{
  "schema_version": 1,
  "source_compilation_context": {
    "mi": {
      "attribution": {
        "inventory": {
          "name": "Compute Atlas",
          "creator": "Edward Kubiak",
          "url": "https://www.compute-atlas.com/api",
          "license": "CC BY 4.0",
          "license_url": "https://creativecommons.org/licenses/by/4.0/",
          "snapshot_url": "https://www.compute-atlas.com/api/facilities",
          "retrieved": "2026-10-14",
          "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37",
          "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally."
        },
        "counties": "U.S. Census Bureau county boundaries (public domain)",
        "research": "Field-specific source context. See the linked source and limits on each record."
      },
      "source_data_url": "https://datacentersatlas.com/data/mi.json",
      "updated": "2026-10-24"
    }
  },
  "scope": "Retained county context, which can be broad or unresolved. No parcel or municipal jurisdiction is inferred. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.",
  "collection": {
    "kind": "counties",
    "key": "26125",
    "label": "Oakland County, Michigan"
  },
  "records": [
    {
      "id": "123net-dc1-southfield-mi",
      "state": "mi",
      "kind": "facility",
      "name": "123NET Southfield DC1",
      "group": "operating",
      "status": "Reported service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Southfield",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. four named Michigan sections. Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.123.net/data-center-colocation/",
          "host": "123.net",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC1%20(3).pdf",
          "host": "6121234.fs1.hubspotusercontent-na1.net",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Exact current named operator service address section"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24700+Northwestern+Hwy%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Unique calculated street range and county match"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.2429661675863%2C42.467807692374535%2C-83.23444120853969%2C42.47409587059947&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Actually viewed setting, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -83.238704,
        "lat": 42.470952,
        "precision": "address",
        "basis": "Current named 123NET service address 24700 Northwestern Hwy, Southfield, MI 48075 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "four named Michigan sections",
          "fields": {
            "site_sections": [
              {
                "code": "DC1",
                "address": "24700 Northwestern Hwy, Southfield, MI48075",
                "colocation_area_sqft": 80000
              },
              {
                "code": "DC2",
                "address": "24275 Northwestern Hwy, Southfield, MI48075",
                "colocation_area_sqft": 8000
              },
              {
                "code": "DC3",
                "address": "24245 Northwestern Hwy, Southfield, MI48075",
                "colocation_area_sqft": 8000
              },
              {
                "code": "DC4",
                "address": "400 76th St SW, Byron Center, MI49315",
                "colocation_area_sqft": 3500
              }
            ]
          },
          "notes": [
            "Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.123.net/data-center-colocation/",
              "host": "123.net",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 24",
          "scope": "123NET current colocation page explicitly identifies DC1 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "current_operator_named_facility_service_not_generic_regional_announcement",
              "scope": "123NET current colocation page explicitly identifies DC1 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted."
            },
            "source_scope": {
              "specific_facility_code": "DC1",
              "all_four_codes_explicit_in_current_source": true,
              "operator_present_service_statement": true,
              "current_service_check_not_opening_day": true,
              "advertised_sizes_and_certifications_not_promoted": true
            }
          },
          "notes": [
            "123NET current colocation page explicitly identifies DC1 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct."
          ],
          "sources": [
            {
              "url": "https://www.123.net/data-center-colocation/",
              "host": "www.123.net",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 25, October 23, 2026",
          "scope": "Calculated named operator service street reference only. Existing native status remains operating. Protected facts remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -83.238704,
                "lat": 42.470952,
                "precision": "address",
                "basis": "Current named 123NET service address 24700 Northwestern Hwy, Southfield, MI 48075 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "24700 Northwestern Hwy, Southfield, MI 48075",
              "county_fips": [
                "26125"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The exact current operator numeric service street is matched to one Census range in the retained county. This is a calculated service street reference, not a surveyed roof, legal parcel, title, floor, tenant unit or full campus boundary.",
            "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. Operator performance, space, power and completion statements are not adopted.",
            "Raw Census coordinates remain unchanged in source history. Public interpolated coordinates round to six decimal places below 0.1 metre displacement. This is not a survey accuracy claim. Official imagery acquisition date is unknown and may predate construction. No residential roof is selected.",
            "The current named code section links this exact operator brochure, whose first address page was actually viewed. No printed roof rights, completed year, footprint, technical figure or pictured roof is adopted. Brochure publication date is unknown.",
            "The operator explicitly describes this as the DC1 data facility and also its headquarters. The admission comes from the dedicated facility address section, not an unrelated headquarters footer. No corporate mailing address is substituted."
          ],
          "sources": [
            {
              "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC1%20(3).pdf",
              "host": "6121234.fs1.hubspotusercontent-na1.net",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Exact current named operator service address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24700+Northwestern+Hwy%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Unique calculated street range and county match"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.2429661675863%2C42.467807692374535%2C-83.23444120853969%2C42.47409587059947&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Actually viewed setting, acquisition date unknown"
            },
            {
              "url": "https://www.123.net/data-center-colocation/",
              "host": "www.123.net",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Retained exact brochure address page or named current code section"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Operator service address reference, not a surveyed building or parcel",
      "summary": "Southfield · Oakland · Source context reviewed",
      "status_scope": "123NET current colocation page explicitly identifies DC1 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted."
    },
    {
      "id": "123net-dc2-southfield-mi",
      "state": "mi",
      "kind": "facility",
      "name": "123NET Southfield DC2 (Southfield Data Center NW)",
      "group": "operating",
      "status": "Reported service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Southfield",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. four named Michigan sections. Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.123.net/data-center-colocation/",
          "host": "123.net",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24275+Northwestern+Hwy%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Unique calculated street range and county match"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.23893026687816%2C42.464033005753535%2C-83.23040582189785%2C42.47032118397847&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Actually viewed setting, acquisition date unknown"
        },
        {
          "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC2%20(1).pdf",
          "host": "6121234.fs1.hubspotusercontent-na1.net",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Retained exact brochure address page or named current code section"
        }
      ],
      "loc": {
        "lng": -83.234668,
        "lat": 42.467177,
        "precision": "address",
        "basis": "Current named 123NET service address 24275 Northwestern Hwy, Southfield, MI 48075 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "four named Michigan sections",
          "fields": {
            "site_sections": [
              {
                "code": "DC1",
                "address": "24700 Northwestern Hwy, Southfield, MI48075",
                "colocation_area_sqft": 80000
              },
              {
                "code": "DC2",
                "address": "24275 Northwestern Hwy, Southfield, MI48075",
                "colocation_area_sqft": 8000
              },
              {
                "code": "DC3",
                "address": "24245 Northwestern Hwy, Southfield, MI48075",
                "colocation_area_sqft": 8000
              },
              {
                "code": "DC4",
                "address": "400 76th St SW, Byron Center, MI49315",
                "colocation_area_sqft": 3500
              }
            ]
          },
          "notes": [
            "Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.123.net/data-center-colocation/",
              "host": "123.net",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 24",
          "scope": "123NET current colocation page explicitly identifies DC2 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "current_operator_named_facility_service_not_generic_regional_announcement",
              "scope": "123NET current colocation page explicitly identifies DC2 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted."
