{ "schema_version": 1, "source_compilation_context": { "mi": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/mi.json", "updated": "2026-10-24" } }, "scope": "Retained county context, which can be broad or unresolved. No parcel or municipal jurisdiction is inferred. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.", "collection": { "kind": "counties", "key": "26163", "label": "Wayne County, Michigan" }, "records": [ { "id": "cogent-detroit-1320-3rd-st-mi", "state": "mi", "kind": "facility", "name": "Cogent Detroit Data Center (1320 3rd St)", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Detroit", "address": "", "who": "Cogent Communications", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Generic multiple-options power gives no MW. Two area blocks need brochure mapping before assigning to Detroit versus Troy. Operator explicitly separates Detroit, Troy and Michigan edge sites. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Detroit/Troy named sections. Distinctsiteaddressesandspaces; GrandRapids/Lansing/Pontiac/FlintedgeaddressesnotadditionalDetroitfloorarea. NoMWadopted.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1320+3rd+St%2C+Detroit%2C+MI+48226&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Calculated Census street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.06063717329927%2C42.32730684259353%2C-83.05213128220272%2C42.333595020818464&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Aerial setting only, acquisition date unknown" }, { "url": "https://www.cogentco.com/en/cogent-detroit", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Named facility section and separate service street context" }, { "url": "https://www.cogentco.com/en/network/service-locations?action=search&page=3&continent=&country=United%20States&state=&metro=&site_type=CDC", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact named facility CDC row, separate from network presence" }, { "url": "https://www.cogentco.com/en/network/cogent-data-centers", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Provider explanation of Cogent data center and colocation relationships" } ], "loc": { "lng": -83.056384227751, "lat": 42.330450931706, "precision": "address", "basis": "Published Cogent Communications facility address 1320 3rd St, Detroit, MI 48226 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding." }, "reviewed_evidence": [ { "overlay": "field-verification-2026-10-14.json", "scope": "Field or source context only", "fields": { "street": "1320 3rd St", "city": "Detroit", "marketed_service": "colocation" }, "notes": [ "Generic multiple-options power gives no MW.", "Two area blocks need brochure mapping before assigning to Detroit versus Troy.", "Operator explicitly separates Detroit, Troy and Michigan edge sites.", "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "Detroit/Troy named sections", "fields": { "site_sections": [ { "city": "Troy", "address": "3331 W Big Beaver Road, Troy, MI48084", "operator_labeled_space_sqft": 5624 }, { "city": "Detroit", "address": "1320 3rd St, Detroit, MI48226", "operator_labeled_space_sqft": 31149 } ] }, "notes": [ "Distinctsiteaddressesandspaces; GrandRapids/Lansing/Pontiac/FlintedgeaddressesnotadditionalDetroitfloorarea. NoMWadopted.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies the Detroit data center on Third Street, distinct from its Troy facility and other edge sites. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies the Detroit data center on Third Street, distinct from its Troy facility and other edge sites. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "Cogent explicitly offers current Detroit-market colocation and separately identifies the Detroit data center on Third Street, distinct from its Troy facility and other edge sites." ], "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 16, October 23, 2026", "scope": "Current official facility street reference only. Native protected facts and canonical address remain exact.", "fields": { "location_review_decision": { "location": { "lng": -83.056384227751, "lat": 42.330450931706, "precision": "address", "basis": "Published Cogent Communications facility address 1320 3rd St, Detroit, MI 48226 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "1320 3rd St, Detroit, MI 48226", "county_fips": [ "26163" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named official numeric facility section binds the service address to this existing research record. Corporate offices, related facility cards and embedded map coordinates are excluded.", "The unique Census calculated street range agrees with the retained state and county. Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. The reference does not locate a surveyed roof, parcel, full campus, legal owner, floor or suite.", "All canonical address, status, physical dates, quantity, role, identity and jurisdiction wrappers remain exact. The retained Census method source keeps its actual October 22 date; new captures are dated October 23." ], "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Official named Detroit Data Center numeric facility address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1320+3rd+St%2C+Detroit%2C+MI+48226&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Calculated Census street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.06063717329927%2C42.32730684259353%2C-83.05213128220272%2C42.333595020818464&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Aerial setting only, acquisition date unknown" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check 28, October 23, 2026", "scope": "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes. The service table labels 1320 3rd Avenue, while the named Detroit facility page labels 1320 3rd St. That street wording conflict is retained without changing the existing address or point.", "fields": { "company_association": { "name": "Cogent Communications", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes. The service table labels 1320 3rd Avenue, while the named Detroit facility page labels 1320 3rd St. That street wording conflict is retained without changing the existing address or point." }, "provider_role": "operator" }, "notes": [ "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes. The service table labels 1320 3rd Avenue, while the named Detroit facility page labels 1320 3rd St. That street wording conflict is retained without changing the existing address or point." ], "sources": [ { "url": "https://www.cogentco.com/en/cogent-detroit", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Named facility section and separate service street context" }, { "url": "https://www.cogentco.com/en/network/service-locations?action=search&page=3&continent=&country=United%20States&state=&metro=&site_type=CDC", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact named facility CDC row, separate from network presence" }, { "url": "https://www.cogentco.com/en/network/cogent-data-centers", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Provider explanation of Cogent data center and colocation relationships" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Detroit · Wayne · Source context reviewed", "status_scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies the Detroit data center on Third Street, distinct from its Troy facility and other edge sites. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "detroit-shoemaker-street-data-center-mi", "state": "mi", "kind": "facility", "name": "Shoemaker Street Data Center Proposal (11031 & 11081 Shoemaker St, Detroit east side)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Detroit", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.28249, "lng": -83.28262, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo." }, "notes": [ "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Detroit · Wayne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "otava-metro-detroit-westland-mi", "state": "mi", "kind": "facility", "name": "Otava Metro Detroit Data Center", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Westland", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. OTAVA two named Michigan area/power scopes, location crosswalk held. 1.2MWMetroDetroitTOTALbuildingloadnotIT;2500kVAtransformernot2.5MWIT. MidMichigan1600kVAUPSnotcriticalITMW. GeographiclabelsWestland/MidMichigansourceheadingsmisordered;exactmunicipality/streetcrosswalkunresolved. AnnArborfieldsnotadoptedfromunreadleadsection. CompanythreesitesversusotherthreeMIwordingnotsitecensus. No currentmeteredloadorc ertifierreport. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.otava.com/data-center-michigan/", "host": "otava.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.otava.com/data-centers/metro-detroit/", "host": "www.otava.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 42.29671, "lng": -83.29815, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "OTAVA two named Michigan area/power scopes, location crosswalk held", "fields": { "operator": "OTAVA", "named_sites": [ { "market": "Mid-Michigan, Genesee County", "total_hosting_area_sqft": 32500, "raised_floor_sqft": 22500, "workplace_recovery_sqft": 10000, "historical_upgrade_investment_usd_min_exclusive": 1000000, "conditioned_ups_apparent_power_kva_min_exclusive": 1600 }, { "market": "Metro Detroit", "standalone_building_sqft": 34500, "raised_floor_sqft": 18000, "total_building_load_capacity_mw": 1.2, "utility_transformer_kva": 2500, "generators": 3, "each_generator_kw": 500 } ] }, "notes": [ "1.2MWMetroDetroitTOTALbuildingloadnotIT;2500kVAtransformernot2.5MWIT. MidMichigan1600kVAUPSnotcriticalITMW. GeographiclabelsWestland/MidMichigansourceheadingsmisordered;exactmunicipality/streetcrosswalkunresolved. AnnArborfieldsnotadoptedfromunreadleadsection. CompanythreesitesversusotherthreeMIwordingnotsitecensus. No currentmeteredloadorc ertifierreport.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.otava.com/data-center-michigan/", "host": "otava.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current original OTAVA Metro Detroit facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "fields": { "current_stage_evidence": { "outcome": "current_named_operator_service", "scope": "The current original OTAVA Metro Detroit facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed." }, "source_read_scope": { "selected_sections": [ "Enterprise grade facility account", "Location details", "Other features", "Service FAQ" ], "named_facility_controls_over_combined_page_heading": true, "technical_quantities_not_exported": true } }, "notes": [ "The current original OTAVA Metro Detroit facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.otava.com/data-centers/metro-detroit/", "host": "www.otava.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Westland · Wayne · Source context reviewed", "status_scope": "The current original OTAVA Metro Detroit facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "project-cannoli-van-buren-township-wayne-county-mi", "state": "mi", "kind": "project", "name": "Project Cannoli", "group": "building", "status": "Site work reported", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center development", "counties": [ "Wayne" ], "city": "Van Buren Township", "address": "", "who": "Panattoni", "end_user": "Google (announced participant)", "mw": null, "power": "1,000 MW original maximum utility-service request (March 17, 2026)", "power_note": "Original March 17, 2026 DTE requested maximum utility load, not IT, metered demand or delivered power. The adjustable December 2027 to December 2028 ramp is a plan, not an opening. October 1 utility-contract approval is conditional; acceptance and fulfillment are not verified.", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Cannoli official FAQ with quoted utility load schedule. Town FAQ quotes utility testimony, underlying contract/order not read in this row. Load ramp adjustable.2.7GWnew generation/resource portfolio is not site capacity and not additive to1GW. Development-agreement link does not prove executed effective terms. Ratepayer protection statements are not measured bill outcomes. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-03-17", "Google announced a Michigan data-center/energy collaboration and said it was evaluating Van Buren Township. The later county statement identifies Cannoli; the date is not final-plan approval, site-work commencement or 2700 MW of site IT capacity." ], [ "2026-02-11", "Van Buren Township Planning Commission granted Project Cannoli preliminary site plan approval with conditions, 5–2. This is a preliminary planning milestone, not final plan approval, an issued building permit, satisfied conditions or operation." ], [ "2026-10-01", "MPSC conditionally approved DTE and Google electricity contracts in U-22058. Acceptance and other conditions apply; this is a utility-contract milestone, not local siting or construction permission, completed obligations, energized service or operation." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://vbtmi.gov/departments/municipal_services/data_center_faq.php", "host": "vbtmi.