026-10-17-batch2",
          "scope": "Limited source identity and stage review; not whole-record certification, parcel verification or a physical-site census.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator-listed_development",
              "scope": "Tract currently identifies Buckeye as a development project. Its 1,800 MW figure is marketed campus capacity, not delivered IT load. The current 2,019-acre description differs from an earlier acquisition figure. Zoning and entitlement context do not establish actual construction; the municipal minutes route was access-limited. The proposed label applies to operator-listed development."
            }
          },
          "notes": [
            "Tract currently identifies Buckeye as a development project. Its 1,800 MW figure is marketed campus capacity, not delivered IT load. The current 2,019-acre description differs from an earlier acquisition figure. Zoning and entitlement context do not establish actual construction; the municipal minutes route was access-limited. The proposed label applies to operator-listed development."
          ],
          "sources": [
            {
              "url": "https://www.tract.com/project/buckeye/",
              "host": "www.tract.com",
              "published": "",
              "date": "",
              "checked": "2026-10-17",
              "label": "Reviewed source context"
            },
            {
              "url": "https://buckeyeaz.granicus.com/services/minutes/reports/23859ad0-eafd-4e39-b582-796e20fdc9cb/attachment",
              "host": "buckeyeaz.granicus.com",
              "published": "",
              "date": "",
              "checked": "2026-10-17",
              "label": "Access-check target"
            }
          ],
          "checked": "2026-10-17",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": false,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Buckeye · Maricopa · Source context reviewed",
      "status_scope": "Tract currently identifies Buckeye as a development project. Its 1,800 MW figure is marketed campus capacity, not delivered IT load. The current 2,019-acre description differs from an earlier acquisition figure. Zoning and entitlement context do not establish actual construction; the municipal minutes route was access-limited. The proposed label applies to operator-listed development.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "tract-project-range-buckeye-goodyear-az",
      "state": "az",
      "kind": "facility",
      "name": "Project Range",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Buckeye",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.. County consideration and staff coordination are not approval; no hearing had been scheduled.15-plus-yearbuildout and 2025 site improvements were forecasts, not observed start. Revised 60 footheight/500 footsetbacks differ from initial 110/100 figures, not simultaneous options certified as final conditions. About 100 acrespublic use is within proposed project scope, not automatically another 100 acres. City opposition is not county denial. No MW, executed utility service, current status or tenant independently verified. Later original decisions and observed outcomes take precedence; future events have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://azbex.com/planning-development/massive-data-center-master-plan-proposed-in-west-valley/",
          "host": "azbex.com",
          "date": "2024-03-22",
          "published": "2024-03-22",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 33.55575,
        "lng": -112.78846,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round33-2026-10-14.json",
          "scope": "Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.",
          "fields": {
            "reported_context": "AZBEX reports Tract’s 2024 Project Range master-plan proposal on a Maricopa County island between Buckeye and Goodyear: two campuses,28 buildings and about 5.6 million squarefeet across 1000 acres.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "County consideration and staff coordination are not approval; no hearing had been scheduled.15-plus-yearbuildout and 2025 site improvements were forecasts, not observed start. Revised 60 footheight/500 footsetbacks differ from initial 110/100 figures, not simultaneous options certified as final conditions. About 100 acrespublic use is within proposed project scope, not automatically another 100 acres. City opposition is not county denial. No MW, executed utility service, current status or tenant independently verified.",
            "Later original decisions and observed outcomes take precedence; future events have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://azbex.com/planning-development/massive-data-center-master-plan-proposed-in-west-valley/",
              "host": "azbex.com",
              "date": "2024-03-22",