            },
            "source_scope": {
              "specific_facility_code": "DC2",
              "all_four_codes_explicit_in_current_source": true,
              "operator_present_service_statement": true,
              "current_service_check_not_opening_day": true,
              "advertised_sizes_and_certifications_not_promoted": true
            }
          },
          "notes": [
            "123NET current colocation page explicitly identifies DC2 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct."
          ],
          "sources": [
            {
              "url": "https://www.123.net/data-center-colocation/",
              "host": "www.123.net",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 25, October 23, 2026",
          "scope": "Calculated named operator service street reference only. Existing native status remains operating. Protected facts remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -83.234668,
                "lat": 42.467177,
                "precision": "address",
                "basis": "Current named 123NET service address 24275 Northwestern Hwy, Southfield, MI 48075 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "24275 Northwestern Hwy, Southfield, MI 48075",
              "county_fips": [
                "26125"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The exact current operator numeric service street is matched to one Census range in the retained county. This is a calculated service street reference, not a surveyed roof, legal parcel, title, floor, tenant unit or full campus boundary.",
            "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. Operator performance, space, power and completion statements are not adopted.",
            "Raw Census coordinates remain unchanged in source history. Public interpolated coordinates round to six decimal places below 0.1 metre displacement. This is not a survey accuracy claim. Official imagery acquisition date is unknown and may predate construction. No residential roof is selected.",
            "The current named code section links this exact operator brochure, whose first address page was actually viewed. No printed roof rights, completed year, footprint, technical figure or pictured roof is adopted. Brochure publication date is unknown.",
            "The current named DC2 HTML section gives 48075. Its linked brochure prints 48705. Both originals remain unchanged, including the first Census request using 48705. The accepted query uses 48075 exactly from the current named DC2 section and returns the same street coordinates inside Oakland County. No silent brochure correction or date inference is made."
          ],
          "sources": [
            {
              "url": "https://www.123.net/data-center-colocation/",
              "host": "www.123.net",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Exact current named operator service address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24275+Northwestern+Hwy%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Unique calculated street range and county match"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.23893026687816%2C42.464033005753535%2C-83.23040582189785%2C42.47032118397847&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Actually viewed setting, acquisition date unknown"
            },
            {
              "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC2%20(1).pdf",
              "host": "6121234.fs1.hubspotusercontent-na1.net",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Retained exact brochure address page or named current code section"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Operator service address reference, not a surveyed building or parcel",
      "summary": "Southfield · Oakland · Source context reviewed",
      "status_scope": "123NET current colocation page explicitly identifies DC2 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted."
    },
    {
      "id": "123net-dc3-southfield-mi",
      "state": "mi",
      "kind": "facility",
      "name": "123NET Southfield DC3 (Southfield Data Center W)",
      "group": "operating",
      "status": "Reported service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Southfield",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. four named Michigan sections. Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.123.net/data-center-colocation/",
          "host": "123.net",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC3%20(1).pdf",
          "host": "6121234.fs1.hubspotusercontent-na1.net",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Exact current named operator service address section"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24245+Northwestern+Hwy%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Unique calculated street range and county match"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.23865502844556%2C42.46384816011953%2C-83.23013060863643%2C42.47013633834447&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Actually viewed setting, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -83.234393,
        "lat": 42.466992,
        "precision": "address",
        "basis": "Current named 123NET service address 24245 Northwestern Hwy, Southfield, MI 48075 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "four named Michigan sections",
          "fields": {
            "site_sections": [
              {
                "code": "DC1",
                "address": "24700 Northwestern Hwy, Southfield, MI48075",
                "colocation_area_sqft": 80000
              },
              {
                "code": "DC2",
                "address": "24275 Northwestern Hwy, Southfield, MI48075",
                "colocation_area_sqft": 8000
              },
              {
                "code": "DC3",
                "address": "24245 Northwestern Hwy, Southfield, MI48075",
                "colocation_area_sqft": 8000
              },
              {
                "code": "DC4",
                "address": "400 76th St SW, Byron Center, MI49315",
                "colocation_area_sqft": 3500
              }
            ]
          },
          "notes": [
            "Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.123.net/data-center-colocation/",
              "host": "123.net",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 24",
          "scope": "123NET current colocation page explicitly identifies DC3 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "current_operator_named_facility_service_not_generic_regional_announcement",
              "scope": "123NET current colocation page explicitly identifies DC3 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted."
            },
            "source_scope": {
              "specific_facility_code": "DC3",
              "all_four_codes_explicit_in_current_source": true,
              "operator_present_service_statement": true,
              "current_service_check_not_opening_day": true,
              "advertised_sizes_and_certifications_not_promoted": true
            }
          },
          "notes": [
            "123NET current colocation page explicitly identifies DC3 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct."
          ],
          "sources": [
            {
              "url": "https://www.123.net/data-center-colocation/",
              "host": "www.123.net",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 25, October 23, 2026",
          "scope": "Calculated named operator service street reference only. Existing native status remains operating. Protected facts remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -83.234393,
                "lat": 42.466992,
                "precision": "address",
                "basis": "Current named 123NET service address 24245 Northwestern Hwy, Southfield, MI 48075 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "24245 Northwestern Hwy, Southfield, MI 48075",
              "county_fips": [
                "26125"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The exact current operator numeric service street is matched to one Census range in the retained county. This is a calculated service street reference, not a surveyed roof, legal parcel, title, floor, tenant unit or full campus boundary.",
            "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. Operator performance, space, power and completion statements are not adopted.",
            "Raw Census coordinates remain unchanged in source history. Public interpolated coordinates round to six decimal places below 0.1 metre displacement. This is not a survey accuracy claim. Official imagery acquisition date is unknown and may predate construction. No residential roof is selected.",
            "The current named code section links this exact operator brochure, whose first address page was actually viewed. No printed roof rights, completed year, footprint, technical figure or pictured roof is adopted. Brochure publication date is unknown."
          ],
          "sources": [
            {
              "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC3%20(1).pdf",
              "host": "6121234.fs1.hubspotusercontent-na1.net",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Exact current named operator service address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24245+Northwestern+Hwy%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Unique calculated street range and county match"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.23865502844556%2C42.46384816011953%2C-83.23013060863643%2C42.47013633834447&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Actually viewed setting, acquisition date unknown"
            },
            {
              "url": "https://www.123.net/data-center-colocation/",
              "host": "www.123.net",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Retained exact brochure address page or named current code section"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Operator service address reference, not a surveyed building or parcel",
      "summary": "Southfield · Oakland · Source context reviewed",
      "status_scope": "123NET current colocation page explicitly identifies DC3 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted."