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.panattoni.com/vanburen/", "host": "www.panattoni.com", "published": "", "date": "", "checked": "2026-10-16", "label": "Developer Project Cannoli design and proposed water supplier" }, { "url": "https://www.waynecountymi.gov/News/Commission/Wayne-County-Commission-Van-Buren-%E2%80%9CProject-Cannoli%E2%80%9D-Data-Center-Statement", "host": "www.waynecountymi.gov", "published": "2026-10-01", "date": "2026-10-01", "checked": "2026-10-16", "label": "Wayne County public statement, extracted text view" }, { "url": "https://blog.google/innovation-and-ai/infrastructure-and-cloud/global-network/clean-energy-reliability-michigan/", "host": "blog.google", "published": "2026-03-17", "date": "2026-03-17", "checked": "2026-10-16", "label": "Michigan development and grid-resource announcement" }, { "url": "https://www.datacenters.google/locations/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Current Google location directory; flags are not status proof" }, { "url": "https://www.wemu.org/wemu-news/2026-10-15/van-buren-township-planning-commission-approves-data-center-plan", "host": "www.wemu.org", "published": "2026-10-15", "date": "2026-10-15", "checked": "2026-10-16", "label": "WEMU reporting of preliminary work and a plan vote" }, { "url": "https://vbtmi.gov/Document_Center/Agendas%20&%20Minutes/Planning%20Commission/2024/Minutes/2-11-26%20PC%20Min.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "February 11, 2026 planning minutes, page 20: preliminary approval with conditions" }, { "url": "https://vbtmi.gov/Document_Center/Agendas%20&%20Minutes/Planning%20Commission/2024/Packets/10-14-26%20PC%20Packet.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "October 14, 2026 agenda packet; August staff reviews and proposed final plans" }, { "url": "https://vbtmi.gov/Document_Center/Department/Municipal%20Services/Development%20Agreement%20VBT%202026.05.20%20final.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "Posted development agreement; blank developer and township signature pages" }, { "url": "https://vbtmi.gov/government/agendas___minutes/planning_commission.php", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "Planning commission document index checked October 16, 2026" }, { "url": "https://mi-psc.my.site.com/sfc/servlet.shepherd/version/download/068cs00002YBZ99AAH", "host": "mi-psc.my.site.com", "published": "2026-10-01", "date": "2026-10-01", "checked": "2026-10-16", "label": "October 1, 2026 MPSC order U-22058-0187; operative provisions pages 137 to 141" }, { "url": "https://mi-psc.my.site.com/sfc/servlet.shepherd/version/download/068cs00001pUwYcAAK", "host": "mi-psc.my.site.com", "published": "2026-03-17", "date": "2026-03-17", "checked": "2026-10-16", "label": "March 17, 2026 original DTE application/testimony; maximum requested load and adjustable ramp, PDF page 10" } ], "loc": { "lat": 42.25283, "lng": -83.28002, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "Cannoli official FAQ with quoted utility load schedule", "fields": { "project_name": "Cannoli", "published_location_description": "nearI94andHaggertyRoad,VanBurenTownship,Michigan", "site_maximum_contract_load_mw": 1000, "contract_load_basis": "maximum customer load,not explicitly criticalIT", "utility_testimony_quoted_load_ramp_start_month": "2027-12", "utility_testimony_quoted_max_load_month": "2028-12", "separate_new_grid_resource_capacity_gw": 2.7 }, "notes": [ "Town FAQ quotes utility testimony, underlying contract/order not read in this row. Load ramp adjustable.2.7GWnew generation/resource portfolio is not site capacity and not additive to1GW. Development-agreement link does not prove executed effective terms. Ratepayer protection statements are not measured bill outcomes.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://vbtmi.gov/departments/municipal_services/data_center_faq.php", "host": "vbtmi.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Google pending-location follow-up October 16", "scope": "Explicit existing-record identity, source confidence and phase review. No new physical site, parcel, whole-campus completion, whole-state refresh or automatic directory-flag status.", "fields": { "identity_scope": "The existing Project Cannoli ID is retained. Wayne County explicitly identifies the proposed Google Van Buren Township project as Cannoli; Panattoni names itself developer. No new Google Michigan ID is created.", "provider_roles": [ { "name": "Panattoni", "role": "developer" }, { "name": "Google", "role": "planned operator" } ], "google_role_scope": "Google is the announced data-center participant; the planned-operator role is a scoped interpretation of Google's own development announcement/current directory and the county identity bridge. No current operator, legal parcel owner, signed tenancy or corporate parent is certified.", "reported_site_work_scope": "WEMU's October 15 report says preliminary construction has begun. Site work is reported, not independently inspected data-hall construction, delivered capacity or operation. The developer's proposed-campus wording is retained; the primary final-plan decision and conditions have not been read.", "reported_plan_vote": { "report_published_on": "2026-10-15", "body_vote_day": "Wednesday", "image_caption_meeting_date": "2026-10-15", "normalized_exact_vote_date": null, "scope": "The report describes final-plan approval but its caption date and weekday differ. No exact approval milestone is invented, and no issued building/occupancy permission or legal condition is asserted." }, "county_tax_scope": "The October 1 county statement links Google/Cannoli but expressly separates its tax-benefit veto override from construction authorization and a development agreement. Its October 14 final-plan review was prospective on October 1. Estimated incentives and promised community payments are not realized savings or paid benefits.", "water_supply_design": "Panattoni names Great Lakes Water Authority supply and designs without groundwater use. This is a prospective developer commitment, not an independently read water contract, permit, measured withdrawal or zero total water use.", "environmental_design_scope": "Panattoni describes no discharge to Belleville Lake/ground, Tier 4 backup generators and noise/landscape design commitments. These are design statements, not issued permits, operating test results, zero emissions or proven legal compliance.", "power_scope": "The 2.7 GW DTE collaboration describes a grid resource portfolio, not site IT capacity. Inherited FAQ-quoted 1000 MW maximum contract load and ramp dates remain unnormalized until their underlying utility documents are reviewed.", "location_scope": "The approximate inherited point remains unchanged. Road descriptions, developer renderings, the county statement and news are not a reviewed parcel or exact building pin." }, "notes": [ "Keep each source type, date and confidence visible. Reported activity is not a site inspection, legal permission, complete campus or current metered demand.", "All inherited geometry, addresses, jurisdictions, legacy MW, investment, jobs and opening fields remain unchanged.", "WEMU is secondary reporting, not a primary approval record. Its road label I-95 conflicts with the inherited official I-94 context; no address or point is changed. The caption/weekday conflict keeps an exact approval date unset." ], "sources": [ { "url": "https://www.panattoni.com/vanburen/", "host": "www.panattoni.com", "published": "", "date": "", "checked": "2026-10-16", "label": "Developer Project Cannoli design and proposed water supplier" }, { "url": "https://www.waynecountymi.gov/News/Commission/Wayne-County-Commission-Van-Buren-%E2%80%9CProject-Cannoli%E2%80%9D-Data-Center-Statement", "host": "www.waynecountymi.gov", "published": "2026-10-01", "date": "2026-10-01", "checked": "2026-10-16", "label": "Wayne County public statement, extracted text view" }, { "url": "https://blog.google/innovation-and-ai/infrastructure-and-cloud/global-network/clean-energy-reliability-michigan/", "host": "blog.google", "published": "2026-03-17", "date": "2026-03-17", "checked": "2026-10-16", "label": "Michigan development and grid-resource announcement" }, { "url": "https://www.datacenters.google/locations/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Current Google location directory; flags are not status proof" }, { "url": "https://www.wemu.org/wemu-news/2026-10-15/van-buren-township-planning-commission-approves-data-center-plan", "host": "www.wemu.org", "published": "2026-10-15", "date": "2026-10-15", "checked": "2026-10-16", "label": "WEMU reporting of preliminary work and a plan vote" } ], "checked": "2026-10-16", "whole_record_certified": false }, { "overlay": "Primary project scope and county-only location review, October 16, 2026", "scope": "Bounded primary-source planning and location review; current physical activity is separately sourced.", "fields": { "preliminary_plan_decision": { "meeting_date": "2026-02-11", "document_page": 20, "action": "Preliminary site plan approval with conditions", "vote": { "yes": 5, "no": 2 }, "applicant": "PDC AK LPIC, LLC c/o Panattoni Development Company", "planned_buildings": { "data_processing": 3, "administrative_office": 1, "network_service": 1 }, "scope": "Historical preliminary approval only; not final plan approval, building permit, satisfied conditions, actual building construction or operation." }, "preliminary_approval_conditions": { "document_page": 20, "development_agreement": "Township Board authorization required before final site plan approval, including GLWA main connection/meter details, sanitary discharge limits and metering, recurring noise monitoring, construction access and phasing.", "sewer_discharge_limit_million_gallons_per_day": 0.75, "water_scope": "Condition concerning sewer discharge, not measured water consumption, water withdrawal or an operating discharge permit." }, "october_final_plan_review": { "agenda_date": "2026-10-14", "agenda_case": "25-041", "staff_review_date": "2026-08-19", "plans_date": "2026-07-29", "document_pages": [ 1, 14, 15 ], "proposed_buildings": { "data_processing": 3, "administrative_office": 1, "network_service": 2 }, "campus_area_acres": 282.2, "separate_switching_station": true, "scope": "Final-plan agenda and dated staff review, not the October vote, fulfilled conditions or issued construction permission." }, "proposed_area_conflict": { "document_pages": [ 14, 15 ], "narrative_footprint_sqft": 973247, "table_footprint_sqft": 973364, "table_gross_floor_area_sqft": 1423112, "office_footprint_revision_sqft": 117, "scope": "Different stated proposed design measures retained verbatim as numbers; no constructed area, reconciled survey, IT load or building count census inferred." }, "plan_location_scope": { "document_pages": [ 1, 2, 14 ], "bounds": "East of Haggerty Road, north of I-94 North Service Drive, west of Hannan Road, south of Wayne County Community College and I-275.", "agency_address_not_site": "46425 Tyler Road is the Township address, not the data center street address.", "separate_temporary_yard": { "case": "26-013", "parcel_ids": [ "83-051-99-0001-004", "83-051-99-0002-701", "83-051-99-0002-702" ], "scope": "Corby Energy temporary construction yard across Haggerty; not adopted as Cannoli campus parcels." }, "precise_parcel_or_map_point_adopted": false, "scope": "The inherited approximate point still needs explicit plan-to-authoritative-geometry review." }, "engineering_review_conditions": { "letter_date": "2026-08-20", "document_pages": [ 24, 25 ], "engineering_plans_submitted_on": "2026-07-03", "initial_engineering_review_on": "2026-08-07", "proposed_glwa_connection": "24-inch water main toward the GLWA main within Tyler Road, with connection, meter and engineering details to finalize.", "phase_three_timing": null, "permit_scope": "Staff says the plan summary lists County SESC and EGLE NPDES permits as obtained, but requests the actual approvals. Their numbers, issuance and conditions have not been independently verified here.", "scope": "Staff review and planned utility design; not final engineering approval, measured water demand, confirmed permit issuance or completed infrastructure." }, "posted_agreement_execution_limits": { "printed_date": "2026-05-19", "document_pages": [ 16, 17 ], "developer_name": "PDC VBT, LLC", "developer_signature_blank": true, "township_signatures_blank": true, "execution_verified": false, "effective_agreement_date_verified": false, "scope": "Posted text contains a stated effective date and legal description but blank signatures/notarial fields. Filename final and upload/PDF creation dates do not establish execution, recordation or satisfied terms." }, "primary_final_decision_hold": { "checked_on": "2026-10-16", "index_latest_minutes_linked": "2026-09-23", "october_14_packet_linked": true, "october_14_minutes_link_found": false, "normalized_final_vote_date": null, "scope": "No October 14 minutes link found on the checked public index; absence of a link does not establish that no minutes or decision exists. The earlier reported vote/caption date conflict remains unresolved." } }, "notes": [ "Historical February preliminary decision has exact date and conditions; October packet is not adopted minutes.", "Physical activity retains its separately cited Site work reported label and secondary-report confidence. No new current-stage, power, water, opening, building or parcel claim." ], "sources": [ { "url": "https://vbtmi.gov/Document_Center/Agendas%20&%20Minutes/Planning%20Commission/2024/Minutes/2-11-26%20PC%20Min.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "February 11, 2026 planning minutes, page 20: preliminary approval with conditions" }, { "url": "https://vbtmi.gov/Document_Center/Agendas%20&%20Minutes/Planning%20Commission/2024/Packets/10-14-26%20PC%20Packet.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "October 14, 2026 agenda packet; August staff reviews and proposed final plans" }, { "url": "https://vbtmi.gov/Document_Center/Department/Municipal%20Services/Development%20Agreement%20VBT%202026.05.20%20final.