              "published": "2024-03-22",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Buckeye · Maricopa · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    },
    {
      "id": "vantage-phoenix-campus-goodyear-az-az",
      "state": "az",
      "kind": "facility",
      "name": "Vantage Phoenix Campus (Goodyear, AZ)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Goodyear",
      "address": "",
      "who": "Vantage Data Centers",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Vantage Goodyear full-campus IT and address scope. Fullfive-building future campus, not176MWcurrentlyenergized.69kVvoltage not ITMWor certified substation surplus. Near-zeroWUEdesign not measured zero domestic water. Operator green-building claims not independently audited. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://vantage-dc.com/data-center-locations/north-america/phoenix-arizona/",
          "host": "vantage-dc.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://vantage-dc.com/data-center-locations/",
          "host": "vantage-dc.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Exact separate named campus address section"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=45+S.+Bullard+Avenue%2C+Goodyear%2C+AZ+85338&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Unique calculated street range and retained county match"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-112.37919792710773%2C33.44620441589253%2C-112.37166151953028%2C33.452492594117466&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Actually viewed setting only, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -112.37543,
        "lat": 33.449349,
        "precision": "approximate",
        "basis": "Approximate named Vantage Phoenix campus at Goodyear campus service area at 45 S. Bullard Avenue, Goodyear, AZ 85338, matched to one Census street range inside the retained county. Not a confirmed parcel, independent building, tenant unit or completed full campus. Aerial acquisition date is unknown and may predate construction. Existing native status remains unknown."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-discovery-review-round8-2026-10-14.json",
          "scope": "Vantage Goodyear full-campus IT and address scope",
          "fields": {
            "campus_code": "AZ1",
            "published_address": "45 S Bullard Avenue, Goodyear, AZ85338",
            "planned_campus_acres": 50,
            "planned_data_center_buildings": 5,
            "fullbuild_critical_it_mw": 176,
            "fullbuild_area_sqft_min_exclusive": 1000000
          },
          "notes": [
            "Fullfive-building future campus, not176MWcurrentlyenergized.69kVvoltage not ITMWor certified substation surplus. Near-zeroWUEdesign not measured zero domestic water. Operator green-building claims not independently audited.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://vantage-dc.com/data-center-locations/north-america/phoenix-arizona/",
              "host": "vantage-dc.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 11",
          "scope": "The Vantage AZ1 page combines present campus amenity descriptions, AZ11 and AZ12 construction certifications, and future language for a five building campus. It does not specify the current delivered and operating stage of every phase. Construction certification, marketed capacity and planned near zero cooling water intensity are not verified operating capacity, actual water use or full campus completion. Physical stage remains unclear.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "mixed_present_and_future_campus_copy_stage_held",
              "scope": "The Vantage AZ1 page combines present campus amenity descriptions, AZ11 and AZ12 construction certifications, and future language for a five building campus. It does not specify the current delivered and operating stage of every phase. Construction certification, marketed capacity and planned near zero cooling water intensity are not verified operating capacity, actual water use or full campus completion. Physical stage remains unclear."
            },
            "phase_scope": {
              "campus": "AZ1",
              "named_certification_components": [
                "AZ11",
                "AZ12"
              ],
              "all_phase_completion_verified": false,
              "design_water_intensity_is_not_measured_water_use": true
            }
          },
          "notes": [
            "The Vantage AZ1 page combines present campus amenity descriptions, AZ11 and AZ12 construction certifications, and future language for a five building campus. It does not specify the current delivered and operating stage of every phase. Construction certification, marketed capacity and planned near zero cooling water intensity are not verified operating capacity, actual water use or full campus completion. Physical stage remains unclear.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones."