    },
    {
      "id": "365-data-centers-dt1-southfield-mi",
      "state": "mi",
      "kind": "facility",
      "name": "365 Data Centers Detroit (DT1)",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Southfield",
      "address": "",
      "who": "365 Data Centers",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Do not sum redundant UPS units as critical IT capacity or treat the generator as utility supply. No independent uptime verification. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://365datacenters.com/detroit-data-center/",
          "host": "365datacenters.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24660+Lahser+Road%2C+Southfield%2C+MI+48033&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street method and limits"
        },
        {
          "url": "https://365datacenters.com/colocation-services/",
          "host": "365datacenters.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 42.469159136957,
        "lng": -83.260517403519,
        "precision": "address",
        "basis": "Published 365 Data Centers facility address 24660 Lahser Road, Southfield, MI 48033 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "primary-events-round3-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "published_address": "24660 Lahser Road, Southfield, MI 48033",
            "advertised_data_center_sqft": 12000,
            "ups_configuration": {
              "units": 3,
              "kw_per_unit": 203,
              "redundancy": "N+1"
            },
            "backup_generator_kw": 750
          },
          "notes": [
            "Do not sum redundant UPS units as critical IT capacity or treat the generator as utility supply. No independent uptime verification.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://365datacenters.com/detroit-data-center/",
              "host": "365datacenters.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "365 Data Centers lists current customer-care and colocation support at its Detroit-market facility in Southfield. The Detroit market name does not change the municipality. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "365 Data Centers lists current customer-care and colocation support at its Detroit-market facility in Southfield. The Detroit market name does not change the municipality. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "365 Data Centers lists current customer-care and colocation support at its Detroit-market facility in Southfield. The Detroit market name does not change the municipality."
          ],
          "sources": [
            {
              "url": "https://365datacenters.com/detroit-data-center/",
              "host": "365datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 7, October 22, 2026",
          "scope": "Official facility service street reference only. No canonical address, current operation, physical date, capacity, company role, jurisdiction, parcel, complete campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 42.469159136957,
                "lng": -83.260517403519,
                "precision": "address",
                "basis": "Published 365 Data Centers facility address 24660 Lahser Road, Southfield, MI 48033 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "24660 Lahser Road, Southfield, MI 48033",
              "county_fips": [
                "26125"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named operator facility page publishes this service address in its facility location section. Navigation, related facilities, corporate addresses, embedded maps and operator template coordinates are excluded. The canonical address wrapper remains exact; the published address is retained as reviewed location evidence.",
            "The unique Census street match and retained county boundary agree with the existing county. Street interpolation does not identify a roof, suite, floor, campus boundary, legal parcel, ownership or distinct physical building. Status, dates, quantities and jurisdiction remain unchanged."
          ],
          "sources": [
            {
              "url": "https://365datacenters.com/detroit-data-center/",
              "host": "365datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Official named facility street address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24660+Lahser+Road%2C+Southfield%2C+MI+48033&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street method and limits"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 29, October 23, 2026",
          "scope": "365 Data Centers lists the same named facility at the retained first party source URL and separately describes its colocation service relationship. Operator per source records the provider brand relationship. It does not establish legal title, sole control of a shared building or an independent legal entity. The existing name, physical status, dates, address, point, county, quantities, certifications and component identity remain exact. Current service advertising is not a physical milestone or independently measured performance. The source publication date is unknown.",
          "fields": {
            "company_association": {
              "name": "365 Data Centers",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "365 Data Centers lists the same named facility at the retained first party source URL and separately describes its colocation service relationship. Operator per source records the provider brand relationship. It does not establish legal title, sole control of a shared building or an independent legal entity. The existing name, physical status, dates, address, point, county, quantities, certifications and component identity remain exact. Current service advertising is not a physical milestone or independently measured performance. The source publication date is unknown."
            },
            "provider_role": "operator"
          },
          "notes": [
            "365 Data Centers lists the same named facility at the retained first party source URL and separately describes its colocation service relationship. Operator per source records the provider brand relationship. It does not establish legal title, sole control of a shared building or an independent legal entity. The existing name, physical status, dates, address, point, county, quantities, certifications and component identity remain exact. Current service advertising is not a physical milestone or independently measured performance. The source publication date is unknown."
          ],
          "sources": [
            {
              "url": "https://365datacenters.com/detroit-data-center/",
              "host": "365datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            },
            {
              "url": "https://365datacenters.com/colocation-services/",
              "host": "365datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Southfield · Oakland · Source context reviewed",
      "status_scope": "365 Data Centers lists current customer-care and colocation support at its Detroit-market facility in Southfield. The Detroit market name does not change the municipality. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "cogent-troy-big-beaver-mi",
      "state": "mi",
      "kind": "facility",
      "name": "Cogent Troy Data Center (3331 W. Big Beaver Rd)",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Troy",
      "address": "",
      "who": "Cogent Communications",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Detroit/Troy named sections. Distinctsiteaddressesandspaces; GrandRapids/Lansing/Pontiac/FlintedgeaddressesnotadditionalDetroitfloorarea. NoMWadopted. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://cogentco.com/en/cogent-detroit",
          "host": "cogentco.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3331+W.+Big+Beaver+Road%2C+Troy%2C+MI+48084&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Calculated Census street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.19762990277907%2C42.55778239191153%2C-83.18909266091693%2C42.564070570136465&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Aerial setting only, acquisition date unknown"
        },
        {
          "url": "https://www.cogentco.com/en/cogent-detroit",
          "host": "www.cogentco.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Named facility section and separate service street context"
        },
        {
          "url": "https://www.cogentco.com/en/network/service-locations?action=search&page=8&continent=&country=United%20States&state=&metro=&site_type=CDC",
          "host": "www.cogentco.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Exact named facility CDC row, separate from network presence"
        },
        {
          "url": "https://www.cogentco.com/en/network/cogent-data-centers",
          "host": "www.cogentco.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Provider explanation of Cogent data center and colocation relationships"
        }
      ],
      "loc": {
        "lng": -83.193361281848,
        "lat": 42.560926481024,
        "precision": "address",
        "basis": "Published Cogent Communications facility address 3331 W. Big Beaver Road, Troy, MI 48084 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "Detroit/Troy named sections",
          "fields": {
            "site_sections": [
              {
                "city": "Troy",
                "address": "3331 W Big Beaver Road, Troy, MI48084",
                "operator_labeled_space_sqft": 5624
              },
              {
                "city": "Detroit",
                "address": "1320 3rd St, Detroit, MI48226",
                "operator_labeled_space_sqft": 31149
              }
            ]
          },
          "notes": [
            "Distinctsiteaddressesandspaces; GrandRapids/Lansing/Pontiac/FlintedgeaddressesnotadditionalDetroitfloorarea. NoMWadopted.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://cogentco.com/en/cogent-detroit",
              "host": "cogentco.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies its Troy Office and Data Center on Big Beaver Road. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies its Troy Office and Data Center on Big Beaver Road. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "Cogent explicitly offers current Detroit-market colocation and separately identifies its Troy Office and Data Center on Big Beaver Road."
          ],
          "sources": [
            {
              "url": "https://cogentco.com/en/cogent-detroit",
              "host": "cogentco.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 17, October 23, 2026",
          "scope": "Current official facility street reference only. Native protected facts and canonical address remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -83.193361281848,
                "lat": 42.560926481024,
                "precision": "address",
                "basis": "Published Cogent Communications facility address 3331 W. Big Beaver Road, Troy, MI 48084 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "3331 W. Big Beaver Road, Troy, MI 48084",
              "county_fips": [
                "26125"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named official numeric facility section binds the service address to this existing research record. Corporate offices, related facility cards and embedded map coordinates are excluded.",
            "The unique Census calculated street range agrees with the retained state and county. Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. The reference does not locate a surveyed roof, parcel, full campus, legal owner, floor or suite.",
            "All canonical address, status, physical dates, quantity, role, identity and jurisdiction wrappers remain exact. The retained Census method source keeps its actual October 22 date; new captures are dated October 23."
