{ "schema_version": 1, "source_compilation_context": { "pa": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/pa.json", "updated": "2026-10-24" } }, "scope": "Retained county context, which can be broad or unresolved. No parcel or municipal jurisdiction is inferred. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.", "collection": { "kind": "counties", "key": "42077", "label": "Lehigh County, Pennsylvania" }, "records": [ { "id": "air-products-cetronia-road-upper-macungie-pa", "state": "pa", "kind": "facility", "name": "Cetronia Road Data Center (former Air Products site)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lehigh" ], "city": "Trexlertown", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. LehighValleyNews originalNov12/13,2025report:AirProducts194acformerHQproposal2.6Msf,applicationstillprocessed/notpublicthen. Originalwarehouse2023approvalnotDCpermit.22.2Mtaxassessedvalue notsaleprice/capex. Generic500000homescomparisonnotmeasuredsiteMW. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations. WFMZMay27,2026hearingreportnames7300Cetronia/3buildings,denialofcontinuance andsimilar-use relief. OralhearingdenialdistinctfromwrittenJulydecision;45daywrittendecision/30dayappealreportedprocedure,notindependentlegaldeadlinecalculation. NoactualMWwaterorpermitcertification. Aug12,2026LehighValleyPublicMediaquotesAirProductsspokesman:companydidnotappeal,andhasnofuturepropertyuse/ownershipdecisiontoannounce. ReportedAug5appealdeadline,notcomputedlegaladvice;writtenJulydecisionafterMay27hearing.194ac2.6MsfDCproposalabandoned,notdemolitionofoperatingcampus. PrologisdealwasearlierWAREHOUSEplanandneverclosed,notDCoperator.95000gpd/930cars19truckstrafficwereSTUDYPROJECTIONSnotmeasureduse;23.2Massessmentnotcapex.22.2Moldassessmentdifferentdate.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.lehighvalleynews.com/business/giant-data-center-proposal-in-upper-macungie-township-is-in-the-works", "host": "lehighvalleynews.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.wfmz.com/news/area/lehighvalley/lehigh-county/western-lehigh-county/upper-macungie-zoners-reject-appeal-for-massive-data-center-campus-on-former-air-products-site/article_c531b72e-e928-4562-bcbf-3dbc7e9ce3e8.html", "host": "wfmz.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.lehighvalleypublicmedia.org/news/all/air-products-abandons-plan-for-data-center-at-former-upper-macungie-headquarters/", "host": "lehighvalleypublicmedia.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.61264, "lng": -75.59243, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "LehighValleyNews originalNov12/13,2025report:AirProducts194acformerHQproposal2.6Msf,applicationstillprocessed/notpublicthen. Originalwarehouse2023approvalnotDCpermit.22.2Mtaxassessedvalue notsaleprice/capex. Generic500000homescomparisonnotmeasuredsiteMW." }, "notes": [ "LehighValleyNews originalNov12/13,2025report:AirProducts194acformerHQproposal2.6Msf,applicationstillprocessed/notpublicthen. Originalwarehouse2023approvalnotDCpermit.22.2Mtaxassessedvalue notsaleprice/capex. Generic500000homescomparisonnotmeasuredsiteMW.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.lehighvalleynews.com/business/giant-data-center-proposal-in-upper-macungie-township-is-in-the-works", "host": "lehighvalleynews.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "WFMZMay27,2026hearingreportnames7300Cetronia/3buildings,denialofcontinuance andsimilar-use relief. OralhearingdenialdistinctfromwrittenJulydecision;45daywrittendecision/30dayappealreportedprocedure,notindependentlegaldeadlinecalculation. NoactualMWwaterorpermitcertification." }, "notes": [ "WFMZMay27,2026hearingreportnames7300Cetronia/3buildings,denialofcontinuance andsimilar-use relief. OralhearingdenialdistinctfromwrittenJulydecision;45daywrittendecision/30dayappealreportedprocedure,notindependentlegaldeadlinecalculation. NoactualMWwaterorpermitcertification.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.wfmz.com/news/area/lehighvalley/lehigh-county/western-lehigh-county/upper-macungie-zoners-reject-appeal-for-massive-data-center-campus-on-former-air-products-site/article_c531b72e-e928-4562-bcbf-3dbc7e9ce3e8.html", "host": "wfmz.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "Aug12,2026LehighValleyPublicMediaquotesAirProductsspokesman:companydidnotappeal,andhasnofuturepropertyuse/ownershipdecisiontoannounce. ReportedAug5appealdeadline,notcomputedlegaladvice;writtenJulydecisionafterMay27hearing.194ac2.6MsfDCproposalabandoned,notdemolitionofoperatingcampus. PrologisdealwasearlierWAREHOUSEplanandneverclosed,notDCoperator.95000gpd/930cars19truckstrafficwereSTUDYPROJECTIONSnotmeasureduse;23.2Massessmentnotcapex.22.2Moldassessmentdifferentdate." }, "notes": [ "Aug12,2026LehighValleyPublicMediaquotesAirProductsspokesman:companydidnotappeal,andhasnofuturepropertyuse/ownershipdecisiontoannounce. ReportedAug5appealdeadline,notcomputedlegaladvice;writtenJulydecisionafterMay27hearing.194ac2.6MsfDCproposalabandoned,notdemolitionofoperatingcampus. PrologisdealwasearlierWAREHOUSEplanandneverclosed,notDCoperator.95000gpd/930cars19truckstrafficwereSTUDYPROJECTIONSnotmeasureduse;23.2Massessmentnotcapex.22.2Moldassessmentdifferentdate.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.lehighvalleypublicmedia.org/news/all/air-products-abandons-plan-for-data-center-at-former-upper-macungie-headquarters/", "host": "lehighvalleypublicmedia.