{ "schema_version": 1, "source_compilation_context": { "mi": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/mi.json", "updated": "2026-10-24" } }, "scope": "Source compiled state collection. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.", "collection": { "kind": "states", "key": "mi", "label": "Michigan" }, "records": [ { "id": "cloverleaf-ironwood-dundee-township-mi", "state": "mi", "kind": "facility", "name": "Project Ironwood", "group": "proposed", "status": "Proposed", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Monroe" ], "city": "Dundee", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Ironwood FAQ generic versus project-specific sections. Generic400000to1000000sqftperbuilding and50to300jobs are not approved project-specific quantities. Developer describes future425Agreement as conditional; no executed annexation/revenue-sharing agreement read. Claims on legally binding promises not independent legal finding. No exact MW, permit approval date or named end-user adopted. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Named-site current agency/operator stage, reviewed October 15, 2026. Developer site preparation and its search for a future operator do not establish construction, issued permits or operation. No selected tenant or capacity is inferred. Publication date of this current page is not established; the review date is not an event date. Displayed status uses the explicitly reviewed current status field; it is a source statement, not a physical inspection.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ironwooddatacenter.com/faqs/", "host": "ironwooddatacenter.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 41.94081, "lng": -83.55168, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "primary-source-review-round9-2026-10-14.json", "scope": "Ironwood FAQ generic versus project-specific sections", "fields": { "project_name": "Project Ironwood", "developer": "Cloverleaf Infrastructure", "locality": "Dundee Township, Michigan", "developer_described_stage": "proposed development", "northern_boundary_description": "Day Road" }, "notes": [ "Generic400000to1000000sqftperbuilding and50to300jobs are not approved project-specific quantities. Developer describes future425Agreement as conditional; no executed annexation/revenue-sharing agreement read. Claims on legally binding promises not independent legal finding. No exact MW, permit approval date or named end-user adopted.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://ironwooddatacenter.com/faqs/", "host": "ironwooddatacenter.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Atlas targeted primary-source follow-up", "scope": "Named-site current agency/operator stage, reviewed October 15, 2026", "fields": { "current_status": "proposed", "status_basis": "Cloverleaf calls Ironwood a proposed development in Dundee Township and says it is in the development phase." }, "notes": [ "Developer site preparation and its search for a future operator do not establish construction, issued permits or operation. No selected tenant or capacity is inferred. Publication date of this current page is not established; the review date is not an event date." ], "sources": [ { "url": "https://ironwooddatacenter.com/faqs/", "host": "ironwooddatacenter.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "checked": "2026-10-15", "capture_sha256": "abf808ff3f3b336e9b59cb44d26983dbcbd1266cc520cb57d07c8aef064ed615", "events": [], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Dundee · Monroe · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26115" } }, { "id": "123net-dc4-byron-center-mi", "state": "mi", "kind": "facility", "name": "123NET DC4 Grand Rapids Data Center", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Kent" ], "city": "Byron Center", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. four named Michigan sections. Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "123.net", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC4%20(1).pdf", "host": "6121234.fs1.hubspotusercontent-na1.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact current named operator service address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=400+76th+Street+SW%2C+Byron+Center%2C+MI+49315&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Unique calculated street range and county match" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-85.6769711940423%2C42.82306147506553%2C-85.6683974074717%2C42.829349653290464&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting, acquisition date unknown" } ], "loc": { "lng": -85.672684, "lat": 42.826206, "precision": "address", "basis": "Current named 123NET service address 400 76th Street SW Suite 12, Byron Center, MI 49315 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "four named Michigan sections", "fields": { "site_sections": [ { "code": "DC1", "address": "24700 Northwestern Hwy, Southfield, MI48075", "colocation_area_sqft": 80000 }, { "code": "DC2", "address": "24275 Northwestern Hwy, Southfield, MI48075", "colocation_area_sqft": 8000 }, { "code": "DC3", "address": "24245 Northwestern Hwy, Southfield, MI48075", "colocation_area_sqft": 8000 }, { "code": "DC4", "address": "400 76th St SW, Byron Center, MI49315", "colocation_area_sqft": 3500 } ] }, "notes": [ "Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "123.net", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 24", "scope": "123NET current colocation page explicitly identifies DC4 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.", "fields": { "current_stage_evidence": { "outcome": "current_operator_named_facility_service_not_generic_regional_announcement", "scope": "123NET current colocation page explicitly identifies DC4 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted." }, "source_scope": { "specific_facility_code": "DC4", "all_four_codes_explicit_in_current_source": true, "operator_present_service_statement": true, "current_service_check_not_opening_day": true, "advertised_sizes_and_certifications_not_promoted": true } }, "notes": [ "123NET current colocation page explicitly identifies DC4 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "www.123.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 25, October 23, 2026", "scope": "Calculated named operator service street reference only. Existing native status remains operating. Protected facts remain exact.", "fields": { "location_review_decision": { "location": { "lng": -85.672684, "lat": 42.826206, "precision": "address", "basis": "Current named 123NET service address 400 76th Street SW Suite 12, Byron Center, MI 49315 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating." }, "reference_method": "Census interpolated street address", "published_address": "400 76th Street SW Suite 12, Byron Center, MI 49315", "county_fips": [ "26081" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The exact current operator numeric service street is matched to one Census range in the retained county. This is a calculated service street reference, not a surveyed roof, legal parcel, title, floor, tenant unit or full campus boundary.", "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. Operator performance, space, power and completion statements are not adopted.", "Raw Census coordinates remain unchanged in source history. Public interpolated coordinates round to six decimal places below 0.1 metre displacement. This is not a survey accuracy claim. Official imagery acquisition date is unknown and may predate construction. No residential roof is selected.", "The current named code section links this exact operator brochure, whose first address page was actually viewed. No printed roof rights, completed year, footprint, technical figure or pictured roof is adopted. Brochure publication date is unknown.", "Suite 12 remains in the published address and viewed source evidence. The Census query omits only the suite for the service street reference. No tenant unit, separate roof or independent building coordinate is established." ], "sources": [ { "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC4%20(1).pdf", "host": "6121234.fs1.hubspotusercontent-na1.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact current named operator service address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=400+76th+Street+SW%2C+Byron+Center%2C+MI+49315&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Unique calculated street range and county match" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-85.6769711940423%2C42.82306147506553%2C-85.6683974074717%2C42.829349653290464&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting, acquisition date unknown" }, { "url": "https://www.123.net/data-center-colocation/", "host": "www.123.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Retained exact brochure address page or named current code section" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Operator service address reference, not a surveyed building or parcel", "summary": "Byron Center · Kent · Source context reviewed", "status_scope": "123NET current colocation page explicitly identifies DC4 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted." }, { "id": "123net-dc1-southfield-mi", "state": "mi", "kind": "facility", "name": "123NET Southfield DC1", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Southfield", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. four named Michigan sections. Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "123.net", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC1%20(3).pdf", "host": "6121234.fs1.hubspotusercontent-na1.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact current named operator service address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24700+Northwestern+Hwy%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Unique calculated street range and county match" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.2429661675863%2C42.467807692374535%2C-83.23444120853969%2C42.47409587059947&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting, acquisition date unknown" } ], "loc": { "lng": -83.238704, "lat": 42.470952, "precision": "address", "basis": "Current named 123NET service address 24700 Northwestern Hwy, Southfield, MI 48075 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "four named Michigan sections", "fields": { "site_sections": [ { "code": "DC1", "address": "24700 Northwestern Hwy, Southfield, MI48075", "colocation_area_sqft": 80000 }, { "code": "DC2", "address": "24275 Northwestern Hwy, Southfield, MI48075", "colocation_area_sqft": 8000 }, { "code": "DC3", "address": "24245 Northwestern Hwy, Southfield, MI48075", "colocation_area_sqft": 8000 }, { "code": "DC4", "address": "400 76th St SW, Byron Center, MI49315", "colocation_area_sqft": 3500 } ] }, "notes": [ "Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "123.net", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 24", "scope": "123NET current colocation page explicitly identifies DC1 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.", "fields": { "current_stage_evidence": { "outcome": "current_operator_named_facility_service_not_generic_regional_announcement", "scope": "123NET current colocation page explicitly identifies DC1 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted." }, "source_scope": { "specific_facility_code": "DC1", "all_four_codes_explicit_in_current_source": true, "operator_present_service_statement": true, "current_service_check_not_opening_day": true, "advertised_sizes_and_certifications_not_promoted": true } }, "notes": [ "123NET current colocation page explicitly identifies DC1 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "www.123.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 25, October 23, 2026", "scope": "Calculated named operator service street reference only. Existing native status remains operating. Protected facts remain exact.", "fields": { "location_review_decision": { "location": { "lng": -83.238704, "lat": 42.470952, "precision": "address", "basis": "Current named 123NET service address 24700 Northwestern Hwy, Southfield, MI 48075 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating." }, "reference_method": "Census interpolated street address", "published_address": "24700 Northwestern Hwy, Southfield, MI 48075", "county_fips": [ "26125" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The exact current operator numeric service street is matched to one Census range in the retained county. This is a calculated service street reference, not a surveyed roof, legal parcel, title, floor, tenant unit or full campus boundary.", "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. Operator performance, space, power and completion statements are not adopted.", "Raw Census coordinates remain unchanged in source history. Public interpolated coordinates round to six decimal places below 0.1 metre displacement. This is not a survey accuracy claim. Official imagery acquisition date is unknown and may predate construction. No residential roof is selected.", "The current named code section links this exact operator brochure, whose first address page was actually viewed. No printed roof rights, completed year, footprint, technical figure or pictured roof is adopted. Brochure publication date is unknown.", "The operator explicitly describes this as the DC1 data facility and also its headquarters. The admission comes from the dedicated facility address section, not an unrelated headquarters footer. No corporate mailing address is substituted." ], "sources": [ { "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC1%20(3).pdf", "host": "6121234.fs1.hubspotusercontent-na1.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact current named operator service address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24700+Northwestern+Hwy%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Unique calculated street range and county match" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.2429661675863%2C42.467807692374535%2C-83.23444120853969%2C42.47409587059947&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting, acquisition date unknown" }, { "url": "https://www.123.net/data-center-colocation/", "host": "www.123.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Retained exact brochure address page or named current code section" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Operator service address reference, not a surveyed building or parcel", "summary": "Southfield · Oakland · Source context reviewed", "status_scope": "123NET current colocation page explicitly identifies DC1 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted." }, { "id": "123net-dc2-southfield-mi", "state": "mi", "kind": "facility", "name": "123NET Southfield DC2 (Southfield Data Center NW)", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Southfield", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. four named Michigan sections. Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "123.net", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24275+Northwestern+Hwy%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Unique calculated street range and county match" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.23893026687816%2C42.464033005753535%2C-83.23040582189785%2C42.47032118397847&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting, acquisition date unknown" }, { "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC2%20(1).pdf", "host": "6121234.fs1.hubspotusercontent-na1.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Retained exact brochure address page or named current code section" } ], "loc": { "lng": -83.234668, "lat": 42.467177, "precision": "address", "basis": "Current named 123NET service address 24275 Northwestern Hwy, Southfield, MI 48075 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "four named Michigan sections", "fields": { "site_sections": [ { "code": "DC1", "address": "24700 Northwestern Hwy, Southfield, MI48075", "colocation_area_sqft": 80000 }, { "code": "DC2", "address": "24275 Northwestern Hwy, Southfield, MI48075", "colocation_area_sqft": 8000 }, { "code": "DC3", "address": "24245 Northwestern Hwy, Southfield, MI48075", "colocation_area_sqft": 8000 }, { "code": "DC4", "address": "400 76th St SW, Byron Center, MI49315", "colocation_area_sqft": 3500 } ] }, "notes": [ "Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "123.net", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 24", "scope": "123NET current colocation page explicitly identifies DC2 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.", "fields": { "current_stage_evidence": { "outcome": "current_operator_named_facility_service_not_generic_regional_announcement", "scope": "123NET current colocation page explicitly identifies DC2 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted." }, "source_scope": { "specific_facility_code": "DC2", "all_four_codes_explicit_in_current_source": true, "operator_present_service_statement": true, "current_service_check_not_opening_day": true, "advertised_sizes_and_certifications_not_promoted": true } }, "notes": [ "123NET current colocation page explicitly identifies DC2 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "www.123.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 25, October 23, 2026", "scope": "Calculated named operator service street reference only. Existing native status remains operating. Protected facts remain exact.", "fields": { "location_review_decision": { "location": { "lng": -83.234668, "lat": 42.467177, "precision": "address", "basis": "Current named 123NET service address 24275 Northwestern Hwy, Southfield, MI 48075 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating." }, "reference_method": "Census interpolated street address", "published_address": "24275 Northwestern Hwy, Southfield, MI 48075", "county_fips": [ "26125" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The exact current operator numeric service street is matched to one Census range in the retained county. This is a calculated service street reference, not a surveyed roof, legal parcel, title, floor, tenant unit or full campus boundary.", "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. Operator performance, space, power and completion statements are not adopted.", "Raw Census coordinates remain unchanged in source history. Public interpolated coordinates round to six decimal places below 0.1 metre displacement. This is not a survey accuracy claim. Official imagery acquisition date is unknown and may predate construction. No residential roof is selected.", "The current named code section links this exact operator brochure, whose first address page was actually viewed. No printed roof rights, completed year, footprint, technical figure or pictured roof is adopted. Brochure publication date is unknown.", "The current named DC2 HTML section gives 48075. Its linked brochure prints 48705. Both originals remain unchanged, including the first Census request using 48705. The accepted query uses 48075 exactly from the current named DC2 section and returns the same street coordinates inside Oakland County. No silent brochure correction or date inference is made." ], "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "www.123.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact current named operator service address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24275+Northwestern+Hwy%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Unique calculated street range and county match" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.23893026687816%2C42.464033005753535%2C-83.23040582189785%2C42.47032118397847&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting, acquisition date unknown" }, { "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC2%20(1).pdf", "host": "6121234.fs1.hubspotusercontent-na1.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Retained exact brochure address page or named current code section" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Operator service address reference, not a surveyed building or parcel", "summary": "Southfield · Oakland · Source context reviewed", "status_scope": "123NET current colocation page explicitly identifies DC2 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted." }, { "id": "123net-dc3-southfield-mi", "state": "mi", "kind": "facility", "name": "123NET Southfield DC3 (Southfield Data Center W)", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Southfield", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. four named Michigan sections. Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "123.net", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC3%20(1).pdf", "host": "6121234.fs1.hubspotusercontent-na1.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact current named operator service address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24245+Northwestern+Hwy%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Unique calculated street range and county match" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.23865502844556%2C42.46384816011953%2C-83.23013060863643%2C42.47013633834447&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting, acquisition date unknown" } ], "loc": { "lng": -83.234393, "lat": 42.466992, "precision": "address", "basis": "Current named 123NET service address 24245 Northwestern Hwy, Southfield, MI 48075 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "four named Michigan sections", "fields": { "site_sections": [ { "code": "DC1", "address": "24700 Northwestern Hwy, Southfield, MI48075", "colocation_area_sqft": 80000 }, { "code": "DC2", "address": "24275 Northwestern Hwy, Southfield, MI48075", "colocation_area_sqft": 8000 }, { "code": "DC3", "address": "24245 Northwestern Hwy, Southfield, MI48075", "colocation_area_sqft": 8000 }, { "code": "DC4", "address": "400 76th St SW, Byron Center, MI49315", "colocation_area_sqft": 3500 } ] }, "notes": [ "Detroit/GrandRapidsaremarketlabels; publishedmunicipalitiesSouthfield/ByronCenterretained. Colocationareasnotwholebuilding. A/BsupplynotITMW; noindependentenergization.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "123.net", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 24", "scope": "123NET current colocation page explicitly identifies DC3 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.", "fields": { "current_stage_evidence": { "outcome": "current_operator_named_facility_service_not_generic_regional_announcement", "scope": "123NET current colocation page explicitly identifies DC3 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted." }, "source_scope": { "specific_facility_code": "DC3", "all_four_codes_explicit_in_current_source": true, "operator_present_service_statement": true, "current_service_check_not_opening_day": true, "advertised_sizes_and_certifications_not_promoted": true } }, "notes": [ "123NET current colocation page explicitly identifies DC3 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://www.123.net/data-center-colocation/", "host": "www.123.