          ],
          "sources": [
            {
              "url": "https://cogentco.com/en/cogent-detroit",
              "host": "cogentco.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Official named Troy Office & Data Center numeric facility address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3331+W.+Big+Beaver+Road%2C+Troy%2C+MI+48084&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Calculated Census street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.19762990277907%2C42.55778239191153%2C-83.18909266091693%2C42.564070570136465&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Aerial setting only, acquisition date unknown"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 28, October 23, 2026",
          "scope": "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes.",
          "fields": {
            "company_association": {
              "name": "Cogent Communications",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes."
          ],
          "sources": [
            {
              "url": "https://www.cogentco.com/en/cogent-detroit",
              "host": "www.cogentco.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Named facility section and separate service street context"
            },
            {
              "url": "https://www.cogentco.com/en/network/service-locations?action=search&page=8&continent=&country=United%20States&state=&metro=&site_type=CDC",
              "host": "www.cogentco.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Exact named facility CDC row, separate from network presence"
            },
            {
              "url": "https://www.cogentco.com/en/network/cogent-data-centers",
              "host": "www.cogentco.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Provider explanation of Cogent data center and colocation relationships"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Troy · Oakland · Source context reviewed",
      "status_scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies its Troy Office and Data Center on Big Beaver Road. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "edgeconnex-det01-mi",
      "state": "mi",
      "kind": "facility",
      "name": "EdgeConneX DET01",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Detroit (Oakland County)",
      "address": "",
      "who": "EdgeConneX",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. 20+kWcabinetand600+WpersquarefootdensitynotfacilityMW; noextrapolationfromgrossfloor. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.edgeconnex.com/locations/americas/detroit-mi/",
          "host": "edgeconnex.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 42.66039,
        "lng": -83.38578,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "operator_site_code": "DET01",
            "facility_area_sqft": 39900,
            "raised_floor_sqft": 9930
          },
          "notes": [
            "20+kWcabinetand600+WpersquarefootdensitynotfacilityMW; noextrapolationfromgrossfloor.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.edgeconnex.com/locations/americas/detroit-mi/",
              "host": "edgeconnex.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "EdgeConneX lists current carrier-neutral colocation, local customer facilities and interconnection at DET01 in the Detroit market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "EdgeConneX lists current carrier-neutral colocation, local customer facilities and interconnection at DET01 in the Detroit market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "EdgeConneX lists current carrier-neutral colocation, local customer facilities and interconnection at DET01 in the Detroit market."
          ],
          "sources": [
            {
              "url": "https://www.edgeconnex.com/locations/americas/detroit-mi/",
              "host": "www.edgeconnex.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check24, October23,2026",
          "scope": "EdgeConneX names this facility or the retained campus components on its current website and offers colocation and facility services there. Operator per source is the attributed provider brand relationship only, not a finding of the legal operating entity or property title. No physical status, coordinates, street address, quantity, cooling volume, air permit, certification, measured reliability, environmental compliance, tenant identity or completed expansion is adopted. First publication dates remain unknown; retrieval does not establish a physical opening date. The exact named DET01 provider section supplies the relationship. Marketing capability and certification statements remain source claims, not independent findings.",
          "fields": {
            "company_association": {
              "name": "EdgeConneX",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "EdgeConneX names this facility or the retained campus components on its current website and offers colocation and facility services there. Operator per source is the attributed provider brand relationship only, not a finding of the legal operating entity or property title. No physical status, coordinates, street address, quantity, cooling volume, air permit, certification, measured reliability, environmental compliance, tenant identity or completed expansion is adopted. First publication dates remain unknown; retrieval does not establish a physical opening date. The exact named DET01 provider section supplies the relationship. Marketing capability and certification statements remain source claims, not independent findings."
            },
            "provider_role": "operator"
          },
          "notes": [
            "EdgeConneX names this facility or the retained campus components on its current website and offers colocation and facility services there. Operator per source is the attributed provider brand relationship only, not a finding of the legal operating entity or property title. No physical status, coordinates, street address, quantity, cooling volume, air permit, certification, measured reliability, environmental compliance, tenant identity or completed expansion is adopted. First publication dates remain unknown; retrieval does not establish a physical opening date. The exact named DET01 provider section supplies the relationship. Marketing capability and certification statements remain source claims, not independent findings."
          ],
          "sources": [
            {
              "url": "https://www.edgeconnex.com/locations/americas/detroit-mi/",
              "host": "www.edgeconnex.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current first party named facility, provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Detroit (Oakland County) · Oakland · Source context reviewed",
      "status_scope": "EdgeConneX lists current carrier-neutral colocation, local customer facilities and interconnection at DET01 in the Detroit market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "26125"
      }
    },
    {
      "id": "liberty-center-one-royal-oak-mi",
      "state": "mi",
      "kind": "facility",
      "name": "Liberty Center One Royal Oak Data Center",
      "group": "operating",
      "status": "Operator-listed service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Royal Oak",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Liberty Center One offices versus data-center site identity. Genericserviceshomepageprovides4815DelemereRoyalOakand1080NimitzviewCincinnatiexplicitOFFICEaddresses;notexactdatacenterproof. ColocationadvertisementdoesnotconfirmbothwholeofficebuildingsareDCs. No numericcapacity,areaoropeningadopted. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://libertycenterone.com/",
          "host": "libertycenterone.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.libertycenterone.com/our-data-center/",
          "host": "www.libertycenterone.com",
          "published": "",
          "date": "",
          "checked": "2026-10-17",
          "label": "Reviewed primary source"
        },
        {
          "url": "https://www.libertycenterone.com/about-us/",
          "host": "www.libertycenterone.com",
          "published": "",
          "date": "",
          "checked": "2026-10-17",
          "label": "Reviewed primary source"
        }
      ],
      "loc": {
        "lat": 42.67584,
        "lng": -83.40265,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round10-2026-10-14.json",
          "scope": "Liberty Center One offices versus data-center site identity",
          "fields": {},
          "notes": [
            "Genericserviceshomepageprovides4815DelemereRoyalOakand1080NimitzviewCincinnatiexplicitOFFICEaddresses;notexactdatacenterproof. ColocationadvertisementdoesnotconfirmbothwholeofficebuildingsareDCs. No numericcapacity,areaoropeningadopted.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://libertycenterone.com/",
              "host": "libertycenterone.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "encore-2026-10-17-batch1",
          "scope": "Limited source identity and stage review; not whole-record certification, parcel verification or a physical-site census.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_service",
              "scope": "Liberty Center One’s own facility and company pages identify current Royal Oak colocation services. This is an operator service context; office coordinates, historical opening details and company-wide capabilities are not independent parcel or occupancy verification."
            }
          },
          "notes": [
            "Liberty Center One’s own facility and company pages identify current Royal Oak colocation services. This is an operator service context; office coordinates, historical opening details and company-wide capabilities are not independent parcel or occupancy verification."