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Trexlertown · Lehigh · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42077" } }, { "id": "cde-acquisitions-project-atlas-south-whitehall-lehigh-pa", "state": "pa", "kind": "facility", "name": "Project Atlas Data Center Campus (South Whitehall Township)", "group": "proposed", "status": "Permit review underway", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lehigh" ], "city": "South Whitehall Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.. Introductory presentation is not approval; nine-billion-USD investment and sixteen-million annual tax are projections. Claimed avoided cooling water is a modeled comparison, not measured water use; no-cost-to-ratepayer promise not executed utility terms. Subsequent original decisions and current operator disclosures take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.lehighvalleypublicmedia.org/news/local/residents-push-for-public-hearing-as-south-whitehall-takes-new-look-at-hyperscale-data-center/", "host": "lehighvalleypublicmedia.org", "date": "2026-07-14", "published": "2026-07-14", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.6251, "lng": -75.60603, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round24-2026-10-14.json", "scope": "Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.", "fields": { "reported_context": "Lehigh Valley Public Media reports revised South Whitehall Atlas concept of three roughly500000-square-foot buildings instead of six.", "independently_verified_current_operating_status": null }, "notes": [ "Introductory presentation is not approval; nine-billion-USD investment and sixteen-million annual tax are projections. Claimed avoided cooling water is a modeled comparison, not measured water use; no-cost-to-ratepayer promise not executed utility terms.", "Subsequent original decisions and current operator disclosures take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.lehighvalleypublicmedia.org/news/local/residents-push-for-public-hearing-as-south-whitehall-takes-new-look-at-hyperscale-data-center/", "host": "lehighvalleypublicmedia.org", "date": "2026-07-14", "published": "2026-07-14", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "The DEP row explicitly identifies Project Atlas, Edged US and CDE Acquisitions in South Whitehall. Pending environmental review is distinct from final local land use action. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "exact_named_dep_proposal_account_not_physical_commissioning", "scope": "The DEP row explicitly identifies Project Atlas, Edged US and CDE Acquisitions in South Whitehall. Pending environmental review is distinct from final local land use action. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged." }, "tracker_scope": { "project_id": "10000006", "original_project_and_related_permit_csv_read": true, "no_data_center_operation_inferred": true, "no_coordinate_or_role_promotion": true } }, "notes": [ "The DEP row explicitly identifies Project Atlas, Edged US and CDE Acquisitions in South Whitehall. Pending environmental review is distinct from final local land use action. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "South Whitehall Township · Lehigh · Source context reviewed", "status_scope": "The DEP row explicitly identifies Project Atlas, Edged US and CDE Acquisitions in South Whitehall. Pending environmental review is distinct from final local land use action. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42077" } }, { "id": "flexential-allentown-data-center-abe01-pa", "state": "pa", "kind": "facility", "name": "Flexential Allentown Data Center (ABE01)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lehigh" ], "city": "Allentown", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Historical operator specification sheet; named Allentown facility, no address on these two pages.. Historical brochure remains publicly served; it does not independently verify October 2026 operations, current certification or actual annual PUE. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.flexential.com/system/files/file/2020-02/allentown-data-center-sheet.pdf", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2021-12/Flexential-2021-PCI-DSS-AOC-Cloud-Operations.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=744+Roble+Road%2C+Allentown%2C+Pennsylvania+18109&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-75.46226778340635%2C40.632091288537545%2C-75.44924621659366%2C40.64197271146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "loc": { "lng": -75.455757, "lat": 40.637032, "precision": "address", "basis": "Operator facility documents identify 744 Roble Road, Allentown, Pennsylvania 18109. One complete unique Census street range supports this calculated reference inside Lehigh County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round14-2026-10-14.json", "scope": "Historical operator specification sheet; named Allentown facility, no address on these two pages.", "fields": { "publisher_reported_footprint_sqft": 46800, "publisher_reported_critical_power_mw": 0.849, "original_power_value": { "value": 849, "unit": "kW", "conversion": "849 / 1000 = 0.849 MW" }, "publisher_pue_rating": 1.8, "current_measured_demand_mw": null, "commissioning_date": null }, "notes": [ "Historical brochure remains publicly served; it does not independently verify October 2026 operations, current certification or actual annual PUE.