          ],
          "sources": [
            {
              "url": "https://vantage-dc.com/data-center-locations/north-america/phoenix-arizona/",
              "host": "vantage-dc.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 15, October 23, 2026",
          "scope": "Vantage Data Centers explicitly identifies the named campus or building in its own source. The developer role is an attributed provider brand relationship, not independently verified legal ownership or current operation of every phase. Proposed and delivered components remain separate. No status, location, address, physical date, quantity, certification, environmental outcome or incentive eligibility is promoted. The current AZ1 page says Vantage is building five data centers and describes a fully developed future campus. Developer is supported; present completion, marketed power and the status of individual AZ11 or AZ12 buildings are not adopted.",
          "fields": {
            "company_association": {
              "name": "Vantage Data Centers",
              "role": "developer",
              "identity_scope": "provider_brand_only",
              "scope": "Vantage Data Centers explicitly identifies the named campus or building in its own source. The developer role is an attributed provider brand relationship, not independently verified legal ownership or current operation of every phase. Proposed and delivered components remain separate. No status, location, address, physical date, quantity, certification, environmental outcome or incentive eligibility is promoted. The current AZ1 page says Vantage is building five data centers and describes a fully developed future campus. Developer is supported; present completion, marketed power and the status of individual AZ11 or AZ12 buildings are not adopted."
            },
            "provider_role": "developer"
          },
          "notes": [
            "Vantage Data Centers explicitly identifies the named campus or building in its own source. The developer role is an attributed provider brand relationship, not independently verified legal ownership or current operation of every phase. Proposed and delivered components remain separate. No status, location, address, physical date, quantity, certification, environmental outcome or incentive eligibility is promoted. The current AZ1 page says Vantage is building five data centers and describes a fully developed future campus. Developer is supported; present completion, marketed power and the status of individual AZ11 or AZ12 buildings are not adopted.",
            "Publication dates and stated targets remain separate from actual physical milestones."
          ],
          "sources": [
            {
              "url": "https://vantage-dc.com/data-center-locations/north-america/phoenix-arizona/",
              "host": "vantage-dc.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party exact campus or code text, scoped provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 36, October 23, 2026",
          "scope": "Approximate remains approximate. Named campus service area only. Existing native status remains unknown.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -112.37543,
                "lat": 33.449349,
                "precision": "approximate",
                "basis": "Approximate named Vantage Phoenix campus at Goodyear campus service area at 45 S. Bullard Avenue, Goodyear, AZ 85338, matched to one Census street range inside the retained county. Not a confirmed parcel, independent building, tenant unit or completed full campus. Aerial acquisition date is unknown and may predate construction. Existing native status remains unknown."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "45 S. Bullard Avenue, Goodyear, AZ 85338",
              "county_fips": [
                "04013"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The current official Vantage North American data center list explicitly separates Phoenix at 45 S. Bullard Avenue, Santa Clara II at 737 Mathew Street and Santa Clara III at 2590 Walsh Avenue. This record uses only its exact corresponding named campus section. Current individual Santa Clara pages explicitly identify CA2 and CA3. CA3 is described with future wording and native proposed remains proposed. CA2 includes mixed current and future marketing, which does not establish a physical stage. Each review adopts only an approximate named campus service area at the calculated street reference. No independent building, unit, full campus boundary, commissioning date, operator quantity or native status is inferred. Company business offices and map provider coordinates are excluded.",
            "Raw Census input, match and coordinates remain exact. Only the public point rounds to six decimals below 0.1 metre displacement, which is not a survey accuracy claim.",
            "Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. No residential roof is selected."