          ],
          "sources": [
            {
              "url": "https://www.libertycenterone.com/our-data-center/",
              "host": "www.libertycenterone.com",
              "published": "",
              "date": "",
              "checked": "2026-10-17",
              "label": "Reviewed primary source"
            },
            {
              "url": "https://www.libertycenterone.com/about-us/",
              "host": "www.libertycenterone.com",
              "published": "",
              "date": "",
              "checked": "2026-10-17",
              "label": "Reviewed primary source"
            },
            {
              "url": "https://libertycenterone.com/",
              "host": "libertycenterone.com",
              "published": "",
              "date": "",
              "checked": "2026-10-17",
              "label": "Reviewed primary source"
            }
          ],
          "checked": "2026-10-17",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": false,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Royal Oak · Oakland · Source context reviewed",
      "status_scope": "Liberty Center One’s own facility and company pages identify current Royal Oak colocation services. This is an operator service context; office coordinates, historical opening details and company-wide capabilities are not independent parcel or occupancy verification.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "26125"
      }
    },
    {
      "id": "managedway-tym1-troy-mi",
      "state": "mi",
      "kind": "facility",
      "name": "ManagedWay TYM1 (319 Executive Drive)",
      "group": "operating",
      "status": "Reported service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Troy",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. ManagedWay Troy two-building identity and rack density. AddresslistdoesnotmapTYM1/TYM2codesbyorder.30pluskWrackcapabilitynotcampusMW/currentaverage.2001customerhistorynotbothbuildingscommissionedthen. SOC/TierIIIplusreportsrestrictednotaccessed;designclaimnotindependentcertification. No streetparcelownershipinspection or exactopeningday. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://managedway.com/colocation-facilities",
          "host": "managedway.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=319+Executive+Drive%2C+Troy%2C+Michigan&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Unique calculated street range and county match"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.10352138368297%2C42.534144285372534%2C-83.09498737422102%2C42.54043246359747&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Actually viewed setting, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -83.099254,
        "lat": 42.537288,
        "precision": "address",
        "basis": "Current named ManagedWay service address 319 Executive Drive, Troy, Michigan matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round10-2026-10-14.json",
          "scope": "ManagedWay Troy two-building identity and rack density",
          "fields": {
            "operator": "ManagedWay",
            "named_building_addresses": [
              "600 Executive Drive, Troy, Michigan",
              "319 Executive Drive, Troy, Michigan"
            ],
            "facilities": 2,
            "available_rack_power_kw_min_exclusive": 30,
            "company_customer_history_since": 2001
          },
          "notes": [
            "AddresslistdoesnotmapTYM1/TYM2codesbyorder.30pluskWrackcapabilitynotcampusMW/currentaverage.2001customerhistorynotbothbuildingscommissionedthen. SOC/TierIIIplusreportsrestrictednotaccessed;designclaimnotindependentcertification. No streetparcelownershipinspection or exactopeningday.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://managedway.com/colocation-facilities",
              "host": "managedway.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 24",
          "scope": "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 319 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "current_two_named_troy_buildings_kept_online_not_planned_availability",
              "scope": "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 319 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged."
            },
            "source_scope": {
              "named_street_facility": "319 Executive Drive",
              "two_troy_buildings_explicit_in_source": true,
              "inherited_code_not_recertified": true,
              "staff_service_account_not_independent_uptime_measurement": true,
              "no_location_or_role_change": true
            }
          },
          "notes": [
            "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 319 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct."
          ],
          "sources": [
            {
              "url": "https://managedway.com/colocation-facilities",
              "host": "managedway.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 25, October 23, 2026",
          "scope": "Calculated named operator service street reference only. Existing native status remains operating. Protected facts remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -83.099254,
                "lat": 42.537288,
                "precision": "address",
                "basis": "Current named ManagedWay service address 319 Executive Drive, Troy, Michigan matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "319 Executive Drive, Troy, Michigan",
              "county_fips": [
                "26125"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The exact current operator numeric service street is matched to one Census range in the retained county. This is a calculated service street reference, not a surveyed roof, legal parcel, title, floor, tenant unit or full campus boundary.",
            "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. Operator performance, space, power and completion statements are not adopted.",
            "Raw Census coordinates remain unchanged in source history. Public interpolated coordinates round to six decimal places below 0.1 metre displacement. This is not a survey accuracy claim. Official imagery acquisition date is unknown and may predate construction. No residential roof is selected.",
            "The operator explicitly describes both 319 and 600 Executive Drive as its two Troy buildings. Each retained record name already states its corresponding numeric Executive Drive street. This address join does not invent a TYM code mapping, split a combined research record or certify independent physical roofs. The operator supplies Troy, Michigan without a postal ZIP; no ZIP is inferred."
          ],
          "sources": [
            {
              "url": "https://managedway.com/colocation-facilities",
              "host": "managedway.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Exact current named operator service address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=319+Executive+Drive%2C+Troy%2C+Michigan&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Unique calculated street range and county match"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.10352138368297%2C42.534144285372534%2C-83.09498737422102%2C42.54043246359747&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Actually viewed setting, acquisition date unknown"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Operator service address reference, not a surveyed building or parcel",
      "summary": "Troy · Oakland · Source context reviewed",
      "status_scope": "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 319 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged."
    },
    {
      "id": "managedway-tym2-troy-mi",
      "state": "mi",
      "kind": "facility",
      "name": "ManagedWay TYM2 (600 Executive Drive)",
      "group": "operating",
      "status": "Reported service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Troy",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. ManagedWay Troy two-building identity and rack density. AddresslistdoesnotmapTYM1/TYM2codesbyorder.30pluskWrackcapabilitynotcampusMW/currentaverage.2001customerhistorynotbothbuildingscommissionedthen. SOC/TierIIIplusreportsrestrictednotaccessed;designclaimnotindependentcertification. No streetparcelownershipinspection or exactopeningday. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://managedway.com/colocation-facilities",
          "host": "managedway.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=600+Executive+Drive%2C+Troy%2C+Michigan&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Unique calculated street range and county match"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.10349674091917%2C42.53690692242353%2C-83.09496235388083%2C42.54319510064847&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Actually viewed setting, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -83.09923,
        "lat": 42.540051,
        "precision": "address",
        "basis": "Current named ManagedWay service address 600 Executive Drive, Troy, Michigan matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round10-2026-10-14.json",
          "scope": "ManagedWay Troy two-building identity and rack density",
          "fields": {
            "operator": "ManagedWay",
            "named_building_addresses": [
              "600 Executive Drive, Troy, Michigan",
              "319 Executive Drive, Troy, Michigan"
            ],
            "facilities": 2,
            "available_rack_power_kw_min_exclusive": 30,
            "company_customer_history_since": 2001
          },
          "notes": [
            "AddresslistdoesnotmapTYM1/TYM2codesbyorder.30pluskWrackcapabilitynotcampusMW/currentaverage.2001customerhistorynotbothbuildingscommissionedthen. SOC/TierIIIplusreportsrestrictednotaccessed;designclaimnotindependentcertification. No streetparcelownershipinspection or exactopeningday.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://managedway.com/colocation-facilities",
              "host": "managedway.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 24",
          "scope": "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 600 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "current_two_named_troy_buildings_kept_online_not_planned_availability",
              "scope": "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 600 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged."