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 25, October 23, 2026", "scope": "Calculated named operator service street reference only. Existing native status remains operating. Protected facts remain exact.", "fields": { "location_review_decision": { "location": { "lng": -83.234393, "lat": 42.466992, "precision": "address", "basis": "Current named 123NET service address 24245 Northwestern Hwy, Southfield, MI 48075 matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating." }, "reference_method": "Census interpolated street address", "published_address": "24245 Northwestern Hwy, Southfield, MI 48075", "county_fips": [ "26125" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The exact current operator numeric service street is matched to one Census range in the retained county. This is a calculated service street reference, not a surveyed roof, legal parcel, title, floor, tenant unit or full campus boundary.", "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. Operator performance, space, power and completion statements are not adopted.", "Raw Census coordinates remain unchanged in source history. Public interpolated coordinates round to six decimal places below 0.1 metre displacement. This is not a survey accuracy claim. Official imagery acquisition date is unknown and may predate construction. No residential roof is selected.", "The current named code section links this exact operator brochure, whose first address page was actually viewed. No printed roof rights, completed year, footprint, technical figure or pictured roof is adopted. Brochure publication date is unknown." ], "sources": [ { "url": "https://6121234.fs1.hubspotusercontent-na1.net/hubfs/6121234/Data%20Center%20Tech%20Specs-DC3%20(1).pdf", "host": "6121234.fs1.hubspotusercontent-na1.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact current named operator service address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24245+Northwestern+Hwy%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Unique calculated street range and county match" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.23865502844556%2C42.46384816011953%2C-83.23013060863643%2C42.47013633834447&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting, acquisition date unknown" }, { "url": "https://www.123.net/data-center-colocation/", "host": "www.123.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Retained exact brochure address page or named current code section" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Operator service address reference, not a surveyed building or parcel", "summary": "Southfield · Oakland · Source context reviewed", "status_scope": "123NET current colocation page explicitly identifies DC3 among its four named data centers and says it operates those facilities. It describes customer colocation use, with DC4 used for primary or backup service and the Southfield facilities identified by their separate codes. Operator reported service describes the current named facility service account, not every advertised technical specification, independently measured uptime or a precise opening day. Regional Detroit or Grand Rapids wording does not change the inherited street, municipality, county or provider role. No advertised capacity, certification or location is promoted." }, { "id": "365-data-centers-dt1-southfield-mi", "state": "mi", "kind": "facility", "name": "365 Data Centers Detroit (DT1)", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Southfield", "address": "", "who": "365 Data Centers", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Do not sum redundant UPS units as critical IT capacity or treat the generator as utility supply. No independent uptime verification. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://365datacenters.com/detroit-data-center/", "host": "365datacenters.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24660+Lahser+Road%2C+Southfield%2C+MI+48033&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" }, { "url": "https://365datacenters.com/colocation-services/", "host": "365datacenters.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 42.469159136957, "lng": -83.260517403519, "precision": "address", "basis": "Published 365 Data Centers facility address 24660 Lahser Road, Southfield, MI 48033 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "primary-events-round3-2026-10-14.json", "scope": "Field or source context only", "fields": { "published_address": "24660 Lahser Road, Southfield, MI 48033", "advertised_data_center_sqft": 12000, "ups_configuration": { "units": 3, "kw_per_unit": 203, "redundancy": "N+1" }, "backup_generator_kw": 750 }, "notes": [ "Do not sum redundant UPS units as critical IT capacity or treat the generator as utility supply. No independent uptime verification.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://365datacenters.com/detroit-data-center/", "host": "365datacenters.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "365 Data Centers lists current customer-care and colocation support at its Detroit-market facility in Southfield. The Detroit market name does not change the municipality. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "365 Data Centers lists current customer-care and colocation support at its Detroit-market facility in Southfield. The Detroit market name does not change the municipality. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "365 Data Centers lists current customer-care and colocation support at its Detroit-market facility in Southfield. The Detroit market name does not change the municipality." ], "sources": [ { "url": "https://365datacenters.com/detroit-data-center/", "host": "365datacenters.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 7, October 22, 2026", "scope": "Official facility service street reference only. No canonical address, current operation, physical date, capacity, company role, jurisdiction, parcel, complete campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 42.469159136957, "lng": -83.260517403519, "precision": "address", "basis": "Published 365 Data Centers facility address 24660 Lahser Road, Southfield, MI 48033 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "24660 Lahser Road, Southfield, MI 48033", "county_fips": [ "26125" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named operator facility page publishes this service address in its facility location section. Navigation, related facilities, corporate addresses, embedded maps and operator template coordinates are excluded. The canonical address wrapper remains exact; the published address is retained as reviewed location evidence.", "The unique Census street match and retained county boundary agree with the existing county. Street interpolation does not identify a roof, suite, floor, campus boundary, legal parcel, ownership or distinct physical building. Status, dates, quantities and jurisdiction remain unchanged." ], "sources": [ { "url": "https://365datacenters.com/detroit-data-center/", "host": "365datacenters.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named facility street address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=24660+Lahser+Road%2C+Southfield%2C+MI+48033&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 29, October 23, 2026", "scope": "365 Data Centers lists the same named facility at the retained first party source URL and separately describes its colocation service relationship. Operator per source records the provider brand relationship. It does not establish legal title, sole control of a shared building or an independent legal entity. The existing name, physical status, dates, address, point, county, quantities, certifications and component identity remain exact. Current service advertising is not a physical milestone or independently measured performance. The source publication date is unknown.", "fields": { "company_association": { "name": "365 Data Centers", "role": "operator", "identity_scope": "provider_brand_only", "scope": "365 Data Centers lists the same named facility at the retained first party source URL and separately describes its colocation service relationship. Operator per source records the provider brand relationship. It does not establish legal title, sole control of a shared building or an independent legal entity. The existing name, physical status, dates, address, point, county, quantities, certifications and component identity remain exact. Current service advertising is not a physical milestone or independently measured performance. The source publication date is unknown." }, "provider_role": "operator" }, "notes": [ "365 Data Centers lists the same named facility at the retained first party source URL and separately describes its colocation service relationship. Operator per source records the provider brand relationship. It does not establish legal title, sole control of a shared building or an independent legal entity. The existing name, physical status, dates, address, point, county, quantities, certifications and component identity remain exact. Current service advertising is not a physical milestone or independently measured performance. The source publication date is unknown." ], "sources": [ { "url": "https://365datacenters.com/detroit-data-center/", "host": "365datacenters.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://365datacenters.com/colocation-services/", "host": "365datacenters.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Southfield · Oakland · Source context reviewed", "status_scope": "365 Data Centers lists current customer-care and colocation support at its Detroit-market facility in Southfield. The Detroit market name does not change the municipality. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "acd-net-metroix-lansing-mi", "state": "mi", "kind": "facility", "name": "ACD.net MetroIX Lansing Data Center (1800 N. Grand River Ave)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Ingham" ], "city": "Lansing", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site context, with limited previews/corridor crosswalks explicitly identified.. Current ACD operator colocation page offers a controlled Lansing facility, UPS/generator/cooling, network-provider choices, racks, cages and on-site Remote Hands. Footer identifies 1800 N Grand River Avenue. This supplies limited operator/location context for the inherited MetroIX row; the MetroIX name is not used. No MW, square footage, certification or exact commissioning date is stated. Company office and service context are not an independently surveyed parcel. Not all fields, current operation, precise parcel or critical IT independently certified.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://acd.net/colocation", "host": "acd.net", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.59709, "lng": -84.3736, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-permit-scope-operator-crosswalks-and-work-resumption-round82-2026-10-15.json", "scope": "Named-site context, with limited previews/corridor crosswalks explicitly identified.", "fields": {}, "notes": [ "Current ACD operator colocation page offers a controlled Lansing facility, UPS/generator/cooling, network-provider choices, racks, cages and on-site Remote Hands. Footer identifies 1800 N Grand River Avenue. This supplies limited operator/location context for the inherited MetroIX row; the MetroIX name is not used. No MW, square footage, certification or exact commissioning date is stated. Company office and service context are not an independently surveyed parcel.", "Not all fields, current operation, precise parcel or critical IT independently certified." ], "sources": [ { "url": "https://acd.net/colocation", "host": "acd.net", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current provider page offers Lansing colocation, Remote Hands, racks and cages and lists the inherited street in its footer. It does not explicitly name MetroIX or establish that the footer office and offered computing floor are the same exact physical premise. This is limited provider and service context. Exact component identity and current physical stage remain held; an office footer alone does not establish an operating data center.", "fields": { "current_stage_evidence": { "outcome": "provider_service_and_office_not_exact_metroix_component", "scope": "The current provider page offers Lansing colocation, Remote Hands, racks and cages and lists the inherited street in its footer. It does not explicitly name MetroIX or establish that the footer office and offered computing floor are the same exact physical premise. This is limited provider and service context. Exact component identity and current physical stage remain held; an office footer alone does not establish an operating data center." } }, "notes": [ "The current provider page offers Lansing colocation, Remote Hands, racks and cages and lists the inherited street in its footer. It does not explicitly name MetroIX or establish that the footer office and offered computing floor are the same exact physical premise. This is limited provider and service context. Exact component identity and current physical stage remain held; an office footer alone does not establish an operating data center.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://acd.net/colocation", "host": "acd.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lansing · Ingham · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26065" } }, { "id": "solstice-data-allen-park-mi", "state": "mi", "kind": "facility", "name": "Allen Park Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Allen Park", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.3323, "lng": -83.29601, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo." }, "notes": [ "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Allen Park · Wayne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "alterra-development-marshall-mi", "state": "mi", "kind": "facility", "name": "Alterra Marshall Technology & Energy Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Calhoun" ], "city": "Marshall", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Marshall conditional property agreement and separate powerplant scope. Duediligenceagreement notcompletedpurchase,finalsiteapproval oroperatingcampus.1GWpowerplantnotITandnotuniversallyguaranteedratepayerbenefit. Forecastjobsapplycombinedtechnology/energydevelopmentnotallDCroles.18to24monthconstructionstartforecastconditionalafterapprovals, not2026actualstart. Existingindustrialzoningdoesnotproveallpermits. Broadernaturearea notautomaticallyprojectland. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2025-10-30", "The City Mayor update reports that Alterra presented MTEC to the Local Development Finance Authority on October 30, 2025 and that the authority agreed to enter a purchase agreement. This dates the reported administrative action, not completed purchase, final approval, construction or computing operation." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://marshalladvisor.com/articles/news/data-center-being-proposed-in-marshall-begins-due-dilligence-period-with-city/", "host": "marshalladvisor.com", "date": "2025-12-27", "published": "2025-12-27", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.cityofmarshall.com/DocumentCenter/View/2300/Statement-Regarding-MTEC-Update-May-2026", "host": "www.cityofmarshall.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 42.24653, "lng": -85.00564, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round13-2026-10-14.json", "scope": "Marshall conditional property agreement and separate powerplant scope", "fields": { "developer": "Alterra Development", "project": "Marshall Technology and EnergyCenter", "location": "BrooksIndustrialPark, Marshall, Michigan", "reported_initial_purchase_agreement_date": "2025-10-30", "proposed_land_acres_min_exclusive": 200, "reported_due_diligence_months_range": [ 6, 12 ], "proposed_generation_gw": 1, "power_basis": "onsite generation, not critical IT", "developer_expected_direct_skilled_jobs_range": [ 300, 500 ] }, "notes": [ "Duediligenceagreement notcompletedpurchase,finalsiteapproval oroperatingcampus.1GWpowerplantnotITandnotuniversallyguaranteedratepayerbenefit. Forecastjobsapplycombinedtechnology/energydevelopmentnotallDCroles.18to24monthconstructionstartforecastconditionalafterapprovals, not2026actualstart. Existingindustrialzoningdoesnotproveallpermits. Broadernaturearea notautomaticallyprojectland.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://marshalladvisor.com/articles/news/data-center-being-proposed-in-marshall-begins-due-dilligence-period-with-city/", "host": "marshalladvisor.com", "date": "2025-12-27", "published": "2025-12-27", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The original City Mayor update describes the Marshall Technology and Energy Center as proposed, with an extended due diligence period and a potential later site plan if Alterra completes its purchase. It reports an October 30, 2025 LDFA presentation and agreement to enter a purchase agreement. These historical administrative facts do not establish completed acquisition, construction, commissioned generation or current computing. The document name supplies a month but no exact online publication day, so publication day remains unknown.", "fields": { "current_stage_evidence": { "outcome": "historical_city_purchase_due_diligence_current_stage_held", "scope": "The original City Mayor update describes the Marshall Technology and Energy Center as proposed, with an extended due diligence period and a potential later site plan if Alterra completes its purchase. It reports an October 30, 2025 LDFA presentation and agreement to enter a purchase agreement. These historical administrative facts do not establish completed acquisition, construction, commissioned generation or current computing. The document name supplies a month but no exact online publication day, so publication day remains unknown." }, "source_read_scope": { "city_update_text_pages": [ 1, 2 ], "mayor_observation_of_other_switch_site_not_transferred": true } }, "notes": [ "The original City Mayor update describes the Marshall Technology and Energy Center as proposed, with an extended due diligence period and a potential later site plan if Alterra completes its purchase. It reports an October 30, 2025 LDFA presentation and agreement to enter a purchase agreement. These historical administrative facts do not establish completed acquisition, construction, commissioned generation or current computing. The document name supplies a month but no exact online publication day, so publication day remains unknown.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.cityofmarshall.com/DocumentCenter/View/2300/Statement-Regarding-MTEC-Update-May-2026", "host": "www.cityofmarshall.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Marshall · Calhoun · Source context reviewed", "event_evidence": [ { "date": "2025-10-30", "text": "The City Mayor update reports that Alterra presented MTEC to the Local Development Finance Authority on October 30, 2025 and that the authority agreed to enter a purchase agreement. This dates the reported administrative action, not completed purchase, final approval, construction or computing operation.", "kind": "announced", "sources": [ { "url": "https://www.cityofmarshall.com/DocumentCenter/View/2300/Statement-Regarding-MTEC-Update-May-2026", "host": "www.cityofmarshall.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26025" } }, { "id": "aunalytics-kalamazoo-mi", "state": "mi", "kind": "facility", "name": "Aunalytics Kalamazoo Datacenter", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Kalamazoo" ], "city": "Kalamazoo", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Exact company office address context; data-center use still unverified at that address.. Current company contact page lists Kalamazoo office at 6395 Technology Avenue, matching the inherited street. Page does not identify Suite A or explicitly describe the office as a data center. Corporate office listing corroborates company presence only. No critical IT MW, commissioned floor space, sole ownership, Tier award or environmental permit inferred. Other listed offices do not automatically become new data-center pins. No contact or hotline used. Limited context; company office, renovation, acquisition, offering and physical operation are different facts. Company-wide cloud infrastructure representations, not site-specific proof.. Company says it owns and operates infrastructure and data centers across the Midwest and offers colocation. Combined with Kalamazoo office address this is limited company context, not independent proof of data-hall use at 6395 Technology Avenue. 99.999% uptime claim covers company Cloud and ISP services over a stated seven-year period; not an independently measured Kalamazoo building uptime record. Demonstration monitoring percentages, approximate team size and AI claims are not facility capacity or operating evidence.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.aunalytics.com/contact/", "host": "aunalytics.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.aunalytics.com/enterprise-cloud/", "host": "aunalytics.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.24548, "lng": -85.53122, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-renovation-acquisition-and-office-role-review-round91-2026-10-15.json", "scope": "Exact company office address context; data-center use still unverified at that address.", "fields": {}, "notes": [ "Current company contact page lists Kalamazoo office at 6395 Technology Avenue, matching the inherited street. Page does not identify Suite A or explicitly describe the office as a data center.", "Corporate office listing corroborates company presence only. No critical IT MW, commissioned floor space, sole ownership, Tier award or environmental permit inferred. Other listed offices do not automatically become new data-center pins. No contact or hotline used.", "Limited context; company office, renovation, acquisition, offering and physical operation are different facts." ], "sources": [ { "url": "https://www.aunalytics.com/contact/", "host": "aunalytics.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "national-renovation-acquisition-and-office-role-review-round91-2026-10-15.json", "scope": "Company-wide cloud infrastructure representations, not site-specific proof.", "fields": {}, "notes": [ "Company says it owns and operates infrastructure and data centers across the Midwest and offers colocation. Combined with Kalamazoo office address this is limited company context, not independent proof of data-hall use at 6395 Technology Avenue.", "99.999% uptime claim covers company Cloud and ISP services over a stated seven-year period; not an independently measured Kalamazoo building uptime record. Demonstration monitoring percentages, approximate team size and AI claims are not facility capacity or operating evidence.", "Limited context; company office, renovation, acquisition, offering and physical operation are different facts." ], "sources": [ { "url": "https://www.aunalytics.com/enterprise-cloud/", "host": "aunalytics.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current Aunalytics enterprise cloud page says that it operates its own infrastructure and data centers across the Midwest. It does not identify the exact Kalamazoo premise as an operating computing floor. Corporate services, a separate office contact listing and regional operations cannot establish current physical service at this exact inherited building.", "fields": { "current_stage_evidence": { "outcome": "regional_services_not_exact_kalamazoo_compute_floor", "scope": "The current Aunalytics enterprise cloud page says that it operates its own infrastructure and data centers across the Midwest. It does not identify the exact Kalamazoo premise as an operating computing floor. Corporate services, a separate office contact listing and regional operations cannot establish current physical service at this exact inherited building." } }, "notes": [ "The current Aunalytics enterprise cloud page says that it operates its own infrastructure and data centers across the Midwest. It does not identify the exact Kalamazoo premise as an operating computing floor. Corporate services, a separate office contact listing and regional operations cannot establish current physical service at this exact inherited building.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.aunalytics.com/enterprise-cloud/", "host": "www.aunalytics.