          ],
          "sources": [
            {
              "url": "https://vantage-dc.com/data-center-locations/",
              "host": "vantage-dc.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Exact separate named campus address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=45+S.+Bullard+Avenue%2C+Goodyear%2C+AZ+85338&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Unique calculated street range and retained county match"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-112.37919792710773%2C33.44620441589253%2C-112.37166151953028%2C33.452492594117466&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Actually viewed setting only, acquisition date unknown"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Approximate campus service area, not a confirmed parcel or building",
      "summary": "Goodyear · Maricopa · Source context reviewed"
    },
    {
      "id": "wintersburg-313-tonopah-az",
      "state": "az",
      "kind": "facility",
      "name": "Wintersburg 313",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Maricopa"
      ],
      "city": "Tonopah",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Wintersburg named county agenda with prior planning recommendation. Agenda is not final Board disposition or an operating permit. Minimum20acres reserved for commercial development is not the data-center footprint. Height standards are not power MW. No reliable current project IT capacity, expenditure or opening from these agenda pages. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2026-05-07",
          "The county June 10 agenda records May 7, 2026 commission recommendations for Wintersburg 313 CPA250011 and Z250034 by seven votes to zero. This is the commission outcome, not proof of the scheduled June 10 Board action, a construction permit or operation."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10316?fileID=100604",
          "host": "maricopa.gov",
          "date": "2026-06-10",
          "published": "2026-06-10",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 32.9881,
        "lng": -112.41021,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "government-primary-review-round7-2026-10-14.json",
          "scope": "Wintersburg named county agenda with prior planning recommendation",
          "fields": {
            "project": "Wintersburg313",
            "county_cases": [
              "CPA250011",
              "Z250034"
            ],
            "owners": [
              "313 Wintersburg LLC",
              "Wintersburg Four LLC"
            ],
            "published_location": "northwest corner of Encanto Boulevard and Wintersburg Road, Tonopah area, Maricopa County, Arizona",
            "planning_commission_recommendation_date": "2026-05-07",
            "planning_commission_recommendation_vote": {
              "for": 7,
              "against": 0
            },
            "board_hearing_agenda_date": "2026-06-10"
          },
          "notes": [
            "Agenda is not final Board disposition or an operating permit. Minimum20acres reserved for commercial development is not the data-center footprint. Height standards are not power MW. No reliable current project IT capacity, expenditure or opening from these agenda pages.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10316?fileID=100604",
              "host": "maricopa.gov",
              "date": "2026-06-10",
              "published": "2026-06-10",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 15",
          "scope": "The June 10, 2026 county planning agenda records May 7 commission recommendations on Wintersburg 313 cases CPA250011 and Z250034. These are recommendations for a comprehensive plan amendment and rezoning, with proposed project conditions. The agenda does not establish the final Board vote, issued construction permits, present work or operation. The broader mixed industrial entitlement does not certify a separate operating data center.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "commission_recommendation_final_board_and_physical_stage_held",
              "scope": "The June 10, 2026 county planning agenda records May 7 commission recommendations on Wintersburg 313 cases CPA250011 and Z250034. These are recommendations for a comprehensive plan amendment and rezoning, with proposed project conditions. The agenda does not establish the final Board vote, issued construction permits, present work or operation. The broader mixed industrial entitlement does not certify a separate operating data center."
            },
            "regulatory_scope": {
              "commission_recommendation_on": "2026-05-07",
              "board_hearing_scheduled_on": "2026-06-10",
              "final_board_outcome_verified": false,
              "project_conditions_not_countywide_rules": true,
              "first_pdf_page_visually_read": true
            }
          },
          "notes": [
            "The June 10, 2026 county planning agenda records May 7 commission recommendations on Wintersburg 313 cases CPA250011 and Z250034. These are recommendations for a comprehensive plan amendment and rezoning, with proposed project conditions. The agenda does not establish the final Board vote, issued construction permits, present work or operation. The broader mixed industrial entitlement does not certify a separate operating data center.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct."
          ],
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10316?fileID=100604",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Tonopah · Maricopa · Source context reviewed",
      "event_evidence": [
        {
          "date": "2026-05-07",
          "text": "The county June 10 agenda records May 7, 2026 commission recommendations for Wintersburg 313 CPA250011 and Z250034 by seven votes to zero. This is the commission outcome, not proof of the scheduled June 10 Board action, a construction permit or operation.",
          "kind": "hearing",
          "sources": [
            {
              "url": "https://www.maricopa.gov/AgendaCenter/ViewFile/Item/10316?fileID=100604",
              "host": "www.maricopa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "04013"
      }
    }
  ],
  "compilation_license": "withheld_pending_owner_decision"
}