            },
            "source_scope": {
              "named_street_facility": "600 Executive Drive",
              "two_troy_buildings_explicit_in_source": true,
              "inherited_code_not_recertified": true,
              "staff_service_account_not_independent_uptime_measurement": true,
              "no_location_or_role_change": true
            }
          },
          "notes": [
            "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 600 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged.",
            "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct."
          ],
          "sources": [
            {
              "url": "https://managedway.com/colocation-facilities",
              "host": "managedway.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 25, October 23, 2026",
          "scope": "Calculated named operator service street reference only. Existing native status remains operating. Protected facts remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -83.09923,
                "lat": 42.540051,
                "precision": "address",
                "basis": "Current named ManagedWay service address 600 Executive Drive, Troy, Michigan matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "600 Executive Drive, Troy, Michigan",
              "county_fips": [
                "26125"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The exact current operator numeric service street is matched to one Census range in the retained county. This is a calculated service street reference, not a surveyed roof, legal parcel, title, floor, tenant unit or full campus boundary.",
            "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. Operator performance, space, power and completion statements are not adopted.",
            "Raw Census coordinates remain unchanged in source history. Public interpolated coordinates round to six decimal places below 0.1 metre displacement. This is not a survey accuracy claim. Official imagery acquisition date is unknown and may predate construction. No residential roof is selected.",
            "The operator explicitly describes both 319 and 600 Executive Drive as its two Troy buildings. Each retained record name already states its corresponding numeric Executive Drive street. This address join does not invent a TYM code mapping, split a combined research record or certify independent physical roofs. The operator supplies Troy, Michigan without a postal ZIP; no ZIP is inferred."
          ],
          "sources": [
            {
              "url": "https://managedway.com/colocation-facilities",
              "host": "managedway.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Exact current named operator service address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=600+Executive+Drive%2C+Troy%2C+Michigan&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Unique calculated street range and county match"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.10349674091917%2C42.53690692242353%2C-83.09496235388083%2C42.54319510064847&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Actually viewed setting, acquisition date unknown"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Operator service address reference, not a surveyed building or parcel",
      "summary": "Troy · Oakland · Source context reviewed",
      "status_scope": "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 600 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged."
    },
    {
      "id": "metrobloks-southfield-mi",
      "state": "mi",
      "kind": "facility",
      "name": "Metrobloks Southfield Data Center",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Southfield",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.",
      "date": "",
      "events": [
        [
          "2025-12-19",
          "The City of Southfield published its Metrobloks proposal statement on December 19, 2025, describing a recent Council approval and later permitting and oversight. This dates publication, not the exact vote day, construction commencement or computing operation."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/",
          "host": "gandernewsroom.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.cityofsouthfield.com/news/city-southfield-statement-regarding-proposed-data-center",
          "host": "www.cityofsouthfield.com",
          "published": "2025-12-19",
          "date": "2025-12-19",
          "checked": "2026-10-23",
          "label": "Reviewed government record"
        }
      ],
      "loc": {
        "lat": 42.62817,
        "lng": -83.38295,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json",
          "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.",
          "fields": {
            "dated_reported_context": "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo."
          },
          "notes": [
            "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo.",
            "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations."
          ],
          "sources": [
            {
              "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/",
              "host": "gandernewsroom.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 51",
          "scope": "The City original December 19, 2025 account acknowledges community concerns, describes Council approval of the Metrobloks proposal and says independent permits and continuing oversight are still required. Its acknowledgment does not supply a specific attributed concern episode or a final later disposition. The historical proposal approval is not exact current construction or commissioned computing. Claimed future resource and ratepayer benefits remain statements rather than measured impacts.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "historical_city_proposal_approval_not_current_physical_stage",
              "scope": "The City original December 19, 2025 account acknowledges community concerns, describes Council approval of the Metrobloks proposal and says independent permits and continuing oversight are still required. Its acknowledgment does not supply a specific attributed concern episode or a final later disposition. The historical proposal approval is not exact current construction or commissioned computing. Claimed future resource and ratepayer benefits remain statements rather than measured impacts."
            }
          },
          "notes": [
            "The City original December 19, 2025 account acknowledges community concerns, describes Council approval of the Metrobloks proposal and says independent permits and continuing oversight are still required. Its acknowledgment does not supply a specific attributed concern episode or a final later disposition. The historical proposal approval is not exact current construction or commissioned computing. Claimed future resource and ratepayer benefits remain statements rather than measured impacts.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://www.cityofsouthfield.com/news/city-southfield-statement-regarding-proposed-data-center",
              "host": "www.cityofsouthfield.com",
              "published": "2025-12-19",
              "date": "2025-12-19",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Southfield · Oakland · Source context reviewed",
      "event_evidence": [
        {
          "date": "2025-12-19",
          "text": "The City of Southfield published its Metrobloks proposal statement on December 19, 2025, describing a recent Council approval and later permitting and oversight. This dates publication, not the exact vote day, construction commencement or computing operation.",
          "kind": "announced",
          "sources": [
            {
              "url": "https://www.cityofsouthfield.com/news/city-southfield-statement-regarding-proposed-data-center",
              "host": "www.cityofsouthfield.com",
              "published": "2025-12-19",
              "date": "2025-12-19",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "26125"
      }
    },
    {
      "id": "oakland-university-computing-auburn-hills-mi",
      "state": "mi",
      "kind": "facility",
      "name": "Oakland University Campus Computing Facility",
      "group": "proposed",
      "status": "Listed proposal",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Auburn Hills",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/",
          "host": "gandernewsroom.com",
          "date": "2026-10-08",
          "published": "2026-10-08",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.oakland.edu/data-infrastructure/",
          "host": "www.oakland.edu",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Reviewed government record"
        }
      ],
      "loc": {
        "lat": 42.69182,
        "lng": -83.36168,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round34-2026-10-14.json",
          "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.",
          "fields": {
            "reported_context": "TheGander’s MarchURLdirectory explicitly updatedOctober 8 reports named Michiganproject stages:DeepGreenLansingAprilwithdrawal;Pavilionrezoningwithdrawal;Morleyunfiledconcept;HarborFarmzpropertymarketing;Lowellutilitytalksstalled;OaklandUniversityduediligence;Yorkwithdrawal;Solonpauseextension;Tonduunfiledconcept.",
            "independently_verified_current_operating_status": null,
            "site_stage_scope": "Trustees authorized due diligence, not final construction"
          },
          "notes": [
            "Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed.",
            "Later originals and observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/",
              "host": "gandernewsroom.com",
              "date": "2026-10-08",
              "published": "2026-10-08",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 51",
          "scope": "The current original University account calls the Campus Computing Facility proposed and says the project is entering due diligence, with design and construction described as later phases. Its June 2026 authorization to move forward is not a report that physical construction began. Existing computing rooms in Dodge Hall and North Foundation Hall are separate from this proposed facility and do not make it operating. No campus power, predicted revenue, future construction duration or tenant allocation becomes an accomplished facility fact.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "current_university_named_proposal",
              "scope": "The current original University account calls the Campus Computing Facility proposed and says the project is entering due diligence, with design and construction described as later phases. Its June 2026 authorization to move forward is not a report that physical construction began. Existing computing rooms in Dodge Hall and North Foundation Hall are separate from this proposed facility and do not make it operating. No campus power, predicted revenue, future construction duration or tenant allocation becomes an accomplished facility fact."