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Kalamazoo · Kalamazoo · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26077" } }, { "id": "benton-township-yore-avenue-ai-data-center-mi", "state": "mi", "kind": "facility", "name": "Benton Township AI Data Center (Yore Avenue, near Lake Michigan College)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Berrien" ], "city": "Benton Charter Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Headline says three billion USD while body prints three million. Investment remains null; no current construction, tenant or final legislative outcome inferred. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://abc57.com/news/jackie", "host": "abc57.com", "date": "2024-04-04", "published": "2024-04-04", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://franklinpartners.net/wp-content/uploads/2024/04/Benton-Harbor-Land_AdvantageCRE_Flyer83.pdf", "host": "franklinpartners.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 41.95471, "lng": -86.41221, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "canonical_investment_usd": null, "source_internal_investment_conflict": true, "reported_context": "ABC57 reports unnamed company considering Yore Avenue site, contingent on proposed state incentives at that time.", "independently_verified_current_operating_status": null }, "notes": [ "Headline says three billion USD while body prints three million. Investment remains null; no current construction, tenant or final legislative outcome inferred.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://abc57.com/news/jackie", "host": "abc57.com", "date": "2024-04-04", "published": "2024-04-04", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The two page developer hosted brokerage brochure for Meadowbrook and Yore Industrial Site is marked updated July 28, 2023 and offers industrial land for sale or a possible building for a future user. Data center use appears as zoning guidance, with future power delivery language. This is not an exact current filed AI campus, signed tenant, completed building or computing operation. Historical marketing does not resolve this record physical stage.", "fields": { "current_stage_evidence": { "outcome": "historical_industrial_land_marketing_not_current_ai_project", "scope": "The two page developer hosted brokerage brochure for Meadowbrook and Yore Industrial Site is marked updated July 28, 2023 and offers industrial land for sale or a possible building for a future user. Data center use appears as zoning guidance, with future power delivery language. This is not an exact current filed AI campus, signed tenant, completed building or computing operation. Historical marketing does not resolve this record physical stage." }, "source_read_scope": { "brochure_text_pages": [ 1, 2 ], "brokerage_authorship_retained": true, "document_update_not_upload_date": true, "no_power_or_land_quantities_exported": true } }, "notes": [ "The two page developer hosted brokerage brochure for Meadowbrook and Yore Industrial Site is marked updated July 28, 2023 and offers industrial land for sale or a possible building for a future user. Data center use appears as zoning guidance, with future power delivery language. This is not an exact current filed AI campus, signed tenant, completed building or computing operation. Historical marketing does not resolve this record physical stage.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://franklinpartners.net/wp-content/uploads/2024/04/Benton-Harbor-Land_AdvantageCRE_Flyer83.pdf", "host": "franklinpartners.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Benton Charter Township · Berrien · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26021" } }, { "id": "hillwood-sterling-buick-city-flint-mi", "state": "mi", "kind": "facility", "name": "Buick City Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Genesee" ], "city": "Flint", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 43.0217, "lng": -83.7067, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo." }, "notes": [ "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Flint · Genesee · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26049" } }, { "id": "cogent-detroit-1320-3rd-st-mi", "state": "mi", "kind": "facility", "name": "Cogent Detroit Data Center (1320 3rd St)", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Detroit", "address": "", "who": "Cogent Communications", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Generic multiple-options power gives no MW. Two area blocks need brochure mapping before assigning to Detroit versus Troy. Operator explicitly separates Detroit, Troy and Michigan edge sites. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Detroit/Troy named sections. Distinctsiteaddressesandspaces; GrandRapids/Lansing/Pontiac/FlintedgeaddressesnotadditionalDetroitfloorarea. NoMWadopted.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1320+3rd+St%2C+Detroit%2C+MI+48226&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Calculated Census street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.06063717329927%2C42.32730684259353%2C-83.05213128220272%2C42.333595020818464&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Aerial setting only, acquisition date unknown" }, { "url": "https://www.cogentco.com/en/cogent-detroit", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Named facility section and separate service street context" }, { "url": "https://www.cogentco.com/en/network/service-locations?action=search&page=3&continent=&country=United%20States&state=&metro=&site_type=CDC", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact named facility CDC row, separate from network presence" }, { "url": "https://www.cogentco.com/en/network/cogent-data-centers", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Provider explanation of Cogent data center and colocation relationships" } ], "loc": { "lng": -83.056384227751, "lat": 42.330450931706, "precision": "address", "basis": "Published Cogent Communications facility address 1320 3rd St, Detroit, MI 48226 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding." }, "reviewed_evidence": [ { "overlay": "field-verification-2026-10-14.json", "scope": "Field or source context only", "fields": { "street": "1320 3rd St", "city": "Detroit", "marketed_service": "colocation" }, "notes": [ "Generic multiple-options power gives no MW.", "Two area blocks need brochure mapping before assigning to Detroit versus Troy.", "Operator explicitly separates Detroit, Troy and Michigan edge sites.", "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "Detroit/Troy named sections", "fields": { "site_sections": [ { "city": "Troy", "address": "3331 W Big Beaver Road, Troy, MI48084", "operator_labeled_space_sqft": 5624 }, { "city": "Detroit", "address": "1320 3rd St, Detroit, MI48226", "operator_labeled_space_sqft": 31149 } ] }, "notes": [ "Distinctsiteaddressesandspaces; GrandRapids/Lansing/Pontiac/FlintedgeaddressesnotadditionalDetroitfloorarea. NoMWadopted.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies the Detroit data center on Third Street, distinct from its Troy facility and other edge sites. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies the Detroit data center on Third Street, distinct from its Troy facility and other edge sites. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "Cogent explicitly offers current Detroit-market colocation and separately identifies the Detroit data center on Third Street, distinct from its Troy facility and other edge sites." ], "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 16, October 23, 2026", "scope": "Current official facility street reference only. Native protected facts and canonical address remain exact.", "fields": { "location_review_decision": { "location": { "lng": -83.056384227751, "lat": 42.330450931706, "precision": "address", "basis": "Published Cogent Communications facility address 1320 3rd St, Detroit, MI 48226 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "1320 3rd St, Detroit, MI 48226", "county_fips": [ "26163" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named official numeric facility section binds the service address to this existing research record. Corporate offices, related facility cards and embedded map coordinates are excluded.", "The unique Census calculated street range agrees with the retained state and county. Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. The reference does not locate a surveyed roof, parcel, full campus, legal owner, floor or suite.", "All canonical address, status, physical dates, quantity, role, identity and jurisdiction wrappers remain exact. The retained Census method source keeps its actual October 22 date; new captures are dated October 23." ], "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Official named Detroit Data Center numeric facility address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1320+3rd+St%2C+Detroit%2C+MI+48226&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Calculated Census street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.06063717329927%2C42.32730684259353%2C-83.05213128220272%2C42.333595020818464&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Aerial setting only, acquisition date unknown" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check 28, October 23, 2026", "scope": "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes. The service table labels 1320 3rd Avenue, while the named Detroit facility page labels 1320 3rd St. That street wording conflict is retained without changing the existing address or point.", "fields": { "company_association": { "name": "Cogent Communications", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes. The service table labels 1320 3rd Avenue, while the named Detroit facility page labels 1320 3rd St. That street wording conflict is retained without changing the existing address or point." }, "provider_role": "operator" }, "notes": [ "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes. The service table labels 1320 3rd Avenue, while the named Detroit facility page labels 1320 3rd St. That street wording conflict is retained without changing the existing address or point." ], "sources": [ { "url": "https://www.cogentco.com/en/cogent-detroit", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Named facility section and separate service street context" }, { "url": "https://www.cogentco.com/en/network/service-locations?action=search&page=3&continent=&country=United%20States&state=&metro=&site_type=CDC", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact named facility CDC row, separate from network presence" }, { "url": "https://www.cogentco.com/en/network/cogent-data-centers", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Provider explanation of Cogent data center and colocation relationships" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Detroit · Wayne · Source context reviewed", "status_scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies the Detroit data center on Third Street, distinct from its Troy facility and other edge sites. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "cogent-troy-big-beaver-mi", "state": "mi", "kind": "facility", "name": "Cogent Troy Data Center (3331 W. Big Beaver Rd)", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Troy", "address": "", "who": "Cogent Communications", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Detroit/Troy named sections. Distinctsiteaddressesandspaces; GrandRapids/Lansing/Pontiac/FlintedgeaddressesnotadditionalDetroitfloorarea. NoMWadopted. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3331+W.+Big+Beaver+Road%2C+Troy%2C+MI+48084&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Calculated Census street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.19762990277907%2C42.55778239191153%2C-83.18909266091693%2C42.564070570136465&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Aerial setting only, acquisition date unknown" }, { "url": "https://www.cogentco.com/en/cogent-detroit", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Named facility section and separate service street context" }, { "url": "https://www.cogentco.com/en/network/service-locations?action=search&page=8&continent=&country=United%20States&state=&metro=&site_type=CDC", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact named facility CDC row, separate from network presence" }, { "url": "https://www.cogentco.com/en/network/cogent-data-centers", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Provider explanation of Cogent data center and colocation relationships" } ], "loc": { "lng": -83.193361281848, "lat": 42.560926481024, "precision": "address", "basis": "Published Cogent Communications facility address 3331 W. Big Beaver Road, Troy, MI 48084 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "Detroit/Troy named sections", "fields": { "site_sections": [ { "city": "Troy", "address": "3331 W Big Beaver Road, Troy, MI48084", "operator_labeled_space_sqft": 5624 }, { "city": "Detroit", "address": "1320 3rd St, Detroit, MI48226", "operator_labeled_space_sqft": 31149 } ] }, "notes": [ "Distinctsiteaddressesandspaces; GrandRapids/Lansing/Pontiac/FlintedgeaddressesnotadditionalDetroitfloorarea. NoMWadopted.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies its Troy Office and Data Center on Big Beaver Road. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies its Troy Office and Data Center on Big Beaver Road. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "Cogent explicitly offers current Detroit-market colocation and separately identifies its Troy Office and Data Center on Big Beaver Road." ], "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 17, October 23, 2026", "scope": "Current official facility street reference only. Native protected facts and canonical address remain exact.", "fields": { "location_review_decision": { "location": { "lng": -83.193361281848, "lat": 42.560926481024, "precision": "address", "basis": "Published Cogent Communications facility address 3331 W. Big Beaver Road, Troy, MI 48084 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "3331 W. Big Beaver Road, Troy, MI 48084", "county_fips": [ "26125" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named official numeric facility section binds the service address to this existing research record. Corporate offices, related facility cards and embedded map coordinates are excluded.", "The unique Census calculated street range agrees with the retained state and county. Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. The reference does not locate a surveyed roof, parcel, full campus, legal owner, floor or suite.", "All canonical address, status, physical dates, quantity, role, identity and jurisdiction wrappers remain exact. The retained Census method source keeps its actual October 22 date; new captures are dated October 23." ], "sources": [ { "url": "https://cogentco.com/en/cogent-detroit", "host": "cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Official named Troy Office & Data Center numeric facility address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3331+W.+Big+Beaver+Road%2C+Troy%2C+MI+48084&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Calculated Census street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.19762990277907%2C42.55778239191153%2C-83.18909266091693%2C42.564070570136465&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Aerial setting only, acquisition date unknown" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check 28, October 23, 2026", "scope": "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes.", "fields": { "company_association": { "name": "Cogent Communications", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes." }, "provider_role": "operator" }, "notes": [ "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes." ], "sources": [ { "url": "https://www.cogentco.com/en/cogent-detroit", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Named facility section and separate service street context" }, { "url": "https://www.cogentco.com/en/network/service-locations?action=search&page=8&continent=&country=United%20States&state=&metro=&site_type=CDC", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact named facility CDC row, separate from network presence" }, { "url": "https://www.cogentco.com/en/network/cogent-data-centers", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Provider explanation of Cogent data center and colocation relationships" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Troy · Oakland · Source context reviewed", "status_scope": "Cogent explicitly offers current Detroit-market colocation and separately identifies its Troy Office and Data Center on Big Beaver Road. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "deep-green-lansing-mi", "state": "mi", "kind": "facility", "name": "Deep Green Lansing Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Ingham" ], "city": "Lansing", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2025-11-05", "Deep Green published its Lansing proposal announcement on November 5, 2025. The stated future construction window depended on approvals and is not an accomplished start or current service finding." ], [ "2026-04-02", "Deep Green published a Lansing proposal analysis on April 2, 2026 and described a later Council vote as expected. This dates developer publication and does not establish the vote outcome or present construction, emissions or computing operation." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://deepgreen.energy/news/deep-green-proposes-120-million-sustainable-data-center-investment-in-downtown-lansing", "host": "deepgreen.energy", "published": "2025-11-05", "date": "2025-11-05", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://deepgreen.energy/blog/analysis-deep-green-data-centre-project-confirmed-to-reduce-overall-lansing-emissions", "host": "deepgreen.energy", "published": "2026-04-02", "date": "2026-04-02", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 42.60906, "lng": -84.38667, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "TheGander’s MarchURLdirectory explicitly updatedOctober 8 reports named Michiganproject stages:DeepGreenLansingAprilwithdrawal;Pavilionrezoningwithdrawal;Morleyunfiledconcept;HarborFarmzpropertymarketing;Lowellutilitytalksstalled;OaklandUniversityduediligence;Yorkwithdrawal;Solonpauseextension;Tonduunfiledconcept.", "independently_verified_current_operating_status": null, "site_stage_scope": "Reported April application withdrawal; not a denied vote" }, "notes": [ "Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The original November 5, 2025 release announced a Lansing proposal with a conditional spring construction forecast. The April 2, 2026 account still describes a proposal and a future April 6 Council vote. Neither original provides that later vote outcome or exact current physical stage. Fuel cell forecasts and comparative emissions claims are not actual operating computing or measured site emissions. The April account body and table identify different March dates for its cited utility analysis; neither becomes an independently verified utility event.", "fields": { "current_stage_evidence": { "outcome": "dated_proposal_and_forecast_current_physical_stage_held", "scope": "The original November 5, 2025 release announced a Lansing proposal with a conditional spring construction forecast. The April 2, 2026 account still describes a proposal and a future April 6 Council vote. Neither original provides that later vote outcome or exact current physical stage. Fuel cell forecasts and comparative emissions claims are not actual operating computing or measured site emissions. The April account body and table identify different March dates for its cited utility analysis; neither becomes an independently verified utility event." }, "source_read_scope": { "releases_selected_main_bodies_read": true, "internal_utility_analysis_dates_conflict_retained": true, "future_vote_not_assumed": true } }, "notes": [ "The original November 5, 2025 release announced a Lansing proposal with a conditional spring construction forecast. The April 2, 2026 account still describes a proposal and a future April 6 Council vote. Neither original provides that later vote outcome or exact current physical stage. Fuel cell forecasts and comparative emissions claims are not actual operating computing or measured site emissions. The April account body and table identify different March dates for its cited utility analysis; neither becomes an independently verified utility event.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://deepgreen.energy/news/deep-green-proposes-120-million-sustainable-data-center-investment-in-downtown-lansing", "host": "deepgreen.energy", "published": "2025-11-05", "date": "2025-11-05", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://deepgreen.energy/blog/analysis-deep-green-data-centre-project-confirmed-to-reduce-overall-lansing-emissions", "host": "deepgreen.energy", "published": "2026-04-02", "date": "2026-04-02", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lansing · Ingham · Source context reviewed", "event_evidence": [ { "date": "2025-11-05", "text": "Deep Green published its Lansing proposal announcement on November 5, 2025. The stated future construction window depended on approvals and is not an accomplished start or current service finding.", "kind": "announced", "sources": [ { "url": "https://deepgreen.energy/news/deep-green-proposes-120-million-sustainable-data-center-investment-in-downtown-lansing", "host": "deepgreen.energy", "published": "2025-11-05", "date": "2025-11-05", "checked": "2026-10-23", "label": "Reviewed operator source" } ] }, { "date": "2026-04-02", "text": "Deep Green published a Lansing proposal analysis on April 2, 2026 and described a later Council vote as expected. This dates developer publication and does not establish the vote outcome or present construction, emissions or computing operation.", "kind": "announced", "sources": [ { "url": "https://deepgreen.energy/blog/analysis-deep-green-data-centre-project-confirmed-to-reduce-overall-lansing-emissions", "host": "deepgreen.energy", "published": "2026-04-02", "date": "2026-04-02", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26065" } }, { "id": "edgeconnex-det01-mi", "state": "mi", "kind": "facility", "name": "EdgeConneX DET01", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Detroit (Oakland County)", "address": "", "who": "EdgeConneX", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. 20+kWcabinetand600+WpersquarefootdensitynotfacilityMW; noextrapolationfromgrossfloor. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.edgeconnex.com/locations/americas/detroit-mi/", "host": "edgeconnex.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.66039, "lng": -83.38578, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "operator_site_code": "DET01", "facility_area_sqft": 39900, "raised_floor_sqft": 9930 }, "notes": [ "20+kWcabinetand600+WpersquarefootdensitynotfacilityMW; noextrapolationfromgrossfloor.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.edgeconnex.com/locations/americas/detroit-mi/", "host": "edgeconnex.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "EdgeConneX lists current carrier-neutral colocation, local customer facilities and interconnection at DET01 in the Detroit market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "EdgeConneX lists current carrier-neutral colocation, local customer facilities and interconnection at DET01 in the Detroit market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "EdgeConneX lists current carrier-neutral colocation, local customer facilities and interconnection at DET01 in the Detroit market." ], "sources": [ { "url": "https://www.edgeconnex.com/locations/americas/detroit-mi/", "host": "www.edgeconnex.