{ "schema_version": 1, "source_compilation_context": { "mi": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/mi.json", "updated": "2026-10-24" } }, "scope": "Retained county context, which can be broad or unresolved. No parcel or municipal jurisdiction is inferred. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.", "collection": { "kind": "counties", "key": "26049", "label": "Genesee County, Michigan" }, "records": [ { "id": "hillwood-sterling-buick-city-flint-mi", "state": "mi", "kind": "facility", "name": "Buick City Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Genesee" ], "city": "Flint", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 43.0217, "lng": -83.7067, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo." }, "notes": [ "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Flint · Genesee · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26049" } }, { "id": "otava-mid-michigan-flint-township-mi", "state": "mi", "kind": "facility", "name": "Otava Mid-Michigan Data Center (5225 Exchange Drive)", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Genesee" ], "city": "Flint Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. OTAVA two named Michigan area/power scopes, location crosswalk held. 1.2MWMetroDetroitTOTALbuildingloadnotIT;2500kVAtransformernot2.5MWIT. MidMichigan1600kVAUPSnotcriticalITMW. GeographiclabelsWestland/MidMichigansourceheadingsmisordered;exactmunicipality/streetcrosswalkunresolved. AnnArborfieldsnotadoptedfromunreadleadsection. CompanythreesitesversusotherthreeMIwordingnotsitecensus. No currentmeteredloadorc ertifierreport. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.otava.com/data-center-michigan/", "host": "otava.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.otava.com/data-centers/mid-michigan/", "host": "www.otava.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 43.03663, "lng": -83.723, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "OTAVA two named Michigan area/power scopes, location crosswalk held", "fields": { "operator": "OTAVA", "named_sites": [ { "market": "Mid-Michigan, Genesee County", "total_hosting_area_sqft": 32500, "raised_floor_sqft": 22500, "workplace_recovery_sqft": 10000, "historical_upgrade_investment_usd_min_exclusive": 1000000, "conditioned_ups_apparent_power_kva_min_exclusive": 1600 }, { "market": "Metro Detroit", "standalone_building_sqft": 34500, "raised_floor_sqft": 18000, "total_building_load_capacity_mw": 1.2, "utility_transformer_kva": 2500, "generators": 3, "each_generator_kw": 500 } ] }, "notes": [ "1.2MWMetroDetroitTOTALbuildingloadnotIT;2500kVAtransformernot2.5MWIT. MidMichigan1600kVAUPSnotcriticalITMW. GeographiclabelsWestland/MidMichigansourceheadingsmisordered;exactmunicipality/streetcrosswalkunresolved. AnnArborfieldsnotadoptedfromunreadleadsection. CompanythreesitesversusotherthreeMIwordingnotsitecensus. No currentmeteredloadorc ertifierreport.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.otava.com/data-center-michigan/", "host": "otava.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current original OTAVA Mid Michigan facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "fields": { "current_stage_evidence": { "outcome": "current_named_operator_service", "scope": "The current original OTAVA Mid Michigan facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed." }, "source_read_scope": { "selected_sections": [ "Enterprise grade facility account", "Location details", "Other features", "Service FAQ" ], "named_facility_controls_over_combined_page_heading": true, "technical_quantities_not_exported": true } }, "notes": [ "The current original OTAVA Mid Michigan facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.otava.com/data-centers/mid-michigan/", "host": "www.otava.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Flint Township · Genesee · Source context reviewed", "status_scope": "The current original OTAVA Mid Michigan facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26049" } } ], "compilation_license": "withheld_pending_owner_decision" }