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "Posted development agreement; blank developer and township signature pages" }, { "url": "https://vbtmi.gov/government/agendas___minutes/planning_commission.php", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "Planning commission document index checked October 16, 2026" }, { "url": "https://vbtmi.gov/departments/municipal_services/data_center_faq.php", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "Township Project Cannoli FAQ and public document links" } ], "checked": "2026-10-16", "whole_record_certified": false }, { "overlay": "S6-Cannoli-Utility-20261016", "scope": "Selected primary utility-order and original requested-load evidence only. Conditional electricity contracts are separate from physical stage, local planning permission, fulfilled conditions, parcel identity, IT capacity and actual consumption.", "fields": { "utility_case_identity": { "docket": "U-22058", "filing": "U-22058-0187", "order_date": "2026-10-01", "customer": "Google LLC", "utility": "DTE Electric Company", "location_scope": "Van Buren Township, Michigan", "pages": [ 1, 2 ], "scope": "Order describes the proposed Google facility and its service agreements. The existing Cannoli/Google association remains separately supported by the county statement and company announcement; no new record, operator-role change or parcel identity is inferred." }, "original_utility_request": { "application_date": "2026-03-17", "maximum_requested_load_mw": 1000, "contract_capacity_mw": 1000, "adjustable_planned_ramp_start": "2027-12", "adjustable_planned_ramp_end": "2028-12", "construction_load_may_precede_ramp": true, "pdf_page": 10, "scope": "Original applicant testimony, not a current measured load, IT capacity, actual energization or opening. The later conditional order is a separate legal milestone; the original requested figure is not reclassified as delivered or unconditionally approved service." }, "conditional_utility_approval": { "date": "2026-10-01", "decision": "conditional approval of PSA and CCAA", "physical_construction_or_operation_certified": false, "scope": "The historical utility-contract decision does not establish final local planning approval, an issued building/air/water permit, completed conditions, energized service or data-hall construction." }, "operative_conditions": { "A": { "pages": [ 138 ], "requirement": "Conditionally approves the March 17 primary supply and clean capacity accelerator agreements with Google." }, "B": { "pages": [ 137, 138 ], "requirement": "Conditions approval on cost-coverage representations and requires DTE to file express acceptance of all conditions within 30 days of the order. The cost-shifting protection has the footnote 19 exclusion." }, "C": { "pages": [ 138 ], "requirement": "Requires operating parameters to be updated as necessary for regulatory, reliability and transmission requirements before and after energization." }, "D": { "pages": [ 138 ], "requirement": "Removes caps on Google or DTE contributions toward line extension and electric infrastructure upgrades needed to serve Google." }, "E": { "pages": [ 139 ], "requirement": "Requires the financial compensation mechanism to be treated as ordinary income." }, "F": { "pages": [ 139 ], "requirement": "Requires same-year retirement and clean-energy-plan use of transferred renewable credits when removed from DTE renewable portfolio standard compliance." }, "G": { "pages": [ 139 ], "requirement": "Requires supplements to U-22168 integrated resource/clean energy plans within 21 days, comparing loads with and without Google, separately and combined with Green Chile, and modeling extension of credit-transfer/demand-response arrangements beyond May 31, 2033." }, "H": { "pages": [ 139, 140 ], "requirement": "Requires renewable-plan supplements within 21 days comparing Google and combined Green Chile loads, non-per-meter surcharge options and equitable incremental compliance cost recovery." }, "I": { "pages": [ 140 ], "requirement": "Requires a new contested application for updated interconnection procedures and a draft battery import/export tariff within 120 days." }, "J": { "pages": [ 140 ], "requirement": "Requires the next capacity demonstration to analyze Google and Green Chile loads separately and together using the stated direct loss-of-load method." }, "K": { "pages": [ 140 ], "requirement": "Requires energy-waste-reduction coordination plus analysis of incremental costs for the 2 percent savings target and related surcharges." }, "L": { "pages": [ 140, 141 ], "requirement": "Requires the next general rate case to include interconnection cost allocation and rate design proposals, six studies and reproducible supporting data, under seal if necessary." }, "M": { "pages": [ 141 ], "requirement": "Requires an application reviewing termination payments and collateral within three years after load-ramp completion." }, "N": { "pages": [ 141 ], "requirement": "Requires quarterly and annual reporting beginning April 15, 2027." }, "O": { "pages": [ 141 ], "requirement": "Consolidates renewable-plan case U-22057 into U-22168 for future amended renewable-plan filings; this is docket administration, not a merger of physical data center projects." } }, "acceptance_and_revision_requirements": { "express_acceptance_within_days": 30, "revised_special_contract_within_days_if_revision_needed": 30, "acceptance_filing_verified": false, "revised_contract_verified": false, "all_conditions_fulfilled_verified": false, "pages": [ 137, 138 ], "scope": "The order requires acceptance. Revised contracts are required only if DTE finds a revision necessary because of the conditions. This review does not establish whether later filings exist or whether compliance is complete; it makes no delinquency or noncompliance finding." }, "cost_protection_scope": { "pages": [ 137, 138 ], "footnote": 19, "choice_customer_exclusion": true, "universal_no_rate_impact_guarantee": false, "measured_bill_outcome_verified": false, "scope": "The order conditions approval on Google covering costs and assigns collateral shortfall risk to DTE. Its other-customer protection excludes customers not paying power supply costs, such as choice customers; footnote 19 reports the Staff finding that those customers will pay more. This is the stated order and cited analysis, not an observed bill outcome." }, "regulatory_followup_scope": { "resource_plan_case": "U-22168", "renewable_plan_case_consolidated_from": "U-22057", "resource_supplement_within_days": 21, "new_interconnection_tariff_application_within_days": 120, "reporting_begins": "2027-04-15", "collateral_review_within_years_after_ramp_completion": 3, "fulfillment_verified": false, "scope": "These are prospective requirements in the order. No completed filings, new scheduled job or fulfilled obligation is inferred; Green Chile combined-load analysis does not merge the sites or add their capacities." }, "physical_stage_and_location_limits": { "status_change": false, "location_change": false, "street_address_adopted": false, "parcel_geometry_adopted": false, "opening_date_adopted": false, "scope": "The