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Company role source check24, October23,2026", "scope": "EdgeConneX names this facility or the retained campus components on its current website and offers colocation and facility services there. Operator per source is the attributed provider brand relationship only, not a finding of the legal operating entity or property title. No physical status, coordinates, street address, quantity, cooling volume, air permit, certification, measured reliability, environmental compliance, tenant identity or completed expansion is adopted. First publication dates remain unknown; retrieval does not establish a physical opening date. The exact named DET01 provider section supplies the relationship. Marketing capability and certification statements remain source claims, not independent findings.", "fields": { "company_association": { "name": "EdgeConneX", "role": "operator", "identity_scope": "provider_brand_only", "scope": "EdgeConneX names this facility or the retained campus components on its current website and offers colocation and facility services there. Operator per source is the attributed provider brand relationship only, not a finding of the legal operating entity or property title. No physical status, coordinates, street address, quantity, cooling volume, air permit, certification, measured reliability, environmental compliance, tenant identity or completed expansion is adopted. First publication dates remain unknown; retrieval does not establish a physical opening date. The exact named DET01 provider section supplies the relationship. Marketing capability and certification statements remain source claims, not independent findings." }, "provider_role": "operator" }, "notes": [ "EdgeConneX names this facility or the retained campus components on its current website and offers colocation and facility services there. Operator per source is the attributed provider brand relationship only, not a finding of the legal operating entity or property title. No physical status, coordinates, street address, quantity, cooling volume, air permit, certification, measured reliability, environmental compliance, tenant identity or completed expansion is adopted. First publication dates remain unknown; retrieval does not establish a physical opening date. The exact named DET01 provider section supplies the relationship. Marketing capability and certification statements remain source claims, not independent findings." ], "sources": [ { "url": "https://www.edgeconnex.com/locations/americas/detroit-mi/", "host": "www.edgeconnex.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Current first party named facility, provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Detroit (Oakland County) · Oakland · Source context reviewed", "status_scope": "EdgeConneX lists current carrier-neutral colocation, local customer facilities and interconnection at DET01 in the Detroit market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26125" } }, { "id": "gm-enterprise-data-center-warren-mi", "state": "mi", "kind": "facility", "name": "General Motors Enterprise Data Center (Warren Technical Center)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Macomb" ], "city": "Warren", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.. HistoricalissuerclaimisnotindependentlyreviewedUSGBCcertificate,currentoperationor2026meteredperformance.70percentreductionlacksfullyreviewedbaseline/scope;notPUEor70percentbetterthanallpeers.12,000carbatteriesreplacedisbackuphistory,notcomputeorMWhcapacity. GM20facilitiesdownfrom23areglobalhistoricalportfolio,notUSbuildingcount. Milfordmirrorunderconstructionisaseparate2013projectstage,notcurrentconstruction. NocriticalITorcapitalverified. Historical observations and forecasts are dated; no later outcome assumed. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.3blmedia.com/news/gm-data-center-goes-green-leed", "host": "3blmedia.com", "date": "2013-09-13", "published": "2013-09-13", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 42.69586, "lng": -82.93228, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round35-2026-10-14.json", "scope": "Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.", "fields": { "reported_context": "GMissuercontenton3BLannouncesWarrenEnterpriseDataCenterLEEDGoldandclaimed70percentenergyreductionfromredesign,withflywheelbackupandin-row/freecooling.", "independently_verified_current_operating_status": null }, "notes": [ "HistoricalissuerclaimisnotindependentlyreviewedUSGBCcertificate,currentoperationor2026meteredperformance.70percentreductionlacksfullyreviewedbaseline/scope;notPUEor70percentbetterthanallpeers.12,000carbatteriesreplacedisbackuphistory,notcomputeorMWhcapacity. GM20facilitiesdownfrom23areglobalhistoricalportfolio,notUSbuildingcount. Milfordmirrorunderconstructionisaseparate2013projectstage,notcurrentconstruction. NocriticalITorcapitalverified.", "Historical observations and forecasts are dated; no later outcome assumed.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.3blmedia.com/news/gm-data-center-goes-green-leed", "host": "3blmedia.com", "date": "2013-09-13", "published": "2013-09-13", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Warren · Macomb · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26099" } }, { "id": "genh-lake-billings-dam-manton-mi", "state": "mi", "kind": "facility", "name": "GenH Lake Billings Dam Data Services Facility", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wexford" ], "city": "Manton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.. Negative first impressions are not a formal rejection. Proposed hydropower is not an operating data center. Cooling and MW are undisclosed. Free installation and rent-style payments are a pitch, not an executed lease. Current original approvals, disclosures and later outcomes take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.cadillacnews.com/news/manton-wary-of-lake-billings-data-center-proposal/article_81fc6587-837e-4e89-a949-b889d28ecd35.html", "host": "cadillacnews.com", "date": "2026-07-23", "published": "2026-07-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 44.33836, "lng": -85.57856, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round26-2026-10-14.json", "scope": "Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.", "fields": { "reported_context": "Cadillac News describes GenH's initial Lake Billings dam proposal, a small modular facility and a possible work group.", "independently_verified_current_operating_status": null }, "notes": [ "Negative first impressions are not a formal rejection. Proposed hydropower is not an operating data center. Cooling and MW are undisclosed. Free installation and rent-style payments are a pitch, not an executed lease.", "Current original approvals, disclosures and later outcomes take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.cadillacnews.com/news/manton-wary-of-lake-billings-data-center-proposal/article_81fc6587-837e-4e89-a949-b889d28ecd35.html", "host": "cadillacnews.com", "date": "2026-07-23", "published": "2026-07-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Manton · Wexford · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26165" } }, { "id": "genh-morley-dam-mecosta-mi", "state": "mi", "kind": "facility", "name": "GenH Morley Dam Data Services Facility", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Mecosta" ], "city": "Morley", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 43.64076, "lng": -85.32453, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "TheGander’s MarchURLdirectory explicitly updatedOctober 8 reports named Michiganproject stages:DeepGreenLansingAprilwithdrawal;Pavilionrezoningwithdrawal;Morleyunfiledconcept;HarborFarmzpropertymarketing;Lowellutilitytalksstalled;OaklandUniversityduediligence;Yorkwithdrawal;Solonpauseextension;Tonduunfiledconcept.", "independently_verified_current_operating_status": null, "site_stage_scope": "Unfiled hydropower/data-services concept" }, "notes": [ "Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Morley · Mecosta · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26107" } }, { "id": "raeden-gibraltar-mclouth-mi", "state": "mi", "kind": "facility", "name": "Gibraltar Data Center (former McLouth Steel site)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Gibraltar", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://raeden.com/data-center-faqs-and-impact/", "host": "raeden.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 42.27516, "lng": -83.32409, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo." }, "notes": [ "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current original company FAQ refers to design plans and studies shared with Gibraltar, but its general performance statements do not establish exact current construction or commissioned computing at the former McLouth property. Generic noise comparisons are not site measurements, and a stated willingness to share materials is not evidence those underlying studies were read. Exact current project physical stage remains unknown.", "fields": { "current_stage_evidence": { "outcome": "company_community_faq_not_gibraltar_physical_stage", "scope": "The current original company FAQ refers to design plans and studies shared with Gibraltar, but its general performance statements do not establish exact current construction or commissioned computing at the former McLouth property. Generic noise comparisons are not site measurements, and a stated willingness to share materials is not evidence those underlying studies were read. Exact current project physical stage remains unknown." }, "source_read_scope": { "selected_sections": [ "Noise and community information references to Gibraltar" ], "underlying_engineering_studies_not_read": true, "no_project_quantity_exported": true } }, "notes": [ "The current original company FAQ refers to design plans and studies shared with Gibraltar, but its general performance statements do not establish exact current construction or commissioned computing at the former McLouth property. Generic noise comparisons are not site measurements, and a stated willingness to share materials is not evidence those underlying studies were read. Exact current project physical stage remains unknown.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://raeden.com/data-center-faqs-and-impact/", "host": "raeden.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Gibraltar · Wayne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "grand-river-power-hamlin-township-mi", "state": "mi", "kind": "facility", "name": "Grand River Power Company Smithville Bitcoin Mine", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Eaton" ], "city": "Eaton Rapids", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.. December 3 rezoning hearing and conditional use remained prospective. Historical order is not proof of current shutdown or later permit result; residents and operator noise claims conflict. Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wkar.org/wkar-news/2025-11-19/cease-and-desist-issued-to-bitcoin-mining-site-in-eaton-county-over-noise-complaints", "host": "wkar.org", "date": "2025-11-19", "published": "2025-11-19", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://hamlineatonmi.gov/wp-content/uploads/2026/08/HTB_Minutes_2026.01.14.pdf", "host": "hamlineatonmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://hamlineatonmi.gov/wp-content/uploads/2026/03/HTB_Minutes_2025.12.10.pdf", "host": "hamlineatonmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://hamlineatonmi.gov/planning/", "host": "hamlineatonmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 42.59604, "lng": -84.8382, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcomes-review-round20-2026-10-14.json", "scope": "Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.", "fields": { "reported_action_type": "cease-and-desist-reported", "reported_finding": "WKAR says Hamlin Township issued October 1 cease-and-desist regarding Grand River Power mining trailer; noise stopped shortly after.", "report_display_date": "2025-11-19", "independently_verified_current_status": null }, "notes": [ "December 3 rezoning hearing and conditional use remained prospective. Historical order is not proof of current shutdown or later permit result; residents and operator noise claims conflict.", "Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.wkar.org/wkar-news/2025-11-19/cease-and-desist-issued-to-bitcoin-mining-site-in-eaton-county-over-noise-complaints", "host": "wkar.org", "date": "2025-11-19", "published": "2025-11-19", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 24", "scope": "The correct Eaton County Hamlin Township Board January 14, 2026 minutes record denial of an unnamed conditional rezoning request after a Planning Commission recommendation. December 10 minutes discuss an earlier December 3 rezoning hearing. Neither reviewed Board item names Grand River Power, Smithville Dam or its parcel, so the exact applicant crosswalk is held and the unnamed denial is not assigned to this record. The separate Hamlin Township in Mason County is not substituted. The current Eaton Township page separates Township zoning from County building permits. Exact current mining operation, order compliance and project disposition remain unclear.", "fields": { "current_stage_evidence": { "outcome": "unnamed_township_rezoning_denial_without_exact_smithville_crosswalk", "scope": "The correct Eaton County Hamlin Township Board January 14, 2026 minutes record denial of an unnamed conditional rezoning request after a Planning Commission recommendation. December 10 minutes discuss an earlier December 3 rezoning hearing. Neither reviewed Board item names Grand River Power, Smithville Dam or its parcel, so the exact applicant crosswalk is held and the unnamed denial is not assigned to this record. The separate Hamlin Township in Mason County is not substituted. The current Eaton Township page separates Township zoning from County building permits. Exact current mining operation, order compliance and project disposition remain unclear." }, "source_scope": { "correct_township_county": "Eaton County", "january_board_meeting_on": "2026-01-14", "december_board_meeting_on": "2025-12-10", "applicant_and_parcel_not_named_in_reviewed_items": true, "mason_county_hamlin_not_substituted": true, "planning_recommendation_and_board_decision_separate": true, "primary_order_and_individual_compliance_not_verified": true } }, "notes": [ "The correct Eaton County Hamlin Township Board January 14, 2026 minutes record denial of an unnamed conditional rezoning request after a Planning Commission recommendation. December 10 minutes discuss an earlier December 3 rezoning hearing. Neither reviewed Board item names Grand River Power, Smithville Dam or its parcel, so the exact applicant crosswalk is held and the unnamed denial is not assigned to this record. The separate Hamlin Township in Mason County is not substituted. The current Eaton Township page separates Township zoning from County building permits. Exact current mining operation, order compliance and project disposition remain unclear.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://hamlineatonmi.gov/wp-content/uploads/2026/08/HTB_Minutes_2026.01.14.pdf", "host": "hamlineatonmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://hamlineatonmi.gov/wp-content/uploads/2026/03/HTB_Minutes_2025.12.10.pdf", "host": "hamlineatonmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://hamlineatonmi.gov/planning/", "host": "hamlineatonmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Eaton Rapids · Eaton · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26045" } }, { "id": "harbor-farmz-full-circle-drive-kalamazoo-mi", "state": "mi", "kind": "facility", "name": "Harbor Farmz Inference Data Center Conversion (2839 Full Circle Drive)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Kalamazoo" ], "city": "Kalamazoo", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 42.22067, "lng": -85.52905, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "TheGander’s MarchURLdirectory explicitly updatedOctober 8 reports named Michiganproject stages:DeepGreenLansingAprilwithdrawal;Pavilionrezoningwithdrawal;Morleyunfiledconcept;HarborFarmzpropertymarketing;Lowellutilitytalksstalled;OaklandUniversityduediligence;Yorkwithdrawal;Solonpauseextension;Tonduunfiledconcept.", "independently_verified_current_operating_status": null, "site_stage_scope": "Property marketed for possible DC; no filed proposal or named developer" }, "notes": [ "Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Kalamazoo · Kalamazoo · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26077" } }, { "id": "stantec-randee-howell-township-mi", "state": "mi", "kind": "facility", "name": "Howell Township Hyperscale Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Livingston" ], "city": "Howell", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Operator or original local-reporting context; source dates and proposal stages retained.. Planet Detroit December8,2025 names Stantec Consulting Michigan Inc/Randee LLC and1077acres north ofI96 in Howell Township. Applicants withdrew a conditional rezoning request following community concerns; the December8 agenda hearing/vote was removed. This is not permanent cancellation or proof of a later resubmission. Article reports November20 six-month moratorium, with a township-attorney interpretation of possible rezoning/site-plan waivers. Original enacted instrument and current2026 status not checked. Planning recommendations are advisory. Billion-dollar cost, tax benefits and petition totals remain dated proposals/claims, not audited spending or certified votes. Not whole-record or current operating-census certification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://planetdetroit.org/2025/12/billion-dollar-data-center-paused/", "host": "planetdetroit.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.60299, "lng": -83.91157, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-and-original-local-reporting-round57-2026-10-15.json", "scope": "Operator or original local-reporting context; source dates and proposal stages retained.", "fields": {}, "notes": [ "Planet Detroit December8,2025 names Stantec Consulting Michigan Inc/Randee LLC and1077acres north ofI96 in Howell Township. Applicants withdrew a conditional rezoning request following community concerns; the December8 agenda hearing/vote was removed. This is not permanent cancellation or proof of a later resubmission.", "Article reports November20 six-month moratorium, with a township-attorney interpretation of possible rezoning/site-plan waivers. Original enacted instrument and current2026 status not checked. Planning recommendations are advisory. Billion-dollar cost, tax benefits and petition totals remain dated proposals/claims, not audited spending or certified votes.", "Not whole-record or current operating-census certification." ], "sources": [ { "url": "https://planetdetroit.org/2025/12/billion-dollar-data-center-paused/", "host": "planetdetroit.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Howell · Livingston · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26093" } }, { "id": "hyperscale-data-dowagiac-mi", "state": "mi", "kind": "facility", "name": "Hyperscale Data Dowagiac Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Cass" ], "city": "Dowagiac", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.. ColinRoose WWMT March31updatedApril1,2026 originalDowagiac citymanager/residentinterviews:48+acrelandpurchaseagreement expectedclose60days, no citydevelopmentproposalreceived.30MWexisting/340MWproposedtotal not370MWIT orcompletedexpansion. Cityelectricutilitynotoperator supplier; noiseordinanceamendedpreviousweekreportedwithoutexactlimits/currentcodificationread. Residentnoise/propertyworriesnotmeasuredhealthharm. Noresponseoperator/currentclosing unverified. Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://wwmt.com/news/local/ai-data-center-expansion-dowagiac-loud-noise-complaints-residents-southwest-michigan-hyperscale-megawatt-bitcoin-wwmt", "host": "wwmt.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 41.91542, "lng": -85.99354, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-acquisitions-regulatory-stage-and-site-crosswalks-round81-2026-10-15.json", "scope": "Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.", "fields": {}, "notes": [ "ColinRoose WWMT March31updatedApril1,2026 originalDowagiac citymanager/residentinterviews:48+acrelandpurchaseagreement expectedclose60days, no citydevelopmentproposalreceived.30MWexisting/340MWproposedtotal not370MWIT orcompletedexpansion.", "Cityelectricutilitynotoperator supplier; noiseordinanceamendedpreviousweekreportedwithoutexactlimits/currentcodificationread. Residentnoise/propertyworriesnotmeasuredhealthharm. Noresponseoperator/currentclosing unverified.", "Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified." ], "sources": [ { "url": "https://wwmt.com/news/local/ai-data-center-expansion-dowagiac-loud-noise-complaints-residents-southwest-michigan-hyperscale-megawatt-bitcoin-wwmt", "host": "wwmt.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Dowagiac · Cass · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26027" } }, { "id": "telkite-aeris-ki-sawyer-marquette-mi", "state": "mi", "kind": "facility", "name": "K.I. Sawyer Data Center (SAGE building / Greenfield Campus)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Marquette" ], "city": "K. I. Sawyer", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Operator or original local-reporting context; source dates and proposal stages retained.. My UP Now June19,2026 original interviews identify Telkite/Aeris exploration at former KI Sawyer airport in Marquette County. Mango Investments LLC ownership is reported; Telkite manages land. No permits, applications or end users were identified, and a rumored vote was not scheduled. Website claims of1000acres,130000sf SAGE building,25/50/500 to 1000MW timelines are marketing scenarios, not additive commissioned IT capacity. Interview discusses roughly25MW gas generation contingent on finding an end user, not25MW delivered IT. Former SAGE building needs modernization; water/noise assertions are unmeasured. No current construction, signed tenant or ready-for-service date established. Not whole-record or current operating-census certification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.myupnow.com/news/local/he-wants-to-bring-a-data-center-to-the-upper-peninsula-he-also-says-dont/article_ef82a784-75a0-4bbd-80e3-cec8ad62726d.html", "host": "myupnow.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 46.43145, "lng": -87.64144, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-and-original-local-reporting-round57-2026-10-15.json", "scope": "Operator or original local-reporting context; source dates and proposal stages retained.", "fields": {}, "notes": [ "My UP Now June19,2026 original interviews identify Telkite/Aeris exploration at former KI Sawyer airport in Marquette County. Mango Investments LLC ownership is reported; Telkite manages land. No permits, applications or end users were identified, and a rumored vote was not scheduled.", "Website claims of1000acres,130000sf SAGE building,25/50/500 to 1000MW timelines are marketing scenarios, not additive commissioned IT capacity. Interview discusses roughly25MW gas generation contingent on finding an end user, not25MW delivered IT. Former SAGE building needs modernization; water/noise assertions are unmeasured. No current construction, signed tenant or ready-for-service date established.", "Not whole-record or current operating-census certification." ], "sources": [ { "url": "https://www.myupnow.com/news/local/he-wants-to-bring-a-data-center-to-the-upper-peninsula-he-also-says-dont/article_ef82a784-75a0-4bbd-80e3-cec8ad62726d.html", "host": "myupnow.