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2020-02/allentown-data-center-sheet.pdf", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 64", "scope": "The complete original Allentown data sheet describes colocation and cloud services, equipment and service commitments. The file path refers to an older archive and the body supplies no independently established publication day or current service confirmation. Current provider access was later denied and the same host roster was skipped. This retains historical service context without certifying present operation, closure, the current provider relationship or a first opening day. Marketing capacity, uptime and compliance descriptions are not measured results.", "fields": { "current_stage_evidence": { "outcome": "original_older_allentown_service_sheet_current_stage_held", "scope": "The complete original Allentown data sheet describes colocation and cloud services, equipment and service commitments. The file path refers to an older archive and the body supplies no independently established publication day or current service confirmation. Current provider access was later denied and the same host roster was skipped. This retains historical service context without certifying present operation, closure, the current provider relationship or a first opening day. Marketing capacity, uptime and compliance descriptions are not measured results." }, "source_read_scope": { "complete_original_datasheet_text_read": true, "source_publication_day_unverified": true, "archive_path_not_current_service_clock": true, "current_provider403_and_roster_skip_retained": true } }, "notes": [ "The complete original Allentown data sheet describes colocation and cloud services, equipment and service commitments. The file path refers to an older archive and the body supplies no independently established publication day or current service confirmation. Current provider access was later denied and the same host roster was skipped. This retains historical service context without certifying present operation, closure, the current provider relationship or a first opening day. Marketing capacity, uptime and compliance descriptions are not measured results.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2020-02/allentown-data-center-sheet.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 64, 2026-10-24", "scope": "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "fields": { "location_review_decision": { "location": { "lng": -75.455757, "lat": 40.637032, "precision": "address", "basis": "Operator facility documents identify 744 Roble Road, Allentown, Pennsylvania 18109. One complete unique Census street range supports this calculated reference inside Lehigh County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "744 Roble Road, Allentown, Pennsylvania 18109", "county_fips": [ "42077" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "The inherited general area coordinate was not an independently reviewed computing street reference. The original operator published computing location documents and complete unique literal Census street evidence support this bounded reference inside the retained county. The measured correction is 213.5 metres. All original source wordings, dates, predecessor coordinates and versions remain retained. Existing status group unknown and every other fact stay unchanged. This is a reference correction without physical relocation, a new operation, selected roof, tenant floor, legal title or complete campus certification.", "Commercial and industrial roofs and parking sit among roads, open land and a larger divided transport route. No particular building, floor or present computing use is selected." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2021-12/Flexential-2021-PCI-DSS-AOC-Cloud-Operations.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=744+Roble+Road%2C+Allentown%2C+Pennsylvania+18109&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-75.46226778340635%2C40.632091288537545%2C-75.44924621659366%2C40.64197271146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Calculated street reference, not a roof or tenant floor", "summary": "Allentown · Lehigh · Source context reviewed" }, { "id": "tierpoint-allentown-tekpark-breinigsville-pa", "state": "pa", "kind": "facility", "name": "TierPoint Allentown TekPark", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lehigh" ], "city": "Breinigsville", "address": "", "who": "TierPoint", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/tekpark-campus/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.tierpoint.com/data-centers/pennsylvania/allentown-tekpark/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=9999+Hamilton+Boulevard%2C+Breinigsville%2C+PA+18031&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint facility navigation links and separate corporate headquarters section" } ], "loc": { "lat": 40.543122693409, "lng": -75.659851731482, "precision": "address", "basis": "Published TierPoint facility address 9999 Hamilton Boulevard, Building #4, Breinigsville, PA 18031 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "operator-specifications-round3-2026-10-14.json", "scope": "Field or source context only", "fields": { "current_operator_listing": "Operator currently advertises the named facility and services. This is an operator statement, not a site inspection or uptime measurement." }, "notes": [ "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/tekpark-campus/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "TierPoint lists current colocation services at its Allentown TekPark TEK facility in Building 4. The broader TekPark campus page includes future expansion; this label does not certify that expansion as complete. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "TierPoint lists current colocation services at its Allentown TekPark TEK facility in Building 4. The broader TekPark campus page includes future expansion; this label does not certify that expansion as complete. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "TierPoint lists current colocation services at its Allentown TekPark TEK facility in Building 4. The broader TekPark campus page includes future expansion; this label does not certify that expansion as complete." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/allentown-tekpark/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 5, October 22, 2026", "scope": "Published operator street reference only. No canonical address, status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 40.543122693409, "lng": -75.659851731482, "precision": "address", "basis": "Published TierPoint facility address 9999 Hamilton Boulevard, Building #4, Breinigsville, PA 18031 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "9999 Hamilton Boulevard, Building #4, Breinigsville, PA 18031", "county_fips": [ "42077" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named facility address section supplies the street and locality. The corporate headquarters footer is excluded. The published facility address is retained as location evidence; the existing blank canonical address field is not changed in this location only transaction.", "The source facility page and its current navigation link identify the same existing research record. A regional market name does not replace the published locality or county. The existing service status, physical dates, technical figures, organizations and jurisdiction wrappers remain exact.", "The previous point is explicitly an inherited general area reference without a verified street or parcel. The current TierPoint facility section Allentown - TekPark (TEK) publishes 9999 Hamilton Boulevard, Building #4, Breinigsville, PA 18031. Its unique Census street range and retained county polygon agree with the existing county. This 2676.0 meter move replaces that unsupported general area reference with a calculated street address reference. It does not certify a roof, full campus boundary, ownership or physical milestone.", "Building 4 is retained only as the operator published address qualifier. This is one calculated street reference for the existing TekPark research record, not an added building pin or whole campus boundary." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/allentown-tekpark/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint named facility address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=9999+Hamilton+Boulevard%2C+Breinigsville%2C+PA+18031&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint facility navigation links and separate corporate headquarters section" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 06, October 23, 2026", "scope": "TierPoint presents this named facility as part of its own colocation service network on its first party facility page. Operator is the attributed provider brand role, not an independently established legal operating entity or property owner. No status, location, physical date, technical figure, certification or environmental outcome is promoted. The source describes a campus and future expansion. Its ownership marketing, acreage and growth claims are not adopted as independently verified legal title, technical capacity, completion or environmental findings.", "fields": { "company_association": { "name": "TierPoint", "role": "operator", "identity_scope": "provider_brand_only", "scope": "TierPoint presents this named facility as part of its own colocation service network on its first party facility page. Operator is the attributed provider brand role, not an independently established legal operating entity or property owner. No status, location, physical date, technical figure, certification or environmental outcome is promoted. The source describes a campus and future expansion. Its ownership marketing, acreage and growth claims are not adopted as independently verified legal title, technical capacity, completion or environmental findings." }, "provider_role": "operator" }, "notes": [ "TierPoint presents this named facility as part of its own colocation service network on its first party facility page. Operator is the attributed provider brand role, not an independently established legal operating entity or property owner. No status, location, physical date, technical figure, certification or environmental outcome is promoted. The source describes a campus and future expansion. Its ownership marketing, acreage and growth claims are not adopted as independently verified legal title, technical capacity, completion or environmental findings.", "Source dates remain separate from physical milestones and the retained status field." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/tekpark-campus/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party named facility page, reviewed named service or development context" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Breinigsville · Lehigh · Source context reviewed", "status_scope": "TierPoint lists current colocation services at its Allentown TekPark TEK facility in Building 4. The broader TekPark campus page includes future expansion; this label does not certify that expansion as complete. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } ], "compilation_license": "withheld_pending_owner_decision" }