original testimony describes about 280 acres, while local planning material uses 282.2 acres. Those are differently scoped plan descriptions, not a survey, title or permission to relocate the inherited approximate point. Site work reported retains its separate secondary confidence." }, "quantity_separation": { "legacy_mw_changed": false, "it_capacity_adopted": false, "approved_service_adopted": false, "metered_power_adopted": false, "grid_resources_added_to_request": false, "scope": "The original 1000 MW requested service is not added to renewable, storage, capacity-credit or regional grid-resource figures and is not normalized to IT load. No water quantity is introduced." }, "source_date_and_review_scope": { "order_date": "2026-10-01", "application_date": "2026-03-17", "checked": "2026-10-16", "order_pdf_pages_text_read": [ 1, 2, 3, 137, 138, 139, 140, 141 ], "order_pdf_pages_visually_checked": [ 1, 2, 137, 138, 139, 140, 141 ], "testimony_pdf_pages_text_and_visually_checked": [ 10 ], "whole_documents_certified": false, "scope": "Local October 16 capture/check date is separate from document dates and UTC October 17 response timestamps. Only the specified pages underpin this field review; no full 147-page order or 250-page filing audit is claimed." } }, "notes": [ "October 1 utility-contract approval is conditional. DTE acceptance, any required revisions and later compliance remain unverified. The order has an explicit choice-customer cost-protection exclusion. Original requested load and adjustable ramp are not delivered power or an opening. Site work reported retains its own secondary source; the point remains approximate." ], "sources": [ { "url": "https://mi-psc.my.site.com/sfc/servlet.shepherd/version/download/068cs00002YBZ99AAH", "host": "mi-psc.my.site.com", "published": "2026-10-01", "date": "2026-10-01", "checked": "2026-10-16", "label": "October 1, 2026 MPSC order U-22058-0187; operative provisions pages 137 to 141" }, { "url": "https://mi-psc.my.site.com/sfc/servlet.shepherd/version/download/068cs00001pUwYcAAK", "host": "mi-psc.my.site.com", "published": "2026-03-17", "date": "2026-03-17", "checked": "2026-10-16", "label": "March 17, 2026 original DTE application/testimony; maximum requested load and adjustable ramp, PDF page 10" }, { "url": "https://www.waynecountymi.gov/News/Commission/Wayne-County-Commission-Van-Buren-%E2%80%9CProject-Cannoli%E2%80%9D-Data-Center-Statement", "host": "www.waynecountymi.gov", "published": "2026-10-01", "date": "2026-10-01", "checked": "2026-10-16", "label": "Wayne County public statement, extracted text view" }, { "url": "https://vbtmi.gov/Document_Center/Agendas%20&%20Minutes/Planning%20Commission/2024/Packets/10-14-26%20PC%20Packet.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "October 14, 2026 agenda packet; August staff reviews and proposed final plans" } ], "checked": "2026-10-16", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Van Buren Township · Wayne · Source context reviewed", "search_extra": "Google Van Buren Township Project Cannoli Panattoni", "status_scope": "WEMU's October 15 report says preliminary construction has begun. Site work is reported, not independently inspected data-hall construction, delivered capacity or operation. The developer's proposed-campus wording is retained; the primary final-plan decision and conditions have not been read.", "event_evidence": [ { "date": "2026-03-17", "text": "Google announced a Michigan data-center/energy collaboration and said it was evaluating Van Buren Township. The later county statement identifies Cannoli; the date is not final-plan approval, site-work commencement or 2700 MW of site IT capacity.", "kind": "announced", "sources": [ { "url": "https://blog.google/innovation-and-ai/infrastructure-and-cloud/global-network/clean-energy-reliability-michigan/", "host": "blog.google", "published": "2026-03-17", "date": "2026-03-17", "checked": "2026-10-16", "label": "Michigan development and grid-resource announcement" } ] }, { "date": "2026-02-11", "text": "Van Buren Township Planning Commission granted Project Cannoli preliminary site plan approval with conditions, 5–2. This is a preliminary planning milestone, not final plan approval, an issued building permit, satisfied conditions or operation.", "kind": "approved", "sources": [ { "url": "https://vbtmi.gov/Document_Center/Agendas%20&%20Minutes/Planning%20Commission/2024/Minutes/2-11-26%20PC%20Min.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "February 11, 2026 planning minutes, page 20: preliminary approval with conditions" } ] }, { "date": "2026-10-01", "text": "MPSC conditionally approved DTE and Google electricity contracts in U-22058. Acceptance and other conditions apply; this is a utility-contract milestone, not local siting or construction permission, completed obligations, energized service or operation.", "kind": "approved", "sources": [ { "url": "https://mi-psc.my.site.com/sfc/servlet.shepherd/version/download/068cs00002YBZ99AAH", "host": "mi-psc.my.site.com", "published": "2026-10-01", "date": "2026-10-01", "checked": "2026-10-16", "label": "October 1, 2026 MPSC order U-22058-0187; operative provisions pages 137 to 141" } ] } ], "typed_water_facts": [ { "measure": "supply_source", "value": "Planned Great Lakes Water Authority supply without groundwater use.", "unit": null, "as_of": null, "as_of_basis": "not_published", "observed_on": "2026-10-16", "basis": "operator_reported_statement", "scope": "Undated developer design commitment only. Not an executed water contract, a permit, measured withdrawal/consumption or zero total water use.", "sources": [ "https://www.panattoni.com/vanburen/" ] } ], "typed_power_facts": [ { "measure": "utility_service_request", "value": 1000, "unit": "MW", "basis": "requested", "as_of": "2026-03-17", "as_of_basis": "source_dated", "observed_on": "2026-10-16", "scope": "Original March 17 DTE applicant testimony, PDF page 10: 1000 MW maximum requested/contract load with an adjustable December 2027 to December 2028 ramp. Construction load may precede that ramp. Not measured demand, IT capacity, actual energization, an opening date or unconditionally approved service; the October 1 conditional utility order is recorded separately.", "sources": [ "https://mi-psc.my.site.com/sfc/servlet.shepherd/version/download/068cs00001pUwYcAAK" ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "raeden-detroit-carrier-hotel-mi", "state": "mi", "kind": "facility", "name": "Raeden Detroit Carrier Hotel (615 W Lafayette)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Detroit", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. RAEDEN two Detroit properties and power-scope separation. 500kVAUPSnotcriticalIT;linked3MWplusnotautomatically615Lafayettecapacity.1050Woodward3MWSCALABLEpotentialnotactualenergizedIT. Distinctaddressesnotonephysicalbuilding. No originalopeningorindependentwholecarrierhotelownership. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://raeden.com/data-centers/detroit/", "host": "raeden.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.31143, "lng": -83.26043, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "RAEDEN two Detroit properties and power-scope separation", "fields": { "operator": "RAEDEN", "named_detroit_sites": [ { "address": "615 WestLafayetteBoulevard, Detroit, Michigan", "ups_apparent_power_kva": 500, "network_link": "directly connected to3MWplusenterprisecolocation" }, { "address": "1050 WoodwardAvenue, Detroit, Michigan", "alias": "One Campus Martius", "colocation_space_sqft": 10000, "scalable_power_mw_max": 3 } ] }, "notes": [ "500kVAUPSnotcriticalIT;linked3MWplusnotautomatically615Lafayettecapacity.1050Woodward3MWSCALABLEpotentialnotactualenergizedIT. Distinctaddressesnotonephysicalbuilding. No originalopeningorindependentwholecarrierhotelownership.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://raeden.com/data-centers/detroit/", "host": "raeden.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current original provider page describes colocation and Remote Hands at 615 West Lafayette and advertises available space and ready infrastructure. These offerings and connection claims do not explicitly establish commissioned computing for this exact component in this bounded review. The page separately describes 1050 Woodward and a future mirror site. Their service, power and floor area are not transferred to the inherited Lafayette record.", "fields": { "current_stage_evidence": { "outcome": "available_colocation_not_explicit_current_computing", "scope": "The current original provider page describes colocation and Remote Hands at 615 West Lafayette and advertises available space and ready infrastructure. These offerings and connection claims do not explicitly establish commissioned computing for this exact component in this bounded review. The page separately describes 1050 Woodward and a future mirror site. Their service, power and floor area are not transferred to the inherited Lafayette record." }, "source_read_scope": { "selected_section": "615 West Lafayette", "separate_1050_woodward_component_excluded": true } }, "notes": [ "The current original provider page describes colocation and Remote Hands at 615 West Lafayette and advertises available space and ready infrastructure. These offerings and connection claims do not explicitly establish commissioned computing for this exact component in this bounded review. The page separately describes 1050 Woodward and a future mirror site. Their service, power and floor area are not transferred to the inherited Lafayette record.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://raeden.com/data-centers/detroit/", "host": "raeden.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Detroit · Wayne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "raeden-gibraltar-mclouth-mi", "state": "mi", "kind": "facility", "name": "Gibraltar Data Center (former McLouth Steel site)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Gibraltar", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://raeden.com/data-center-faqs-and-impact/", "host": "raeden.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 42.27516, "lng": -83.32409, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo." }, "notes": [ "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current original company FAQ refers to design plans and studies shared with Gibraltar, but its general performance statements do not establish exact current construction or commissioned computing at the former McLouth property. Generic noise comparisons are not site measurements, and a stated willingness to share materials is not evidence those underlying studies were read. Exact current project physical stage remains unknown.", "fields": { "current_stage_evidence": { "outcome": "company_community_faq_not_gibraltar_physical_stage", "scope": "The current original company FAQ refers to design plans and studies shared with Gibraltar, but its general performance statements do not establish exact current construction or commissioned computing at the former McLouth property. Generic noise comparisons are not site measurements, and a stated willingness to share materials is not evidence those underlying studies were read. Exact current project physical stage remains unknown." }, "source_read_scope": { "selected_sections": [ "Noise and community information references to Gibraltar" ], "underlying_engineering_studies_not_read": true, "no_project_quantity_exported": true } }, "notes": [ "The current original company FAQ refers to design plans and studies shared with Gibraltar, but its general performance statements do not establish exact current construction or commissioned computing at the former McLouth property. Generic noise comparisons are not site measurements, and a stated willingness to share materials is not evidence those underlying studies were read. Exact current project physical stage remains unknown.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://raeden.com/data-center-faqs-and-impact/", "host": "raeden.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Gibraltar · Wayne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "raeden-one-campus-martius-detroit-mi", "state": "mi", "kind": "facility", "name": "Raeden One Campus Martius (1050 Woodward)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Detroit", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.. RAEDENoperatorpageidentifies1050Woodward/OneCampusMartiusDetroit10000sfcolocation,up-to3MWSCALABLEpower. NoIT/grossbasis,currentcommittedorcommissioned3MWverified. Separate615WLafayette500kVAUPS andconnected3MW+colocation cannotbeadded/copiedtoOCM. TwoRAEDENmanagedhubsitesnotproofownswholebuildings. 1-6monthmarketingcallnotactualRFS. Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://raeden.com/data-centers/detroit/", "host": "raeden.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.25722, "lng": -83.2429, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-and-government-review-round46-2026-10-14.json", "scope": "Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.", "fields": { "named_original_context": "RAEDENoperatorpageidentifies1050Woodward/OneCampusMartiusDetroit10000sfcolocation,up-to3MWSCALABLEpower. NoIT/grossbasis,currentcommittedorcommissioned3MWverified. Separate615WLafayette500kVAUPS andconnected3MW+colocation cannotbeadded/copiedtoOCM. TwoRAEDENmanagedhubsitesnotproofownswholebuildings. 1-6monthmarketingcallnotactualRFS." }, "notes": [ "RAEDENoperatorpageidentifies1050Woodward/OneCampusMartiusDetroit10000sfcolocation,up-to3MWSCALABLEpower. NoIT/grossbasis,currentcommittedorcommissioned3MWverified. Separate615WLafayette500kVAUPS andconnected3MW+colocation cannotbeadded/copiedtoOCM. TwoRAEDENmanagedhubsitesnotproofownswholebuildings. 