            },
            "source_read_scope": {
              "selected_sections": [
                "Campus Computing Facility",
                "Frequently Asked Questions introduction",
                "Project Timeline",
                "Steering Committee due diligence schedule"
              ],
              "existing_computing_rooms_not_joined": true,
              "no_calendar_entry_from_month_only_forecast": true
            }
          },
          "notes": [
            "The current original University account calls the Campus Computing Facility proposed and says the project is entering due diligence, with design and construction described as later phases. Its June 2026 authorization to move forward is not a report that physical construction began. Existing computing rooms in Dodge Hall and North Foundation Hall are separate from this proposed facility and do not make it operating. No campus power, predicted revenue, future construction duration or tenant allocation becomes an accomplished facility fact.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://www.oakland.edu/data-infrastructure/",
              "host": "www.oakland.edu",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Auburn Hills · Oakland · Source context reviewed",
      "status_scope": "The current original University account calls the Campus Computing Facility proposed and says the project is entering due diligence, with design and construction described as later phases. Its June 2026 authorization to move forward is not a report that physical construction began. Existing computing rooms in Dodge Hall and North Foundation Hall are separate from this proposed facility and do not make it operating. No campus power, predicted revenue, future construction duration or tenant allocation becomes an accomplished facility fact.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "26125"
      }
    },
    {
      "id": "sansone-wixom-road-mi",
      "state": "mi",
      "kind": "facility",
      "name": "Wixom Road Data Center Campus",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Wixom",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.. Developer Sansone is not named in readable roundup and exact parcel crosswalk remains unconfirmed. Denial concerns a moratorium exemption, not necessarily final land-use denial. Reported pause through end of August does not establish October status. Lansing 182-day pause, Saline 12-year 50% property-tax action and $43 billion valuation concern separate jurisdictions/projects; statewide historical $13 million tax breaks are not an award to this Wixom proposal. Governor plan and voluntary commitments are not enacted legislation. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://civicmedia.us/news/2026/07/20/michigan-data-centers-the-weekly-download-2",
          "host": "civicmedia.us",
          "date": "2026-07-20",
          "published": "2026-07-20",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 42.65242,
        "lng": -83.43082,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round32-2026-10-14.json",
          "scope": "Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.",
          "fields": {
            "reported_context": "Michigan Advance’s weekly roundup republished by Civic Media reports Wixom unanimously denied a requested waiver for a proposed 54-acre Wixom Road data center site.",
            "independently_verified_current_operating_status": null,
            "operator_or_exact_site_identity_needs_crosswalk": true
          },
          "notes": [
            "Developer Sansone is not named in readable roundup and exact parcel crosswalk remains unconfirmed. Denial concerns a moratorium exemption, not necessarily final land-use denial. Reported pause through end of August does not establish October status. Lansing 182-day pause, Saline 12-year 50% property-tax action and $43 billion valuation concern separate jurisdictions/projects; statewide historical $13 million tax breaks are not an award to this Wixom proposal. Governor plan and voluntary commitments are not enacted legislation.",
            "Original approvals and later observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://civicmedia.us/news/2026/07/20/michigan-data-centers-the-weekly-download-2",
              "host": "civicmedia.us",
              "date": "2026-07-20",
              "published": "2026-07-20",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Wixom · Oakland · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "26125"
      }
    },
    {
      "id": "springfield-township-andersonville-road-data-center-mi",
      "state": "mi",
      "kind": "facility",
      "name": "Springfield Township Data Center Proposal (Andersonville Road & White Lake Road, 84 acres)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Springfield Township",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Springfield official change from DC inquiry to storage and offices. This is a changed property-owner direction after earlier DC inquiry, not an operating data center. Future storage/office proposal not automatically completed. Posted resident groundwater analysis explicitly not groundwater-flow model or prediction of harm. Linked moratorium title does not establish exact enacted expiry without underlying decision. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.springfield-twp.us/departments/supervisor/data_centers/latest_updates.php",
          "host": "springfield-twp.us",
          "date": "2026-08-27",
          "published": "2026-08-27",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 42.63294,
        "lng": -83.34263,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "public-institution-review-round11-2026-10-14.json",
          "scope": "Springfield official change from DC inquiry to storage and offices",
          "fields": {
            "agency": "Springfield Township, Michigan",
            "update_date": "2026-08-27",
            "owner_meeting_date": "2026-08-26",
            "parcel": "07-36-401-012",
            "site_acres_approx": 84.49,
            "location": "Andersonville Road and White Lake Road",
            "agency_reported_current_direction": "owner pursuing high-end storage and office development; property not presently available for other development"
          },
          "notes": [
            "This is a changed property-owner direction after earlier DC inquiry, not an operating data center. Future storage/office proposal not automatically completed. Posted resident groundwater analysis explicitly not groundwater-flow model or prediction of harm. Linked moratorium title does not establish exact enacted expiry without underlying decision.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.springfield-twp.us/departments/supervisor/data_centers/latest_updates.php",
              "host": "springfield-twp.us",
              "date": "2026-08-27",
              "published": "2026-08-27",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Springfield Township · Oakland · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "26125"
      }
    },
    {
      "id": "us-signal-mi04-southfield-mi",
      "state": "mi",
      "kind": "facility",
      "name": "US Signal MI04 Detroit Data Center",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Southfield",
      "address": "",
      "who": "US Signal",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://ussignal.com/data-centers/mi04-detroit/",
          "host": "ussignal.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=21648+Melrose+Avenue%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street method and limits"
        }
      ],
      "loc": {
        "lat": 42.447358816771,
        "lng": -83.256306955815,
        "precision": "address",
        "basis": "Published US Signal facility address 21648 Melrose Avenue, Southfield, MI 48075 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "operator_site_code": "MI04",
            "published_address": "21648 Melrose Avenue, Southfield, MI48075",
            "generator_kw": 800,
            "ups_kw": 250,
            "utility_kva": 1500,
            "operator_reported_year_built": 1972
          },
          "notes": [
            "Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://ussignal.com/data-centers/mi04-detroit/",
              "host": "ussignal.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "US Signal lists MI04 in Southfield as a current second-site offering for customer infrastructure in the Detroit market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "US Signal lists MI04 in Southfield as a current second-site offering for customer infrastructure in the Detroit market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "US Signal lists MI04 in Southfield as a current second-site offering for customer infrastructure in the Detroit market."
          ],
          "sources": [
            {
              "url": "https://ussignal.com/data-centers/mi04-detroit/",
              "host": "ussignal.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 8, October 22, 2026",
          "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 42.447358816771,
                "lng": -83.256306955815,
                "precision": "address",
                "basis": "Published US Signal facility address 21648 Melrose Avenue, Southfield, MI 48075 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "21648 Melrose Avenue, Southfield, MI 48075",
              "county_fips": [
                "26125"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named official facility source publishes this service address. Corporate headquarters, related locations and maps are excluded. The blank native address wrapper remains exact, with the facility address retained only in reviewed location evidence.",
            "The unique Census street match and retained county boundary agree with the existing county. A calculated street reference does not establish a roof, floor, suite, full campus boundary, parcel, title or independent physical building. Status, dates, capacity and jurisdiction remain exact."