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "K. I. Sawyer · Marquette · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26103" } }, { "id": "rocklocker-kalkaska-go-mi", "state": "mi", "kind": "facility", "name": "Kalkaska Go", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Kalkaska" ], "city": "", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.. Company second statement specifically disclaims data centers on public lands while continuing carbon-storage business; not evidence the whole company closed. Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.traverseticker.com/news/developer-pulls-plug-on-kalkaska-data-center/", "host": "traverseticker.com", "date": "2025-11-20", "published": "2025-11-20", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 44.6849, "lng": -85.09034, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcomes-review-round20-2026-10-14.json", "scope": "Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.", "fields": { "reported_action_type": "public-land-proposal-abandoned", "reported_finding": "Traverse Ticker reports Rocklocker / Kalkaska Go ended proposed public-land data center pursuit and cancelled community forum.", "report_display_date": "2025-11-20", "independently_verified_current_status": null }, "notes": [ "Company second statement specifically disclaims data centers on public lands while continuing carbon-storage business; not evidence the whole company closed.", "Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.traverseticker.com/news/developer-pulls-plug-on-kalkaska-data-center/", "host": "traverseticker.com", "date": "2025-11-20", "published": "2025-11-20", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Kalkaska · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26079" } }, { "id": "liberty-center-one-royal-oak-mi", "state": "mi", "kind": "facility", "name": "Liberty Center One Royal Oak Data Center", "group": "operating", "status": "Operator-listed service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Royal Oak", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Liberty Center One offices versus data-center site identity. Genericserviceshomepageprovides4815DelemereRoyalOakand1080NimitzviewCincinnatiexplicitOFFICEaddresses;notexactdatacenterproof. ColocationadvertisementdoesnotconfirmbothwholeofficebuildingsareDCs. No numericcapacity,areaoropeningadopted. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://libertycenterone.com/", "host": "libertycenterone.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.libertycenterone.com/our-data-center/", "host": "www.libertycenterone.com", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed primary source" }, { "url": "https://www.libertycenterone.com/about-us/", "host": "www.libertycenterone.com", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed primary source" } ], "loc": { "lat": 42.67584, "lng": -83.40265, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "Liberty Center One offices versus data-center site identity", "fields": {}, "notes": [ "Genericserviceshomepageprovides4815DelemereRoyalOakand1080NimitzviewCincinnatiexplicitOFFICEaddresses;notexactdatacenterproof. ColocationadvertisementdoesnotconfirmbothwholeofficebuildingsareDCs. No numericcapacity,areaoropeningadopted.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://libertycenterone.com/", "host": "libertycenterone.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "encore-2026-10-17-batch1", "scope": "Limited source identity and stage review; not whole-record certification, parcel verification or a physical-site census.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_service", "scope": "Liberty Center One’s own facility and company pages identify current Royal Oak colocation services. This is an operator service context; office coordinates, historical opening details and company-wide capabilities are not independent parcel or occupancy verification." } }, "notes": [ "Liberty Center One’s own facility and company pages identify current Royal Oak colocation services. This is an operator service context; office coordinates, historical opening details and company-wide capabilities are not independent parcel or occupancy verification." ], "sources": [ { "url": "https://www.libertycenterone.com/our-data-center/", "host": "www.libertycenterone.com", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed primary source" }, { "url": "https://www.libertycenterone.com/about-us/", "host": "www.libertycenterone.com", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed primary source" }, { "url": "https://libertycenterone.com/", "host": "libertycenterone.com", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed primary source" } ], "checked": "2026-10-17", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Royal Oak · Oakland · Source context reviewed", "status_scope": "Liberty Center One’s own facility and company pages identify current Royal Oak colocation services. This is an operator service context; office coordinates, historical opening details and company-wide capabilities are not independent parcel or occupancy verification.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26125" } }, { "id": "liquid-web-dc3-lansing-mi", "state": "mi", "kind": "facility", "name": "Liquid Web Lansing DC3 (2703 Ena Drive)", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Eaton" ], "city": "Lansing", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Liquid Web Lansing two-site scope and apparent power. 13.5MVAutilitynotcriticalITor13.5MWactivepower;scopeacrossfacilitiesunspecified. A/BtoDC3aliasnotproven.1997founding/regionyearnotexactopeningofeachDC. Servercapacitynotcurrentoccupancy. No exactstreetorindependentcertificate;oldSafeHarborclaimnotcurrentlegalcomplianceproof. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-09-25", "Liquid Web original RSS published the Lansing DC3 completed maintenance update September 25, 2026. The feed contains separate scheduled, in progress and completed states. This records the dated company service update, not a data center opening, energization, exact physical work time or completion of all planned capacity expansion." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.liquidweb.com/data-centers/lansing-web-hosting/", "host": "liquidweb.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://status.liquidweb.com/history.rss", "host": "status.liquidweb.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 42.60784, "lng": -84.85108, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "Liquid Web Lansing two-site scope and apparent power", "fields": { "operator": "Liquid Web", "regional_facilities": 2, "locality": "Lansing, Michigan", "operator_described_ownership": "wholly owned", "named_facilities": [ { "label": "A", "area_sqft": 32000, "server_capacity": 8000 }, { "label": "B", "area_sqft": 90000, "server_capacity": 25000 } ], "published_expandable_utility_feeds_kva": 13500, "company_region_established_year": 1997 }, "notes": [ "13.5MVAutilitynotcriticalITor13.5MWactivepower;scopeacrossfacilitiesunspecified. A/BtoDC3aliasnotproven.1997founding/regionyearnotexactopeningofeachDC. Servercapacitynotcurrentoccupancy. No exactstreetorindependentcertificate;oldSafeHarborclaimnotcurrentlegalcomplianceproof.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.liquidweb.com/data-centers/lansing-web-hosting/", "host": "liquidweb.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 24", "scope": "Liquid Web current company page says it operates two Lansing data centers. Its original status RSS explicitly identifies Lansing DC3 and records customer affecting circuit maintenance completed in a September 25, 2026 update, with another completed DC3 network update in August. Operator reported service is based on that named customer service account, not an inference from the generic city listing alone. Scheduled window clocks differ from update clocks and are not used as exact physical work times. Neither maintenance nor the current check supplies a data center opening day, verified address, new capacity or completed expansion.", "fields": { "current_stage_evidence": { "outcome": "current_lansing_service_plus_named_dc3_completed_customer_maintenance", "scope": "Liquid Web current company page says it operates two Lansing data centers. Its original status RSS explicitly identifies Lansing DC3 and records customer affecting circuit maintenance completed in a September 25, 2026 update, with another completed DC3 network update in August. Operator reported service is based on that named customer service account, not an inference from the generic city listing alone. Scheduled window clocks differ from update clocks and are not used as exact physical work times. Neither maintenance nor the current check supplies a data center opening day, verified address, new capacity or completed expansion." }, "source_read_scope": { "original_rss_xml_parsed_locally": true, "retained_excerpt_receipt": "cohort-24-liquidweb-rss-excerpts.json", "specific_incident_pointer": "https://status.liquidweb.com/incidents/b21phz2p0yrq", "rss_item_publication_on": "2026-09-25", "scheduled_and_update_clocks_not_reconciled_as_physical_times": true, "separate_august_dc3_completed_update_read": true, "current_service_not_exact_opening_or_capacity": true } }, "notes": [ "Liquid Web current company page says it operates two Lansing data centers. Its original status RSS explicitly identifies Lansing DC3 and records customer affecting circuit maintenance completed in a September 25, 2026 update, with another completed DC3 network update in August. Operator reported service is based on that named customer service account, not an inference from the generic city listing alone. Scheduled window clocks differ from update clocks and are not used as exact physical work times. Neither maintenance nor the current check supplies a data center opening day, verified address, new capacity or completed expansion.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://www.liquidweb.com/data-centers/lansing-web-hosting/", "host": "www.liquidweb.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://status.liquidweb.com/history.rss", "host": "status.liquidweb.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lansing · Eaton · Source context reviewed", "status_scope": "Liquid Web current company page says it operates two Lansing data centers. Its original status RSS explicitly identifies Lansing DC3 and records customer affecting circuit maintenance completed in a September 25, 2026 update, with another completed DC3 network update in August. Operator reported service is based on that named customer service account, not an inference from the generic city listing alone. Scheduled window clocks differ from update clocks and are not used as exact physical work times. Neither maintenance nor the current check supplies a data center opening day, verified address, new capacity or completed expansion.", "event_evidence": [ { "date": "2026-09-25", "text": "Liquid Web original RSS published the Lansing DC3 completed maintenance update September 25, 2026. The feed contains separate scheduled, in progress and completed states. This records the dated company service update, not a data center opening, energization, exact physical work time or completion of all planned capacity expansion.", "kind": "announced", "sources": [ { "url": "https://status.liquidweb.com/history.rss", "host": "status.liquidweb.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26045" } }, { "id": "managedway-tym1-troy-mi", "state": "mi", "kind": "facility", "name": "ManagedWay TYM1 (319 Executive Drive)", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Troy", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. ManagedWay Troy two-building identity and rack density. AddresslistdoesnotmapTYM1/TYM2codesbyorder.30pluskWrackcapabilitynotcampusMW/currentaverage.2001customerhistorynotbothbuildingscommissionedthen. SOC/TierIIIplusreportsrestrictednotaccessed;designclaimnotindependentcertification. No streetparcelownershipinspection or exactopeningday. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://managedway.com/colocation-facilities", "host": "managedway.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=319+Executive+Drive%2C+Troy%2C+Michigan&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Unique calculated street range and county match" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.10352138368297%2C42.534144285372534%2C-83.09498737422102%2C42.54043246359747&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting, acquisition date unknown" } ], "loc": { "lng": -83.099254, "lat": 42.537288, "precision": "address", "basis": "Current named ManagedWay service address 319 Executive Drive, Troy, Michigan matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "ManagedWay Troy two-building identity and rack density", "fields": { "operator": "ManagedWay", "named_building_addresses": [ "600 Executive Drive, Troy, Michigan", "319 Executive Drive, Troy, Michigan" ], "facilities": 2, "available_rack_power_kw_min_exclusive": 30, "company_customer_history_since": 2001 }, "notes": [ "AddresslistdoesnotmapTYM1/TYM2codesbyorder.30pluskWrackcapabilitynotcampusMW/currentaverage.2001customerhistorynotbothbuildingscommissionedthen. SOC/TierIIIplusreportsrestrictednotaccessed;designclaimnotindependentcertification. No streetparcelownershipinspection or exactopeningday.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://managedway.com/colocation-facilities", "host": "managedway.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 24", "scope": "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 319 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "current_two_named_troy_buildings_kept_online_not_planned_availability", "scope": "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 319 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged." }, "source_scope": { "named_street_facility": "319 Executive Drive", "two_troy_buildings_explicit_in_source": true, "inherited_code_not_recertified": true, "staff_service_account_not_independent_uptime_measurement": true, "no_location_or_role_change": true } }, "notes": [ "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 319 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://managedway.com/colocation-facilities", "host": "managedway.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 25, October 23, 2026", "scope": "Calculated named operator service street reference only. Existing native status remains operating. Protected facts remain exact.", "fields": { "location_review_decision": { "location": { "lng": -83.099254, "lat": 42.537288, "precision": "address", "basis": "Current named ManagedWay service address 319 Executive Drive, Troy, Michigan matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating." }, "reference_method": "Census interpolated street address", "published_address": "319 Executive Drive, Troy, Michigan", "county_fips": [ "26125" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The exact current operator numeric service street is matched to one Census range in the retained county. This is a calculated service street reference, not a surveyed roof, legal parcel, title, floor, tenant unit or full campus boundary.", "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. Operator performance, space, power and completion statements are not adopted.", "Raw Census coordinates remain unchanged in source history. Public interpolated coordinates round to six decimal places below 0.1 metre displacement. This is not a survey accuracy claim. Official imagery acquisition date is unknown and may predate construction. No residential roof is selected.", "The operator explicitly describes both 319 and 600 Executive Drive as its two Troy buildings. Each retained record name already states its corresponding numeric Executive Drive street. This address join does not invent a TYM code mapping, split a combined research record or certify independent physical roofs. The operator supplies Troy, Michigan without a postal ZIP; no ZIP is inferred." ], "sources": [ { "url": "https://managedway.com/colocation-facilities", "host": "managedway.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact current named operator service address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=319+Executive+Drive%2C+Troy%2C+Michigan&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Unique calculated street range and county match" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.10352138368297%2C42.534144285372534%2C-83.09498737422102%2C42.54043246359747&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting, acquisition date unknown" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Operator service address reference, not a surveyed building or parcel", "summary": "Troy · Oakland · Source context reviewed", "status_scope": "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 319 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged." }, { "id": "managedway-tym2-troy-mi", "state": "mi", "kind": "facility", "name": "ManagedWay TYM2 (600 Executive Drive)", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Troy", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. ManagedWay Troy two-building identity and rack density. AddresslistdoesnotmapTYM1/TYM2codesbyorder.30pluskWrackcapabilitynotcampusMW/currentaverage.2001customerhistorynotbothbuildingscommissionedthen. SOC/TierIIIplusreportsrestrictednotaccessed;designclaimnotindependentcertification. No streetparcelownershipinspection or exactopeningday. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://managedway.com/colocation-facilities", "host": "managedway.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=600+Executive+Drive%2C+Troy%2C+Michigan&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Unique calculated street range and county match" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.10349674091917%2C42.53690692242353%2C-83.09496235388083%2C42.54319510064847&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting, acquisition date unknown" } ], "loc": { "lng": -83.09923, "lat": 42.540051, "precision": "address", "basis": "Current named ManagedWay service address 600 Executive Drive, Troy, Michigan matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "ManagedWay Troy two-building identity and rack density", "fields": { "operator": "ManagedWay", "named_building_addresses": [ "600 Executive Drive, Troy, Michigan", "319 Executive Drive, Troy, Michigan" ], "facilities": 2, "available_rack_power_kw_min_exclusive": 30, "company_customer_history_since": 2001 }, "notes": [ "AddresslistdoesnotmapTYM1/TYM2codesbyorder.30pluskWrackcapabilitynotcampusMW/currentaverage.2001customerhistorynotbothbuildingscommissionedthen. SOC/TierIIIplusreportsrestrictednotaccessed;designclaimnotindependentcertification. No streetparcelownershipinspection or exactopeningday.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://managedway.com/colocation-facilities", "host": "managedway.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 24", "scope": "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 600 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "current_two_named_troy_buildings_kept_online_not_planned_availability", "scope": "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 600 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged." }, "source_scope": { "named_street_facility": "600 Executive Drive", "two_troy_buildings_explicit_in_source": true, "inherited_code_not_recertified": true, "staff_service_account_not_independent_uptime_measurement": true, "no_location_or_role_change": true } }, "notes": [ "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 600 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://managedway.com/colocation-facilities", "host": "managedway.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 25, October 23, 2026", "scope": "Calculated named operator service street reference only. Existing native status remains operating. Protected facts remain exact.", "fields": { "location_review_decision": { "location": { "lng": -83.09923, "lat": 42.540051, "precision": "address", "basis": "Current named ManagedWay service address 600 Executive Drive, Troy, Michigan matched to one Census street range inside the retained county. Calculated service street reference only, not a surveyed roof, parcel, tenant unit or full campus. Existing native status remains operating." }, "reference_method": "Census interpolated street address", "published_address": "600 Executive Drive, Troy, Michigan", "county_fips": [ "26125" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The exact current operator numeric service street is matched to one Census range in the retained county. This is a calculated service street reference, not a surveyed roof, legal parcel, title, floor, tenant unit or full campus boundary.", "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. Operator performance, space, power and completion statements are not adopted.", "Raw Census coordinates remain unchanged in source history. Public interpolated coordinates round to six decimal places below 0.1 metre displacement. This is not a survey accuracy claim. Official imagery acquisition date is unknown and may predate construction. No residential roof is selected.", "The operator explicitly describes both 319 and 600 Executive Drive as its two Troy buildings. Each retained record name already states its corresponding numeric Executive Drive street. This address join does not invent a TYM code mapping, split a combined research record or certify independent physical roofs. The operator supplies Troy, Michigan without a postal ZIP; no ZIP is inferred." ], "sources": [ { "url": "https://managedway.com/colocation-facilities", "host": "managedway.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact current named operator service address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=600+Executive+Drive%2C+Troy%2C+Michigan&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Unique calculated street range and county match" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.10349674091917%2C42.53690692242353%2C-83.09496235388083%2C42.54319510064847&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting, acquisition date unknown" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Operator service address reference, not a surveyed building or parcel", "summary": "Troy · Oakland · Source context reviewed", "status_scope": "ManagedWay current colocation page identifies both Troy buildings at 319 and 600 Executive Drive and describes engineers and technicians keeping them online across three daily shifts. Operator reported service applies to the named 600 Executive Drive facility in that explicit two building service account. The source does not certify the inherited TYM code, an exact opening day, independent uptime or a formal Tier certification. Marketing specifications and future availability do not become delivered quantities. Existing addresses, identities and provider roles remain unchanged." }, { "id": "mason-columbia-road-data-center-mi", "state": "mi", "kind": "facility", "name": "Mason / Vevay Township Data Center (unnamed developer)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Ingham" ], "city": "Mason", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.. Secondary dated snapshot, not final annexation, project permit, confirmed tenant or construction. Other seven-entry regulatory sections are distinct jurisdictions: Eagle reported expiry February17,2027; Solon Resolution26-10 July13 extension to February9,2027; Williamstown draft minutes remain draft; Lenox recommendation is not adopted rule; Oakland Charter Township is not Oakland University. Linked originals and subsequent dispositions unexamined in this source review. Historical observations and forecasts are dated; no later outcome assumed. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Primary for what Mason city staff reported; not independently inspected annexation application or StateBoundaryCommission acceptance.. Laterannexationoutcomeandtenantidentityunknown. LinkedSeptember4reportlabelactuallytargetsfilenameSeptember11;requesttimedout,nodate/outcomeadopted. Otherjurisdictionlawsuit/noisethresholdsummariesinMasonreportaresecondaryandnotthissiteoradoptedMasonstandards. Generalcapitalbudget/street/parkprojectsinreportnotDCincentives.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://baldorilaw.com/resources/michigan-data-center-tracker", "host": "baldorilaw.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.mason.mi.us/document_center/Departments/City%20Manager/City%20Manager%20Reports/2026%20City%20Manager%20Reports/8.14.26%20City%20Manager%27s,%20FINAL.pdf?t=202608141542460", "host": "mason.mi.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.michigan.gov/lara/-/media/Project/Websites/lara/bcc-media/Boards-and-Commissions/State-Boundary-Commission/2026/10-7-26/10-7-2026-SBC-Draft-Minutes.pdf?rev=9c1acb9e7fac4ef5b99f41ad5f1a071d&hash=8645254EFFF24DFC5C96719CB9FF1B0F", "host": "www.michigan.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.michigan.gov/lara/-/media/Project/Websites/lara/bcc-media/Boards-and-Commissions/State-Boundary-Commission/2026/10-7-26/10-7-2026_SBC-Approved-Agenda.pdf?rev=1e46b31fd00f43f1b13e85d6d01ab6b5&hash=DD32EDD36814DEF022703326EC184812", "host": "www.michigan.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 42.57211, "lng": -84.37141, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round35-2026-10-14.json", "scope": "Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.", "fields": { "reported_context": "Baldori Law dated tracker reports Mason city staff learned of a landowner annexation request August14,2026, but the city had not received the application and was awaiting State Boundary Commission completeness notice. September4 outreach report did not establish approval.", "independently_verified_current_operating_status": null }, "notes": [ "Secondary dated snapshot, not final annexation, project permit, confirmed tenant or construction. Other seven-entry regulatory sections are distinct jurisdictions: Eagle reported expiry February17,2027; Solon Resolution26-10 July13 extension to February9,2027; Williamstown draft minutes remain draft; Lenox recommendation is not adopted rule; Oakland Charter Township is not Oakland University. Linked originals and subsequent dispositions unexamined in this source review.", "Historical observations and forecasts are dated; no later outcome assumed.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://baldorilaw.com/resources/michigan-data-center-tracker", "host": "baldorilaw.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "government-primary-review-round37-2026-10-14.json", "scope": "Primary for what Mason city staff reported; not independently inspected annexation application or StateBoundaryCommission acceptance.", "fields": { "official_report_date": "2026-08-14", "city_reported_notified_landowner_applied_for_annexation": true, "city_had_received_application_at_report_date": false, "boundary_commission_completeness_verified": false, "project_approval_verified": false }, "notes": [ "Laterannexationoutcomeandtenantidentityunknown. LinkedSeptember4reportlabelactuallytargetsfilenameSeptember11;requesttimedout,nodate/outcomeadopted. Otherjurisdictionlawsuit/noisethresholdsummariesinMasonreportaresecondaryandnotthissiteoradoptedMasonstandards. Generalcapitalbudget/street/parkprojectsinreportnotDCincentives.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.mason.mi.us/document_center/Departments/City%20Manager/City%20Manager%20Reports/2026%20City%20Manager%20Reports/8.14.26%20City%20Manager%27s,%20FINAL.pdf?t=202608141542460", "host": "mason.mi.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 24", "scope": "The State Boundary Commission October 7, 2026 minutes record a unanimous finding that annexation petition 26 AP 01 from Vevay Township to Mason is legally sufficient. The file is published with a draft minutes filename and the vote concerns legal sufficiency, not final annexation, rezoning, building permits or data center operation. These reviewed state documents do not themselves identify an individual developer or establish an exact physical data center phase. The City Manager report target was not fetched after a robots HTTP 403 response. No current project stage or parcel jurisdiction change is adopted.", "fields": { "current_stage_evidence": { "outcome": "state_annexation_legal_sufficiency_not_final_annexation_or_project_permit", "scope": "The State Boundary Commission October 7, 2026 minutes record a unanimous finding that annexation petition 26 AP 01 from Vevay Township to Mason is legally sufficient. The file is published with a draft minutes filename and the vote concerns legal sufficiency, not final annexation, rezoning, building permits or data center operation. These reviewed state documents do not themselves identify an individual developer or establish an exact physical data center phase. The City Manager report target was not fetched after a robots HTTP 403 response. No current project stage or parcel jurisdiction change is adopted." }, "source_scope": { "state_meeting_on": "2026-10-07", "petition": "26 AP 01", "minutes_filename_indicates_draft": true, "legal_sufficiency_vote_not_final_annexation": true, "no_individual_project_permit_or_parcel_jurisdiction_change": true, "city_manager_report_access_held": true } }, "notes": [ "The State Boundary Commission October 7, 2026 minutes record a unanimous finding that annexation petition 26 AP 01 from Vevay Township to Mason is legally sufficient. The file is published with a draft minutes filename and the vote concerns legal sufficiency, not final annexation, rezoning, building permits or data center operation. These reviewed state documents do not themselves identify an individual developer or establish an exact physical data center phase. The City Manager report target was not fetched after a robots HTTP 403 response. No current project stage or parcel jurisdiction change is adopted.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://www.michigan.gov/lara/-/media/Project/Websites/lara/bcc-media/Boards-and-Commissions/State-Boundary-Commission/2026/10-7-26/10-7-2026-SBC-Draft-Minutes.pdf?rev=9c1acb9e7fac4ef5b99f41ad5f1a071d&hash=8645254EFFF24DFC5C96719CB9FF1B0F", "host": "www.michigan.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.michigan.gov/lara/-/media/Project/Websites/lara/bcc-media/Boards-and-Commissions/State-Boundary-Commission/2026/10-7-26/10-7-2026_SBC-Approved-Agenda.pdf?rev=1e46b31fd00f43f1b13e85d6d01ab6b5&hash=DD32EDD36814DEF022703326EC184812", "host": "www.michigan.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Mason · Ingham · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26065" } }, { "id": "metrobloks-southfield-mi", "state": "mi", "kind": "facility", "name": "Metrobloks Southfield Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Southfield", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [ [ "2025-12-19", "The City of Southfield published its Metrobloks proposal statement on December 19, 2025, describing a recent Council approval and later permitting and oversight. This dates publication, not the exact vote day, construction commencement or computing operation." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.cityofsouthfield.com/news/city-southfield-statement-regarding-proposed-data-center", "host": "www.cityofsouthfield.com", "published": "2025-12-19", "date": "2025-12-19", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 42.62817, "lng": -83.38295, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo." }, "notes": [ "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The City original December 19, 2025 account acknowledges community concerns, describes Council approval of the Metrobloks proposal and says independent permits and continuing oversight are still required. Its acknowledgment does not supply a specific attributed concern episode or a final later disposition. The historical proposal approval is not exact current construction or commissioned computing. Claimed future resource and ratepayer benefits remain statements rather than measured impacts.", "fields": { "current_stage_evidence": { "outcome": "historical_city_proposal_approval_not_current_physical_stage", "scope": "The City original December 19, 2025 account acknowledges community concerns, describes Council approval of the Metrobloks proposal and says independent permits and continuing oversight are still required. Its acknowledgment does not supply a specific attributed concern episode or a final later disposition. The historical proposal approval is not exact current construction or commissioned computing. Claimed future resource and ratepayer benefits remain statements rather than measured impacts." } }, "notes": [ "The City original December 19, 2025 account acknowledges community concerns, describes Council approval of the Metrobloks proposal and says independent permits and continuing oversight are still required. Its acknowledgment does not supply a specific attributed concern episode or a final later disposition. The historical proposal approval is not exact current construction or commissioned computing. Claimed future resource and ratepayer benefits remain statements rather than measured impacts.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.cityofsouthfield.com/news/city-southfield-statement-regarding-proposed-data-center", "host": "www.cityofsouthfield.com", "published": "2025-12-19", "date": "2025-12-19", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Southfield · Oakland · Source context reviewed", "event_evidence": [ { "date": "2025-12-19", "text": "The City of Southfield published its Metrobloks proposal statement on December 19, 2025, describing a recent Council approval and later permitting and oversight. This dates publication, not the exact vote day, construction commencement or computing operation.", "kind": "announced", "sources": [ { "url": "https://www.cityofsouthfield.com/news/city-southfield-statement-regarding-proposed-data-center", "host": "www.cityofsouthfield.com", "published": "2025-12-19", "date": "2025-12-19", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26125" } }, { "id": "microsoft-dorr-township-mi", "state": "mi", "kind": "facility", "name": "Microsoft Dorr Township Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Allegan" ], "city": "Dorr Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.. No signed ordinance or exact start/expiry retained. Residents allegations about health, water and taxes are not independently adopted effects. Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-02-26", "Signed Dorr Township minutes record authorization of a 12 month temporary moratorium on new or expanded data centers on February 26, 2026, by six votes to zero. This approval concerns the moratorium, not approval or cancellation of the Microsoft project, an operating shutdown or a verified legal effective day." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://wilcoxnewspapers.com/dorr-twp-approves-12-month-moratorium-on-data-centers/", "host": "wilcoxnewspapers.com", "date": "2026-03-04", "published": "2026-03-04", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.dorrtownshipmi.gov/wp-content/uploads/2026/08/2-26-2026.pdf", "host": "www.dorrtownshipmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 42.59129, "lng": -85.88848, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcomes-review-round20-2026-10-14.json", "scope": "Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.", "fields": { "reported_action_type": "twelve-month-moratorium-reported", "reported_finding": "TownBroadcast reporting republished by Wilcox says Dorr Township approved twelve-month pause after debate over shorter period.", "report_display_date": "2026-03-04", "independently_verified_current_status": null }, "notes": [ "No signed ordinance or exact start/expiry retained. Residents allegations about health, water and taxes are not independently adopted effects.", "Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://wilcoxnewspapers.com/dorr-twp-approves-12-month-moratorium-on-data-centers/", "host": "wilcoxnewspapers.com", "date": "2026-03-04", "published": "2026-03-04", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 14", "scope": "Signed Dorr Township minutes record residents expressing concerns about the Microsoft data center on February 26, 2026. The Board authorized signature of an ordinance imposing a temporary moratorium on new or expanded data centers for 12 months by six votes to zero, after amending an initial nine month motion. This is a township regulatory action. Current individual project construction, permit disposition, operation, the ordinance legal effective day and later amendment history remain unverified. The moratorium is not a project cancellation or a physical shutdown.", "fields": { "current_stage_evidence": { "outcome": "township_moratorium_and_public_comments_physical_stage_held", "scope": "Signed Dorr Township minutes record residents expressing concerns about the Microsoft data center on February 26, 2026. The Board authorized signature of an ordinance imposing a temporary moratorium on new or expanded data centers for 12 months by six votes to zero, after amending an initial nine month motion. This is a township regulatory action. Current individual project construction, permit disposition, operation, the ordinance legal effective day and later amendment history remain unverified. The moratorium is not a project cancellation or a physical shutdown." }, "regulatory_scope": { "board_action_on": "2026-02-26", "minutes_recorded_final_vote": "6 to 0", "minutes_recorded_moratorium_duration": "12 months", "ordinance_effective_day_established": false, "later_ordinance_amendment_history_verified": false, "township_not_countywide_rule": true, "signed_minutes_pdf_pages_visually_read": [ 1, 2 ] } }, "notes": [ "Signed Dorr Township minutes record residents expressing concerns about the Microsoft data center on February 26, 2026. The Board authorized signature of an ordinance imposing a temporary moratorium on new or expanded data centers for 12 months by six votes to zero, after amending an initial nine month motion. This is a township regulatory action. Current individual project construction, permit disposition, operation, the ordinance legal effective day and later amendment history remain unverified. The moratorium is not a project cancellation or a physical shutdown.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones." ], "sources": [ { "url": "https://www.dorrtownshipmi.gov/wp-content/uploads/2026/08/2-26-2026.pdf", "host": "www.dorrtownshipmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Dorr Township · Allegan · Source context reviewed", "event_evidence": [ { "date": "2026-02-26", "text": "Signed Dorr Township minutes record authorization of a 12 month temporary moratorium on new or expanded data centers on February 26, 2026, by six votes to zero. This approval concerns the moratorium, not approval or cancellation of the Microsoft project, an operating shutdown or a verified legal effective day.", "kind": "approved", "sources": [ { "url": "https://www.dorrtownshipmi.gov/wp-content/uploads/2026/08/2-26-2026.pdf", "host": "www.dorrtownshipmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26005" } }, { "id": "microsoft-gaines-township-mi", "state": "mi", "kind": "facility", "name": "Microsoft Gaines Township Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Kent" ], "city": "Gaines Township", "address": "", "who": "Microsoft", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. No specific development plans had been provided. The existing Switch Pyramid's water use and history are not Microsoft site facts. Requested rezoning is not an observed approval; historic purchase price is land consideration, not project capex or current power demand. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-04-15", "Gaines Charter Township certified minutes record the Planning Commission public hearing on the Microsoft rezoning request on April 15, 2026. The hearing included public concerns and company answers. The certified PDF has an incomplete motion continuation, so this event does not assert a final rezoning decision, current construction or operation." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wgvunews.org/news/2025-12-16/gaines-township-to-consider-rezoning-for-future-microsoft-data-center", "host": "wgvunews.org", "date": "2025-12-16", "published": "2025-12-16", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.gainestownship.org/Documents/How%20Do%20I/Document%20Center/Meeting%20Agendas%20and%20Minutes/Planning%20Commission/April%2015%2C%202026%20Planning%20Commission%20Minutes.pdf?t=202606120538070", "host": "www.gainestownship.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://local.microsoft.com/blog/gaines-charter-township-public-meeting/", "host": "local.microsoft.com", "published": "2026-03-10", "date": "2026-03-10", "checked": "2026-10-24", "label": "Reviewed operator source" }, { "url": "https://local.microsoft.com/communities/americas/michigan/", "host": "local.microsoft.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lat": 43.03214, "lng": -85.5493, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round28-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "WGVU reports Microsoft's rezoning request for an additional Gaines Township parcel adjoining its former Steelcase land, with a December 18 public hearing scheduled.", "independently_verified_current_operating_status": null }, "notes": [ "No specific development plans had been provided. The existing Switch Pyramid's water use and history are not Microsoft site facts. Requested rezoning is not an observed approval; historic purchase price is land consideration, not project capex or current power demand.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.wgvunews.org/news/2025-12-16/gaines-township-to-consider-rezoning-for-future-microsoft-data-center", "host": "wgvunews.org", "date": "2025-12-16", "published": "2025-12-16", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 14", "scope": "The certified April 15, 2026 Gaines Charter Township Planning Commission minutes record the Microsoft rezoning public hearing, public comments, company answers and a tabling motion. The certified PDF omits the motion continuation before its signed certification page; the separate May packet includes a draft continuation. No final township rezoning outcome, a vote count for that motion, present physical construction or operation is inferred from the incomplete certified sequence. Proposed conditions and company assurances remain proposals and attributed statements.", "fields": { "current_stage_evidence": { "outcome": "certified_hearing_and_incomplete_motion_sequence_current_stage_held", "scope": "The certified April 15, 2026 Gaines Charter Township Planning Commission minutes record the Microsoft rezoning public hearing, public comments, company answers and a tabling motion. The certified PDF omits the motion continuation before its signed certification page; the separate May packet includes a draft continuation. No final township rezoning outcome, a vote count for that motion, present physical construction or operation is inferred from the incomplete certified sequence. Proposed conditions and company assurances remain proposals and attributed statements." }, "source_read_scope": { "certified_minutes_pages_text_read": [ 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 ], "certified_pages_visually_read": [ 4, 8, 11, 12 ], "certification_signature_dated": "2026-05-28", "certified_sequence_missing_motion_continuation": true, "draft_may_packet_not_final_vote_proof": true, "kent_county_gaines_distinct_from_genesee_county_gaines": true } }, "notes": [ "The certified April 15, 2026 Gaines Charter Township Planning Commission minutes record the Microsoft rezoning public hearing, public comments, company answers and a tabling motion. The certified PDF omits the motion continuation before its signed certification page; the separate May packet includes a draft continuation. No final township rezoning outcome, a vote count for that motion, present physical construction or operation is inferred from the incomplete certified sequence. Proposed conditions and company assurances remain proposals and attributed statements.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones." ], "sources": [ { "url": "https://www.gainestownship.org/Documents/How%20Do%20I/Document%20Center/Meeting%20Agendas%20and%20Minutes/Planning%20Commission/April%2015%2C%202026%20Planning%20Commission%20Minutes.pdf?t=202606120538070", "host": "www.gainestownship.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check69, October24,2026", "scope": "The named Microsoft recap identifies datacenter project concepts discussed in Gaines Charter Township. Its March 3, 2026 meeting and March 10, 2026 publisher metadata remain distinct. Developer per source is a prospective project association, not an approved final design, land title or current construction finding. Regional water and utility price pledges do not establish measured site outcomes. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred.", "fields": { "company_association": { "name": "Microsoft", "role": "developer", "identity_scope": "provider_brand_only", "scope": "The named Microsoft recap identifies datacenter project concepts discussed in Gaines Charter Township. Its March 3, 2026 meeting and March 10, 2026 publisher metadata remain distinct. Developer per source is a prospective project association, not an approved final design, land title or current construction finding. Regional water and utility price pledges do not establish measured site outcomes. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred." }, "provider_role": "developer" }, "notes": [ "The named Microsoft recap identifies datacenter project concepts discussed in Gaines Charter Township. Its March 3, 2026 meeting and March 10, 2026 publisher metadata remain distinct. Developer per source is a prospective project association, not an approved final design, land title or current construction finding. Regional water and utility price pledges do not establish measured site outcomes. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred." ], "sources": [ { "url": "https://local.microsoft.com/blog/gaines-charter-township-public-meeting/", "host": "local.microsoft.com", "published": "2026-03-10", "date": "2026-03-10", "checked": "2026-10-24", "label": "Reviewed operator source" }, { "url": "https://local.microsoft.com/communities/americas/michigan/", "host": "local.microsoft.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Gaines Township · Kent · Source context reviewed", "event_evidence": [ { "date": "2026-04-15", "text": "Gaines Charter Township certified minutes record the Planning Commission public hearing on the Microsoft rezoning request on April 15, 2026. The hearing included public concerns and company answers. The certified PDF has an incomplete motion continuation, so this event does not assert a final rezoning decision, current construction or operation.", "kind": "hearing", "sources": [ { "url": "https://www.gainestownship.org/Documents/How%20Do%20I/Document%20Center/Meeting%20Agendas%20and%20Minutes/Planning%20Commission/April%2015%2C%202026%20Planning%20Commission%20Minutes.pdf?t=202606120538070", "host": "www.gainestownship.