1-6monthmarketingcallnotactualRFS.", "Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol." ], "sources": [ { "url": "https://raeden.com/data-centers/detroit/", "host": "raeden.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 52", "scope": "The current original provider page separately describes 1050 Woodward Avenue as One Campus Martius and offers purpose built colocation and Remote Hands. It describes scalable potential and available space, not explicit exact current computing occupancy or commissioned service in this bounded review. The distinct 615 West Lafayette premise and future mirror site are not this building. No capacity, facility identity, role or location changes are made.", "fields": { "current_stage_evidence": { "outcome": "available_space_and_scalable_power_current_stage_held", "scope": "The current original provider page separately describes 1050 Woodward Avenue as One Campus Martius and offers purpose built colocation and Remote Hands. It describes scalable potential and available space, not explicit exact current computing occupancy or commissioned service in this bounded review. The distinct 615 West Lafayette premise and future mirror site are not this building. No capacity, facility identity, role or location changes are made." }, "source_read_scope": { "selected_section": "1050 Woodward Avenue", "separate_lafayette_component_not_transferred": true } }, "notes": [ "The current original provider page separately describes 1050 Woodward Avenue as One Campus Martius and offers purpose built colocation and Remote Hands. It describes scalable potential and available space, not explicit exact current computing occupancy or commissioned service in this bounded review. The distinct 615 West Lafayette premise and future mirror site are not this building. No capacity, facility identity, role or location changes are made.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://raeden.com/data-centers/detroit/", "host": "raeden.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Detroit · Wayne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "solstice-data-allen-park-mi", "state": "mi", "kind": "facility", "name": "Allen Park Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Allen Park", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.3323, "lng": -83.29601, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo." }, "notes": [ "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Allen Park · Wayne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "us-signal-mi03-van-buren-township-mi", "state": "mi", "kind": "facility", "name": "US Signal MI03 Detroit Data Center", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Belleville", "address": "", "who": "US Signal", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening. Belleville postal city does not independently resolve Van Buren Township municipal/parcel boundary. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ussignal.com/data-centers/mi03-detroit/", "host": "ussignal.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=9275+Haggerty+Road%2C+Belleville%2C+MI+48111&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "loc": { "lat": 42.235623390647, "lng": -83.445062189884, "precision": "address", "basis": "Published US Signal facility address 9275 Haggerty Road, Belleville, MI 48111 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "operator_site_code": "MI03", "published_address": "9275 Haggerty Road, Belleville, MI48111", "generator_kw": 2000, "ups_kw": 1500, "utility_kva": 2500, "operator_reported_year_built": 2020 }, "notes": [ "Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening.", "Belleville postal city does not independently resolve Van Buren Township municipal/parcel boundary.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi03-detroit/", "host": "ussignal.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "US Signal describes MI03 as a recently expanded customer facility supporting AI and edge workloads. Expansion and power quantities are not adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "US Signal describes MI03 as a recently expanded customer facility supporting AI and edge workloads. Expansion and power quantities are not adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "US Signal describes MI03 as a recently expanded customer facility supporting AI and edge workloads. Expansion and power quantities are not adopted." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi03-detroit/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 8, October 22, 2026", "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 42.235623390647, "lng": -83.445062189884, "precision": "address", "basis": "Published US Signal facility address 9275 Haggerty Road, Belleville, MI 48111 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "9275 Haggerty Road, Belleville, MI 48111", "county_fips": [ "26163" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named official facility source publishes this service address. Corporate headquarters, related locations and maps are excluded. The blank native address wrapper remains exact, with the facility address retained only in reviewed location evidence.", "The unique Census street match and retained county boundary agree with the existing county. A calculated street reference does not establish a roof, floor, suite, full campus boundary, parcel, title or independent physical building. Status, dates, capacity and jurisdiction remain exact." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi03-detroit/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named facility street address block" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=9275+Haggerty+Road%2C+Belleville%2C+MI+48111&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 27, October 23, 2026", "scope": "US Signal identifies the retained MI03 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts.", "fields": { "company_association": { "name": "US Signal", "role": "operator", "identity_scope": "provider_brand_only", "scope": "US Signal identifies the retained MI03 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts." }, "provider_role": "operator" }, "notes": [ "US Signal identifies the retained MI03 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi03-detroit/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Current named MI03 provider relationship" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Belleville · Wayne · Source context reviewed", "status_scope": "US Signal describes MI03 as a recently expanded customer facility supporting AI and edge workloads. Expansion and power quantities are not adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } ], "compilation_license": "withheld_pending_owner_decision" }