          ],
          "sources": [
            {
              "url": "https://ussignal.com/data-centers/mi04-detroit/",
              "host": "ussignal.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Official named facility street address block"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=21648+Melrose+Avenue%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street method and limits"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 27, October 23, 2026",
          "scope": "US Signal identifies the retained MI04 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts.",
          "fields": {
            "company_association": {
              "name": "US Signal",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "US Signal identifies the retained MI04 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts."
            },
            "provider_role": "operator"
          },
          "notes": [
            "US Signal identifies the retained MI04 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts."
          ],
          "sources": [
            {
              "url": "https://ussignal.com/data-centers/mi04-detroit/",
              "host": "ussignal.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current named MI04 provider relationship"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Southfield · Oakland · Source context reviewed",
      "status_scope": "US Signal lists MI04 in Southfield as a current second-site offering for customer infrastructure in the Detroit market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "us-signal-mi05-auburn-hills-mi",
      "state": "mi",
      "kind": "facility",
      "name": "US Signal MI05 Detroit Data Center",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Auburn Hills",
      "address": "",
      "who": "US Signal",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://ussignal.com/data-centers/mi05-detroit/",
          "host": "ussignal.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1035+W+Entrance+Drive%2C+Auburn+Hills%2C+MI+48326&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street method and limits"
        }
      ],
      "loc": {
        "lat": 42.652878188853,
        "lng": -83.214963570537,
        "precision": "address",
        "basis": "Published US Signal facility address 1035 W Entrance Drive, Auburn Hills, MI 48326 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "operator_site_code": "MI05",
            "published_address": "1035 W Entrance Drive, Auburn Hills, MI48326",
            "generator_kw": 6000,
            "ups_kw": 4000,
            "utility_kva": 4000,
            "operator_reported_year_built": null
          },
          "notes": [
            "Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://ussignal.com/data-centers/mi05-detroit/",
              "host": "ussignal.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "US Signal lists its purpose-built MI05 facility in Auburn Hills for current and future high-density customer deployments. Future scaling is not certified as energized capacity. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "US Signal lists its purpose-built MI05 facility in Auburn Hills for current and future high-density customer deployments. Future scaling is not certified as energized capacity. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "US Signal lists its purpose-built MI05 facility in Auburn Hills for current and future high-density customer deployments. Future scaling is not certified as energized capacity."
          ],
          "sources": [
            {
              "url": "https://ussignal.com/data-centers/mi05-detroit/",
              "host": "ussignal.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 8, October 22, 2026",
          "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 42.652878188853,
                "lng": -83.214963570537,
                "precision": "address",
                "basis": "Published US Signal facility address 1035 W Entrance Drive, Auburn Hills, MI 48326 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "1035 W Entrance Drive, Auburn Hills, MI 48326",
              "county_fips": [
                "26125"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named official facility source publishes this service address. Corporate headquarters, related locations and maps are excluded. The blank native address wrapper remains exact, with the facility address retained only in reviewed location evidence.",
            "The unique Census street match and retained county boundary agree with the existing county. A calculated street reference does not establish a roof, floor, suite, full campus boundary, parcel, title or independent physical building. Status, dates, capacity and jurisdiction remain exact."
          ],
          "sources": [
            {
              "url": "https://ussignal.com/data-centers/mi05-detroit/",
              "host": "ussignal.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Official named facility street address block"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1035+W+Entrance+Drive%2C+Auburn+Hills%2C+MI+48326&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street method and limits"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 27, October 23, 2026",
          "scope": "US Signal identifies the retained MI05 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts.",
          "fields": {
            "company_association": {
              "name": "US Signal",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "US Signal identifies the retained MI05 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts."
            },
            "provider_role": "operator"
          },
          "notes": [
            "US Signal identifies the retained MI05 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts."
          ],
          "sources": [
            {
              "url": "https://ussignal.com/data-centers/mi05-detroit/",
              "host": "ussignal.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current named MI05 provider relationship"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Auburn Hills · Oakland · Source context reviewed",
      "status_scope": "US Signal lists its purpose-built MI05 facility in Auburn Hills for current and future high-density customer deployments. Future scaling is not certified as energized capacity. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "verrus-project-flex-lyon-township-oakland-county-mi",
      "state": "mi",
      "kind": "facility",
      "name": "Project Flex",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Oakland"
      ],
      "city": "Lyon Township",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original reporter/issuer named-project context, with inference and stages explicit.. BrianAllnutt PlanetDetroit January13,2026 originalLyonmeetingreport. ProjectFlexconditionalSeptember8siteplanapprovalpendingindependentnoise/energyaudits, notfinalauthorization.6buildings/172acres/1.8Msfproposalonecampus. Alphabetinvestmentinparent notGoogleoperatororAnthropictenantproof. January7study44dBAforecastEXCLUDESdiesel; primaryBESSunder4hour/secondarydiesellongeroutages conflictwithsimplifiednodieselexecutivequote. No110dBAgenericmachinevalueassiteboundarynoise; noactualwellcontamination/healthharmfromresidentconcern.12monthmoratoriumwasresidentREQUESTnotenacted. Jan15/22meetings/Feb8questionshistorical, no outreachactions. Plans/historicalchanges/courtallegations/utilitycustomerinference not all-field,siteITorcurrentoperatingcertification.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://planetdetroit.org/2026/01/lyon-township-data-center-plan/",
          "host": "planetdetroit.org",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 42.71449,
        "lng": -83.40032,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "national-withdrawals-power-redesign-and-review-stage-round79-2026-10-15.json",
          "scope": "Original reporter/issuer named-project context, with inference and stages explicit.",
          "fields": {},
          "notes": [
            "BrianAllnutt PlanetDetroit January13,2026 originalLyonmeetingreport. ProjectFlexconditionalSeptember8siteplanapprovalpendingindependentnoise/energyaudits, notfinalauthorization.6buildings/172acres/1.8Msfproposalonecampus. Alphabetinvestmentinparent notGoogleoperatororAnthropictenantproof.",
            "January7study44dBAforecastEXCLUDESdiesel; primaryBESSunder4hour/secondarydiesellongeroutages conflictwithsimplifiednodieselexecutivequote. No110dBAgenericmachinevalueassiteboundarynoise; noactualwellcontamination/healthharmfromresidentconcern.12monthmoratoriumwasresidentREQUESTnotenacted. Jan15/22meetings/Feb8questionshistorical, no outreachactions.",
            "Plans/historicalchanges/courtallegations/utilitycustomerinference not all-field,siteITorcurrentoperatingcertification."
          ],
          "sources": [
            {
              "url": "https://planetdetroit.org/2026/01/lyon-township-data-center-plan/",
              "host": "planetdetroit.org",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": false,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Lyon Township · Oakland · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "26125"
      }
    }
  ],
  "compilation_license": "withheld_pending_owner_decision"
}