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26081" } }, { "id": "microsoft-lowell-township-mi", "state": "mi", "kind": "facility", "name": "Microsoft Lowell Township Data Center", "group": "proposed", "status": "Operator-listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Kent" ], "city": "Lowell Township", "address": "", "who": "Microsoft", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://local.microsoft.com/wp-content/uploads/2026/03/202603_Boards_Lowell_Charter_Township.pdf", "host": "local.microsoft.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" }, { "url": "https://local.microsoft.com/blog/lowell-charter-township-public-meeting/", "host": "local.microsoft.com", "published": "2026-03-10", "date": "2026-03-10", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lat": 43.04839, "lng": -85.56704, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "TheGander’s MarchURLdirectory explicitly updatedOctober 8 reports named Michiganproject stages:DeepGreenLansingAprilwithdrawal;Pavilionrezoningwithdrawal;Morleyunfiledconcept;HarborFarmzpropertymarketing;Lowellutilitytalksstalled;OaklandUniversityduediligence;Yorkwithdrawal;Solonpauseextension;Tonduunfiledconcept.", "independently_verified_current_operating_status": null, "site_stage_scope": "Municipal service/development talks suspended, not project withdrawal" }, "notes": [ "Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 14", "scope": "Microsoft community boards explicitly describe a proposed data center in Lowell Charter Township and say the programme is early in planning, with rezoning intended after community consultation. Operator listed development describes that proposal only. No exact meeting day is established from the PDF filename, and the boards do not prove approved zoning, current physical construction or operation. The township homepage robots redirect remains an access route hold, not evidence that no municipal records exist.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_early_planning_proposal", "scope": "Microsoft community boards explicitly describe a proposed data center in Lowell Charter Township and say the programme is early in planning, with rezoning intended after community consultation. Operator listed development describes that proposal only. No exact meeting day is established from the PDF filename, and the boards do not prove approved zoning, current physical construction or operation. The township homepage robots redirect remains an access route hold, not evidence that no municipal records exist." }, "date_and_approval_scope": { "pdf_first_page_visually_read": true, "exact_meeting_day_established": false, "operator_intention_to_seek_rezoning_not_actual_approval": true } }, "notes": [ "Microsoft community boards explicitly describe a proposed data center in Lowell Charter Township and say the programme is early in planning, with rezoning intended after community consultation. Operator listed development describes that proposal only. No exact meeting day is established from the PDF filename, and the boards do not prove approved zoning, current physical construction or operation. The township homepage robots redirect remains an access route hold, not evidence that no municipal records exist.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones." ], "sources": [ { "url": "https://local.microsoft.com/wp-content/uploads/2026/03/202603_Boards_Lowell_Charter_Township.pdf", "host": "local.microsoft.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check69, October24,2026", "scope": "The Microsoft recap identifies prospective datacenter planning in Lowell Charter Township. Microsoft says it is considering a land purchase; no completed acquisition is established. The March 5, 2026 community meeting and March 10, 2026 publisher metadata are distinct clocks. Developer per source is a prospective project association, not a rezoning approval or current construction finding. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred.", "fields": { "company_association": { "name": "Microsoft", "role": "developer", "identity_scope": "provider_brand_only", "scope": "The Microsoft recap identifies prospective datacenter planning in Lowell Charter Township. Microsoft says it is considering a land purchase; no completed acquisition is established. The March 5, 2026 community meeting and March 10, 2026 publisher metadata are distinct clocks. Developer per source is a prospective project association, not a rezoning approval or current construction finding. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred." }, "provider_role": "developer" }, "notes": [ "The Microsoft recap identifies prospective datacenter planning in Lowell Charter Township. Microsoft says it is considering a land purchase; no completed acquisition is established. The March 5, 2026 community meeting and March 10, 2026 publisher metadata are distinct clocks. Developer per source is a prospective project association, not a rezoning approval or current construction finding. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred." ], "sources": [ { "url": "https://local.microsoft.com/blog/lowell-charter-township-public-meeting/", "host": "local.microsoft.com", "published": "2026-03-10", "date": "2026-03-10", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lowell Township · Kent · Source context reviewed", "status_scope": "Microsoft community boards explicitly describe a proposed data center in Lowell Charter Township and say the programme is early in planning, with rezoning intended after community consultation. Operator listed development describes that proposal only. No exact meeting day is established from the PDF filename, and the boards do not prove approved zoning, current physical construction or operation. The township homepage robots redirect remains an access route hold, not evidence that no municipal records exist.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26081" } }, { "id": "newberry-bitcoin-mine-luce-county-mi", "state": "mi", "kind": "facility", "name": "Newberry Bitcoin Mine (Cloverland Electric service territory)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Luce" ], "city": "Newberry", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Newberry's operator, exact parcel, MW and current service terms are not disclosed. Noise measurements, a school dispute and a temporary restraining order concern Dafter and must not be copied to Newberry. Bills in committee are not law; statewide mine counts are explicitly incomplete, not an exhaustive census. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://bridgemi.com/business-watch/crypto-mines-noisy-nuisance-some-should-michigan-regulate-them/", "host": "bridgemi.com", "date": "2025-07-15", "published": "2025-07-15", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 46.47056, "lng": -85.54442, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round28-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "Bridge Michigan's utility-attributed regional account identifies one operating Newberry cryptocurrency mine in Cloverland territory alongside two Dafter mines.", "independently_verified_current_operating_status": null, "operator_or_site_identity_needs_crosswalk": true }, "notes": [ "Newberry's operator, exact parcel, MW and current service terms are not disclosed. Noise measurements, a school dispute and a temporary restraining order concern Dafter and must not be copied to Newberry. Bills in committee are not law; statewide mine counts are explicitly incomplete, not an exhaustive census.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://bridgemi.com/business-watch/crypto-mines-noisy-nuisance-some-should-michigan-regulate-them/", "host": "bridgemi.com", "date": "2025-07-15", "published": "2025-07-15", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Newberry · Luce · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26095" } }, { "id": "oakland-university-computing-auburn-hills-mi", "state": "mi", "kind": "facility", "name": "Oakland University Campus Computing Facility", "group": "proposed", "status": "Listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Auburn Hills", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.oakland.edu/data-infrastructure/", "host": "www.oakland.edu", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 42.69182, "lng": -83.36168, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "TheGander’s MarchURLdirectory explicitly updatedOctober 8 reports named Michiganproject stages:DeepGreenLansingAprilwithdrawal;Pavilionrezoningwithdrawal;Morleyunfiledconcept;HarborFarmzpropertymarketing;Lowellutilitytalksstalled;OaklandUniversityduediligence;Yorkwithdrawal;Solonpauseextension;Tonduunfiledconcept.", "independently_verified_current_operating_status": null, "site_stage_scope": "Trustees authorized due diligence, not final construction" }, "notes": [ "Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current original University account calls the Campus Computing Facility proposed and says the project is entering due diligence, with design and construction described as later phases. Its June 2026 authorization to move forward is not a report that physical construction began. Existing computing rooms in Dodge Hall and North Foundation Hall are separate from this proposed facility and do not make it operating. No campus power, predicted revenue, future construction duration or tenant allocation becomes an accomplished facility fact.", "fields": { "current_stage_evidence": { "outcome": "current_university_named_proposal", "scope": "The current original University account calls the Campus Computing Facility proposed and says the project is entering due diligence, with design and construction described as later phases. Its June 2026 authorization to move forward is not a report that physical construction began. Existing computing rooms in Dodge Hall and North Foundation Hall are separate from this proposed facility and do not make it operating. No campus power, predicted revenue, future construction duration or tenant allocation becomes an accomplished facility fact." }, "source_read_scope": { "selected_sections": [ "Campus Computing Facility", "Frequently Asked Questions introduction", "Project Timeline", "Steering Committee due diligence schedule" ], "existing_computing_rooms_not_joined": true, "no_calendar_entry_from_month_only_forecast": true } }, "notes": [ "The current original University account calls the Campus Computing Facility proposed and says the project is entering due diligence, with design and construction described as later phases. Its June 2026 authorization to move forward is not a report that physical construction began. Existing computing rooms in Dodge Hall and North Foundation Hall are separate from this proposed facility and do not make it operating. No campus power, predicted revenue, future construction duration or tenant allocation becomes an accomplished facility fact.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.oakland.edu/data-infrastructure/", "host": "www.oakland.edu", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Auburn Hills · Oakland · Source context reviewed", "status_scope": "The current original University account calls the Campus Computing Facility proposed and says the project is entering due diligence, with design and construction described as later phases. Its June 2026 authorization to move forward is not a report that physical construction began. Existing computing rooms in Dodge Hall and North Foundation Hall are separate from this proposed facility and do not make it operating. No campus power, predicted revenue, future construction duration or tenant allocation becomes an accomplished facility fact.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26125" } }, { "id": "otava-ann-arbor-mi", "state": "mi", "kind": "facility", "name": "Otava Ann Arbor Data Center", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Washtenaw" ], "city": "Ann Arbor", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. OTAVA two named Michigan area/power scopes, location crosswalk held. 1.2MWMetroDetroitTOTALbuildingloadnotIT;2500kVAtransformernot2.5MWIT. MidMichigan1600kVAUPSnotcriticalITMW. GeographiclabelsWestland/MidMichigansourceheadingsmisordered;exactmunicipality/streetcrosswalkunresolved. AnnArborfieldsnotadoptedfromunreadleadsection. CompanythreesitesversusotherthreeMIwordingnotsitecensus. No currentmeteredloadorc ertifierreport. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.otava.com/data-center-michigan/", "host": "otava.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.otava.com/data-centers/ann-arbor/", "host": "www.otava.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 42.25324, "lng": -83.8388, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "OTAVA two named Michigan area/power scopes, location crosswalk held", "fields": { "operator": "OTAVA", "named_sites": [ { "market": "Mid-Michigan, Genesee County", "total_hosting_area_sqft": 32500, "raised_floor_sqft": 22500, "workplace_recovery_sqft": 10000, "historical_upgrade_investment_usd_min_exclusive": 1000000, "conditioned_ups_apparent_power_kva_min_exclusive": 1600 }, { "market": "Metro Detroit", "standalone_building_sqft": 34500, "raised_floor_sqft": 18000, "total_building_load_capacity_mw": 1.2, "utility_transformer_kva": 2500, "generators": 3, "each_generator_kw": 500 } ] }, "notes": [ "1.2MWMetroDetroitTOTALbuildingloadnotIT;2500kVAtransformernot2.5MWIT. MidMichigan1600kVAUPSnotcriticalITMW. GeographiclabelsWestland/MidMichigansourceheadingsmisordered;exactmunicipality/streetcrosswalkunresolved. AnnArborfieldsnotadoptedfromunreadleadsection. CompanythreesitesversusotherthreeMIwordingnotsitecensus. No currentmeteredloadorc ertifierreport.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.otava.com/data-center-michigan/", "host": "otava.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current original OTAVA Ann Arbor facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "fields": { "current_stage_evidence": { "outcome": "current_named_operator_service", "scope": "The current original OTAVA Ann Arbor facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed." }, "source_read_scope": { "selected_sections": [ "Enterprise grade facility account", "Location details", "Other features", "Service FAQ" ], "named_facility_controls_over_combined_page_heading": true, "technical_quantities_not_exported": true } }, "notes": [ "The current original OTAVA Ann Arbor facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.otava.com/data-centers/ann-arbor/", "host": "www.otava.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Ann Arbor · Washtenaw · Source context reviewed", "status_scope": "The current original OTAVA Ann Arbor facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26161" } }, { "id": "otava-metro-detroit-westland-mi", "state": "mi", "kind": "facility", "name": "Otava Metro Detroit Data Center", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Westland", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. OTAVA two named Michigan area/power scopes, location crosswalk held. 1.2MWMetroDetroitTOTALbuildingloadnotIT;2500kVAtransformernot2.5MWIT. MidMichigan1600kVAUPSnotcriticalITMW. GeographiclabelsWestland/MidMichigansourceheadingsmisordered;exactmunicipality/streetcrosswalkunresolved. AnnArborfieldsnotadoptedfromunreadleadsection. CompanythreesitesversusotherthreeMIwordingnotsitecensus. No currentmeteredloadorc ertifierreport. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.otava.com/data-center-michigan/", "host": "otava.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.otava.com/data-centers/metro-detroit/", "host": "www.otava.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 42.29671, "lng": -83.29815, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "OTAVA two named Michigan area/power scopes, location crosswalk held", "fields": { "operator": "OTAVA", "named_sites": [ { "market": "Mid-Michigan, Genesee County", "total_hosting_area_sqft": 32500, "raised_floor_sqft": 22500, "workplace_recovery_sqft": 10000, "historical_upgrade_investment_usd_min_exclusive": 1000000, "conditioned_ups_apparent_power_kva_min_exclusive": 1600 }, { "market": "Metro Detroit", "standalone_building_sqft": 34500, "raised_floor_sqft": 18000, "total_building_load_capacity_mw": 1.2, "utility_transformer_kva": 2500, "generators": 3, "each_generator_kw": 500 } ] }, "notes": [ "1.2MWMetroDetroitTOTALbuildingloadnotIT;2500kVAtransformernot2.5MWIT. MidMichigan1600kVAUPSnotcriticalITMW. GeographiclabelsWestland/MidMichigansourceheadingsmisordered;exactmunicipality/streetcrosswalkunresolved. AnnArborfieldsnotadoptedfromunreadleadsection. CompanythreesitesversusotherthreeMIwordingnotsitecensus. No currentmeteredloadorc ertifierreport.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.otava.com/data-center-michigan/", "host": "otava.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current original OTAVA Metro Detroit facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "fields": { "current_stage_evidence": { "outcome": "current_named_operator_service", "scope": "The current original OTAVA Metro Detroit facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed." }, "source_read_scope": { "selected_sections": [ "Enterprise grade facility account", "Location details", "Other features", "Service FAQ" ], "named_facility_controls_over_combined_page_heading": true, "technical_quantities_not_exported": true } }, "notes": [ "The current original OTAVA Metro Detroit facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.otava.com/data-centers/metro-detroit/", "host": "www.otava.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Westland · Wayne · Source context reviewed", "status_scope": "The current original OTAVA Metro Detroit facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "otava-mid-michigan-flint-township-mi", "state": "mi", "kind": "facility", "name": "Otava Mid-Michigan Data Center (5225 Exchange Drive)", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Genesee" ], "city": "Flint Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. OTAVA two named Michigan area/power scopes, location crosswalk held. 1.2MWMetroDetroitTOTALbuildingloadnotIT;2500kVAtransformernot2.5MWIT. MidMichigan1600kVAUPSnotcriticalITMW. GeographiclabelsWestland/MidMichigansourceheadingsmisordered;exactmunicipality/streetcrosswalkunresolved. AnnArborfieldsnotadoptedfromunreadleadsection. CompanythreesitesversusotherthreeMIwordingnotsitecensus. No currentmeteredloadorc ertifierreport. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.otava.com/data-center-michigan/", "host": "otava.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.otava.com/data-centers/mid-michigan/", "host": "www.otava.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 43.03663, "lng": -83.723, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "OTAVA two named Michigan area/power scopes, location crosswalk held", "fields": { "operator": "OTAVA", "named_sites": [ { "market": "Mid-Michigan, Genesee County", "total_hosting_area_sqft": 32500, "raised_floor_sqft": 22500, "workplace_recovery_sqft": 10000, "historical_upgrade_investment_usd_min_exclusive": 1000000, "conditioned_ups_apparent_power_kva_min_exclusive": 1600 }, { "market": "Metro Detroit", "standalone_building_sqft": 34500, "raised_floor_sqft": 18000, "total_building_load_capacity_mw": 1.2, "utility_transformer_kva": 2500, "generators": 3, "each_generator_kw": 500 } ] }, "notes": [ "1.2MWMetroDetroitTOTALbuildingloadnotIT;2500kVAtransformernot2.5MWIT. MidMichigan1600kVAUPSnotcriticalITMW. GeographiclabelsWestland/MidMichigansourceheadingsmisordered;exactmunicipality/streetcrosswalkunresolved. AnnArborfieldsnotadoptedfromunreadleadsection. CompanythreesitesversusotherthreeMIwordingnotsitecensus. No currentmeteredloadorc ertifierreport.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.otava.com/data-center-michigan/", "host": "otava.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current original OTAVA Mid Michigan facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "fields": { "current_stage_evidence": { "outcome": "current_named_operator_service", "scope": "The current original OTAVA Mid Michigan facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed." }, "source_read_scope": { "selected_sections": [ "Enterprise grade facility account", "Location details", "Other features", "Service FAQ" ], "named_facility_controls_over_combined_page_heading": true, "technical_quantities_not_exported": true } }, "notes": [ "The current original OTAVA Mid Michigan facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.otava.com/data-centers/mid-michigan/", "host": "www.otava.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Flint Township · Genesee · Source context reviewed", "status_scope": "The current original OTAVA Mid Michigan facility page expressly describes infrastructure and cloud services delivered to businesses, current colocation and recovery services and operational monitoring. This supports reported service at the named facility, not a new commissioning date, every phase or full capacity utilization. The older combined Michigan page has a mismatched Westland heading above its Mid Michigan description. The specific current facility page is used for the named service finding; no street, municipality, point, technical quantity or existing geography is changed.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26049" } }, { "id": "franklin-partners-pavilion-township-mi", "state": "mi", "kind": "facility", "name": "Pavilion Township Data Center (S 26th St & E N Ave)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Kalamazoo" ], "city": "Pavilion Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.paviliontwpmi.gov/notices-postings", "host": "www.paviliontwpmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.paviliontwpmi.gov/_files/ugd/222eb1_a75a165163a748a19a693be3c6d6e4d7.pdf", "host": "www.paviliontwpmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.paviliontwpmi.gov/_files/ugd/222eb1_5cc4c95223f646c48abaad26c0a52653.pdf", "host": "www.paviliontwpmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 42.25737, "lng": -85.54421, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "TheGander’s MarchURLdirectory explicitly updatedOctober 8 reports named Michiganproject stages:DeepGreenLansingAprilwithdrawal;Pavilionrezoningwithdrawal;Morleyunfiledconcept;HarborFarmzpropertymarketing;Lowellutilitytalksstalled;OaklandUniversityduediligence;Yorkwithdrawal;Solonpauseextension;Tonduunfiledconcept.", "independently_verified_current_operating_status": null, "site_stage_scope": "Reported rezoning request withdrawal" }, "notes": [ "Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current Township notice index links two scanned temporary pause documents. The Ordinance 184 copy has a blank adoption line and a past notice of proposed consideration. A separate zoning amendment copy also has blank ordinance and adoption fields. Their commencement clauses differ, with publication after adoption in one and eight days after publication in the other. No final enactment or exact legal effect is certified from these copies. Neither document identifies a current Franklin Partners computing facility physical stage. Townshipwide proposed regulation is separate from project construction, closure and individual permissions.", "fields": { "current_stage_evidence": { "outcome": "township_draft_rules_not_exact_franklin_project_stage", "scope": "The current Township notice index links two scanned temporary pause documents. The Ordinance 184 copy has a blank adoption line and a past notice of proposed consideration. A separate zoning amendment copy also has blank ordinance and adoption fields. Their commencement clauses differ, with publication after adoption in one and eight days after publication in the other. No final enactment or exact legal effect is certified from these copies. Neither document identifies a current Franklin Partners computing facility physical stage. Townshipwide proposed regulation is separate from project construction, closure and individual permissions." }, "source_read_scope": { "ordinance184_visual_pages": [ 1, 2, 3, 4 ], "separate_authority_draft_visual_pages": [ 1, 2, 3 ], "blank_adoption_fields_retained": true, "different_conditional_commencement_clocks_retained": true, "no_future_calendar_date_from_past_notice": true } }, "notes": [ "The current Township notice index links two scanned temporary pause documents. The Ordinance 184 copy has a blank adoption line and a past notice of proposed consideration. A separate zoning amendment copy also has blank ordinance and adoption fields. Their commencement clauses differ, with publication after adoption in one and eight days after publication in the other. No final enactment or exact legal effect is certified from these copies. Neither document identifies a current Franklin Partners computing facility physical stage. Townshipwide proposed regulation is separate from project construction, closure and individual permissions.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.paviliontwpmi.gov/notices-postings", "host": "www.paviliontwpmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.paviliontwpmi.gov/_files/ugd/222eb1_a75a165163a748a19a693be3c6d6e4d7.pdf", "host": "www.paviliontwpmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.paviliontwpmi.gov/_files/ugd/222eb1_5cc4c95223f646c48abaad26c0a52653.pdf", "host": "www.paviliontwpmi.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Pavilion Township · Kalamazoo · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26077" } }, { "id": "project-cannoli-van-buren-township-wayne-county-mi", "state": "mi", "kind": "project", "name": "Project Cannoli", "group": "building", "status": "Site work reported", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center development", "counties": [ "Wayne" ], "city": "Van Buren Township", "address": "", "who": "Panattoni", "end_user": "Google (announced participant)", "mw": null, "power": "1,000 MW original maximum utility-service request (March 17, 2026)", "power_note": "Original March 17, 2026 DTE requested maximum utility load, not IT, metered demand or delivered power. The adjustable December 2027 to December 2028 ramp is a plan, not an opening. October 1 utility-contract approval is conditional; acceptance and fulfillment are not verified.", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Cannoli official FAQ with quoted utility load schedule. Town FAQ quotes utility testimony, underlying contract/order not read in this row. Load ramp adjustable.2.7GWnew generation/resource portfolio is not site capacity and not additive to1GW. Development-agreement link does not prove executed effective terms. Ratepayer protection statements are not measured bill outcomes. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-03-17", "Google announced a Michigan data-center/energy collaboration and said it was evaluating Van Buren Township. The later county statement identifies Cannoli; the date is not final-plan approval, site-work commencement or 2700 MW of site IT capacity." ], [ "2026-02-11", "Van Buren Township Planning Commission granted Project Cannoli preliminary site plan approval with conditions, 5–2. This is a preliminary planning milestone, not final plan approval, an issued building permit, satisfied conditions or operation." ], [ "2026-10-01", "MPSC conditionally approved DTE and Google electricity contracts in U-22058. Acceptance and other conditions apply; this is a utility-contract milestone, not local siting or construction permission, completed obligations, energized service or operation." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://vbtmi.gov/departments/municipal_services/data_center_faq.php", "host": "vbtmi.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.panattoni.com/vanburen/", "host": "www.panattoni.com", "published": "", "date": "", "checked": "2026-10-16", "label": "Developer Project Cannoli design and proposed water supplier" }, { "url": "https://www.waynecountymi.gov/News/Commission/Wayne-County-Commission-Van-Buren-%E2%80%9CProject-Cannoli%E2%80%9D-Data-Center-Statement", "host": "www.waynecountymi.gov", "published": "2026-10-01", "date": "2026-10-01", "checked": "2026-10-16", "label": "Wayne County public statement, extracted text view" }, { "url": "https://blog.google/innovation-and-ai/infrastructure-and-cloud/global-network/clean-energy-reliability-michigan/", "host": "blog.google", "published": "2026-03-17", "date": "2026-03-17", "checked": "2026-10-16", "label": "Michigan development and grid-resource announcement" }, { "url": "https://www.datacenters.google/locations/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Current Google location directory; flags are not status proof" }, { "url": "https://www.wemu.org/wemu-news/2026-10-15/van-buren-township-planning-commission-approves-data-center-plan", "host": "www.wemu.org", "published": "2026-10-15", "date": "2026-10-15", "checked": "2026-10-16", "label": "WEMU reporting of preliminary work and a plan vote" }, { "url": "https://vbtmi.gov/Document_Center/Agendas%20&%20Minutes/Planning%20Commission/2024/Minutes/2-11-26%20PC%20Min.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "February 11, 2026 planning minutes, page 20: preliminary approval with conditions" }, { "url": "https://vbtmi.gov/Document_Center/Agendas%20&%20Minutes/Planning%20Commission/2024/Packets/10-14-26%20PC%20Packet.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "October 14, 2026 agenda packet; August staff reviews and proposed final plans" }, { "url": "https://vbtmi.gov/Document_Center/Department/Municipal%20Services/Development%20Agreement%20VBT%202026.05.20%20final.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "Posted development agreement; blank developer and township signature pages" }, { "url": "https://vbtmi.gov/government/agendas___minutes/planning_commission.php", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "Planning commission document index checked October 16, 2026" }, { "url": "https://mi-psc.my.site.com/sfc/servlet.shepherd/version/download/068cs00002YBZ99AAH", "host": "mi-psc.my.site.com", "published": "2026-10-01", "date": "2026-10-01", "checked": "2026-10-16", "label": "October 1, 2026 MPSC order U-22058-0187; operative provisions pages 137 to 141" }, { "url": "https://mi-psc.my.site.com/sfc/servlet.shepherd/version/download/068cs00001pUwYcAAK", "host": "mi-psc.my.site.com", "published": "2026-03-17", "date": "2026-03-17", "checked": "2026-10-16", "label": "March 17, 2026 original DTE application/testimony; maximum requested load and adjustable ramp, PDF page 10" } ], "loc": { "lat": 42.25283, "lng": -83.28002, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "Cannoli official FAQ with quoted utility load schedule", "fields": { "project_name": "Cannoli", "published_location_description": "nearI94andHaggertyRoad,VanBurenTownship,Michigan", "site_maximum_contract_load_mw": 1000, "contract_load_basis": "maximum customer load,not explicitly criticalIT", "utility_testimony_quoted_load_ramp_start_month": "2027-12", "utility_testimony_quoted_max_load_month": "2028-12", "separate_new_grid_resource_capacity_gw": 2.7 }, "notes": [ "Town FAQ quotes utility testimony, underlying contract/order not read in this row. Load ramp adjustable.2.7GWnew generation/resource portfolio is not site capacity and not additive to1GW. Development-agreement link does not prove executed effective terms. Ratepayer protection statements are not measured bill outcomes.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://vbtmi.gov/departments/municipal_services/data_center_faq.php", "host": "vbtmi.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Google pending-location follow-up October 16", "scope": "Explicit existing-record identity, source confidence and phase review. No new physical site, parcel, whole-campus completion, whole-state refresh or automatic directory-flag status.", "fields": { "identity_scope": "The existing Project Cannoli ID is retained. Wayne County explicitly identifies the proposed Google Van Buren Township project as Cannoli; Panattoni names itself developer. No new Google Michigan ID is created.", "provider_roles": [ { "name": "Panattoni", "role": "developer" }, { "name": "Google", "role": "planned operator" } ], "google_role_scope": "Google is the announced data-center participant; the planned-operator role is a scoped interpretation of Google's own development announcement/current directory and the county identity bridge. No current operator, legal parcel owner, signed tenancy or corporate parent is certified.", "reported_site_work_scope": "WEMU's October 15 report says preliminary construction has begun. Site work is reported, not independently inspected data-hall construction, delivered capacity or operation. The developer's proposed-campus wording is retained; the primary final-plan decision and conditions have not been read.", "reported_plan_vote": { "report_published_on": "2026-10-15", "body_vote_day": "Wednesday", "image_caption_meeting_date": "2026-10-15", "normalized_exact_vote_date": null, "scope": "The report describes final-plan approval but its caption date and weekday differ. No exact approval milestone is invented, and no issued building/occupancy permission or legal condition is asserted." }, "county_tax_scope": "The October 1 county statement links Google/Cannoli but expressly separates its tax-benefit veto override from construction authorization and a development agreement. Its October 14 final-plan review was prospective on October 1. Estimated incentives and promised community payments are not realized savings or paid benefits.", "water_supply_design": "Panattoni names Great Lakes Water Authority supply and designs without groundwater use. This is a prospective developer commitment, not an independently read water contract, permit, measured withdrawal or zero total water use.", "environmental_design_scope": "Panattoni describes no discharge to Belleville Lake/ground, Tier 4 backup generators and noise/landscape design commitments. These are design statements, not issued permits, operating test results, zero emissions or proven legal compliance.", "power_scope": "The 2.7 GW DTE collaboration describes a grid resource portfolio, not site IT capacity. Inherited FAQ-quoted 1000 MW maximum contract load and ramp dates remain unnormalized until their underlying utility documents are reviewed.", "location_scope": "The approximate inherited point remains unchanged. Road descriptions, developer renderings, the county statement and news are not a reviewed parcel or exact building pin." }, "notes": [ "Keep each source type, date and confidence visible. Reported activity is not a site inspection, legal permission, complete campus or current metered demand.", "All inherited geometry, addresses, jurisdictions, legacy MW, investment, jobs and opening fields remain unchanged.", "WEMU is secondary reporting, not a primary approval record. Its road label I-95 conflicts with the inherited official I-94 context; no address or point is changed. The caption/weekday conflict keeps an exact approval date unset." ], "sources": [ { "url": "https://www.panattoni.com/vanburen/", "host": "www.panattoni.com", "published": "", "date": "", "checked": "2026-10-16", "label": "Developer Project Cannoli design and proposed water supplier" }, { "url": "https://www.waynecountymi.gov/News/Commission/Wayne-County-Commission-Van-Buren-%E2%80%9CProject-Cannoli%E2%80%9D-Data-Center-Statement", "host": "www.waynecountymi.gov", "published": "2026-10-01", "date": "2026-10-01", "checked": "2026-10-16", "label": "Wayne County public statement, extracted text view" }, { "url": "https://blog.google/innovation-and-ai/infrastructure-and-cloud/global-network/clean-energy-reliability-michigan/", "host": "blog.google", "published": "2026-03-17", "date": "2026-03-17", "checked": "2026-10-16", "label": "Michigan development and grid-resource announcement" }, { "url": "https://www.datacenters.google/locations/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Current Google location directory; flags are not status proof" }, { "url": "https://www.wemu.org/wemu-news/2026-10-15/van-buren-township-planning-commission-approves-data-center-plan", "host": "www.wemu.org", "published": "2026-10-15", "date": "2026-10-15", "checked": "2026-10-16", "label": "WEMU reporting of preliminary work and a plan vote" } ], "checked": "2026-10-16", "whole_record_certified": false }, { "overlay": "Primary project scope and county-only location review, October 16, 2026", "scope": "Bounded primary-source planning and location review; current physical activity is separately sourced.", "fields": { "preliminary_plan_decision": { "meeting_date": "2026-02-11", "document_page": 20, "action": "Preliminary site plan approval with conditions", "vote": { "yes": 5, "no": 2 }, "applicant": "PDC AK LPIC, LLC c/o Panattoni Development Company", "planned_buildings": { "data_processing": 3, "administrative_office": 1, "network_service": 1 }, "scope": "Historical preliminary approval only; not final plan approval, building permit, satisfied conditions, actual building construction or operation." }, "preliminary_approval_conditions": { "document_page": 20, "development_agreement": "Township Board authorization required before final site plan approval, including GLWA main connection/meter details, sanitary discharge limits and metering, recurring noise monitoring, construction access and phasing.", "sewer_discharge_limit_million_gallons_per_day": 0.75, "water_scope": "Condition concerning sewer discharge, not measured water consumption, water withdrawal or an operating discharge permit." }, "october_final_plan_review": { "agenda_date": "2026-10-14", "agenda_case": "25-041", "staff_review_date": "2026-08-19", "plans_date": "2026-07-29", "document_pages": [ 1, 14, 15 ], "proposed_buildings": { "data_processing": 3, "administrative_office": 1, "network_service": 2 }, "campus_area_acres": 282.2, "separate_switching_station": true, "scope": "Final-plan agenda and dated staff review, not the October vote, fulfilled conditions or issued construction permission." }, "proposed_area_conflict": { "document_pages": [ 14, 15 ], "narrative_footprint_sqft": 973247, "table_footprint_sqft": 973364, "table_gross_floor_area_sqft": 1423112, "office_footprint_revision_sqft": 117, "scope": "Different stated proposed design measures retained verbatim as numbers; no constructed area, reconciled survey, IT load or building count census inferred." }, "plan_location_scope": { "document_pages": [ 1, 2, 14 ], "bounds": "East of Haggerty Road, north of I-94 North Service Drive, west of Hannan Road, south of Wayne County Community College and I-275.", "agency_address_not_site": "46425 Tyler Road is the Township address, not the data center street address.", "separate_temporary_yard": { "case": "26-013", "parcel_ids": [ "83-051-99-0001-004", "83-051-99-0002-701", "83-051-99-0002-702" ], "scope": "Corby Energy temporary construction yard across Haggerty; not adopted as Cannoli campus parcels." }, "precise_parcel_or_map_point_adopted": false, "scope": "The inherited approximate point still needs explicit plan-to-authoritative-geometry review." }, "engineering_review_conditions": { "letter_date": "2026-08-20", "document_pages": [ 24, 25 ], "engineering_plans_submitted_on": "2026-07-03", "initial_engineering_review_on": "2026-08-07", "proposed_glwa_connection": "24-inch water main toward the GLWA main within Tyler Road, with connection, meter and engineering details to finalize.", "phase_three_timing": null, "permit_scope": "Staff says the plan summary lists County SESC and EGLE NPDES permits as obtained, but requests the actual approvals. Their numbers, issuance and conditions have not been independently verified here.", "scope": "Staff review and planned utility design; not final engineering approval, measured water demand, confirmed permit issuance or completed infrastructure." }, "posted_agreement_execution_limits": { "printed_date": "2026-05-19", "document_pages": [ 16, 17 ], "developer_name": "PDC VBT, LLC", "developer_signature_blank": true, "township_signatures_blank": true, "execution_verified": false, "effective_agreement_date_verified": false, "scope": "Posted text contains a stated effective date and legal description but blank signatures/notarial fields. Filename final and upload/PDF creation dates do not establish execution, recordation or satisfied terms." }, "primary_final_decision_hold": { "checked_on": "2026-10-16", "index_latest_minutes_linked": "2026-09-23", "october_14_packet_linked": true, "october_14_minutes_link_found": false, "normalized_final_vote_date": null, "scope": "No October 14 minutes link found on the checked public index; absence of a link does not establish that no minutes or decision exists. The earlier reported vote/caption date conflict remains unresolved." } }, "notes": [ "Historical February preliminary decision has exact date and conditions; October packet is not adopted minutes.", "Physical activity retains its separately cited Site work reported label and secondary-report confidence. No new current-stage, power, water, opening, building or parcel claim." ], "sources": [ { "url": "https://vbtmi.gov/Document_Center/Agendas%20&%20Minutes/Planning%20Commission/2024/Minutes/2-11-26%20PC%20Min.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "February 11, 2026 planning minutes, page 20: preliminary approval with conditions" }, { "url": "https://vbtmi.gov/Document_Center/Agendas%20&%20Minutes/Planning%20Commission/2024/Packets/10-14-26%20PC%20Packet.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "October 14, 2026 agenda packet; August staff reviews and proposed final plans" }, { "url": "https://vbtmi.gov/Document_Center/Department/Municipal%20Services/Development%20Agreement%20VBT%202026.05.20%20final.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "Posted development agreement; blank developer and township signature pages" }, { "url": "https://vbtmi.gov/government/agendas___minutes/planning_commission.php", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "Planning commission document index checked October 16, 2026" }, { "url": "https://vbtmi.gov/departments/municipal_services/data_center_faq.php", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "Township Project Cannoli FAQ and public document links" } ], "checked": "2026-10-16", "whole_record_certified": false }, { "overlay": "S6-Cannoli-Utility-20261016", "scope": "Selected primary utility-order and original requested-load evidence only. Conditional electricity contracts are separate from physical stage, local planning permission, fulfilled conditions, parcel identity, IT capacity and actual consumption.", "fields": { "utility_case_identity": { "docket": "U-22058", "filing": "U-22058-0187", "order_date": "2026-10-01", "customer": "Google LLC", "utility": "DTE Electric Company", "location_scope": "Van Buren Township, Michigan", "pages": [ 1, 2 ], "scope": "Order describes the proposed Google facility and its service agreements. The existing Cannoli/Google association remains separately supported by the county statement and company announcement; no new record, operator-role change or parcel identity is inferred." }, "original_utility_request": { "application_date": "2026-03-17", "maximum_requested_load_mw": 1000, "contract_capacity_mw": 1000, "adjustable_planned_ramp_start": "2027-12", "adjustable_planned_ramp_end": "2028-12", "construction_load_may_precede_ramp": true, "pdf_page": 10, "scope": "Original applicant testimony, not a current measured load, IT capacity, actual energization or opening. The later conditional order is a separate legal milestone; the original requested figure is not reclassified as delivered or unconditionally approved service." }, "conditional_utility_approval": { "date": "2026-10-01", "decision": "conditional approval of PSA and CCAA", "physical_construction_or_operation_certified": false, "scope": "The historical utility-contract decision does not establish final local planning approval, an issued building/air/water permit, completed conditions, energized service or data-hall construction." }, "operative_conditions": { "A": { "pages": [ 138 ], "requirement": "Conditionally approves the March 17 primary supply and clean capacity accelerator agreements with Google." }, "B": { "pages": [ 137, 138 ], "requirement": "Conditions approval on cost-coverage representations and requires DTE to file express acceptance of all conditions within 30 days of the order. The cost-shifting protection has the footnote 19 exclusion." }, "C": { "pages": [ 138 ], "requirement": "Requires operating parameters to be updated as necessary for regulatory, reliability and transmission requirements before and after energization." }, "D": { "pages": [ 138 ], "requirement": "Removes caps on Google or DTE contributions toward line extension and electric infrastructure upgrades needed to serve Google." }, "E": { "pages": [ 139 ], "requirement": "Requires the financial compensation mechanism to be treated as ordinary income." }, "F": { "pages": [ 139 ], "requirement": "Requires same-year retirement and clean-energy-plan use of transferred renewable credits when removed from DTE renewable portfolio standard compliance." }, "G": { "pages": [ 139 ], "requirement": "Requires supplements to U-22168 integrated resource/clean energy plans within 21 days, comparing loads with and without Google, separately and combined with Green Chile, and modeling extension of credit-transfer/demand-response arrangements beyond May 31, 2033." }, "H": { "pages": [ 139, 140 ], "requirement": "Requires renewable-plan supplements within 21 days comparing Google and combined Green Chile loads, non-per-meter surcharge options and equitable incremental compliance cost recovery." }, "I": { "pages": [ 140 ], "requirement": "Requires a new contested application for updated interconnection procedures and a draft battery import/export tariff within 120 days." }, "J": { "pages": [ 140 ], "requirement": "Requires the next capacity demonstration to analyze Google and Green Chile loads separately and together using the stated direct loss-of-load method." }, "K": { "pages": [ 140 ], "requirement": "Requires energy-waste-reduction coordination plus analysis of incremental costs for the 2 percent savings target and related surcharges." }, "L": { "pages": [ 140, 141 ], "requirement": "Requires the next general rate case to include interconnection cost allocation and rate design proposals, six studies and reproducible supporting data, under seal if necessary." }, "M": { "pages": [ 141 ], "requirement": "Requires an application reviewing termination payments and collateral within three years after load-ramp completion." }, "N": { "pages": [ 141 ], "requirement": "Requires quarterly and annual reporting beginning April 15, 2027." }, "O": { "pages": [ 141 ], "requirement": "Consolidates renewable-plan case U-22057 into U-22168 for future amended renewable-plan filings; this is docket administration, not a merger of physical data center projects." } }, "acceptance_and_revision_requirements": { "express_acceptance_within_days": 30, "revised_special_contract_within_days_if_revision_needed": 30, "acceptance_filing_verified": false, "revised_contract_verified": false, "all_conditions_fulfilled_verified": false, "pages": [ 137, 138 ], "scope": "The order requires acceptance. Revised contracts are required only if DTE finds a revision necessary because of the conditions. This review does not establish whether later filings exist or whether compliance is complete; it makes no delinquency or noncompliance finding." }, "cost_protection_scope": { "pages": [ 137, 138 ], "footnote": 19, "choice_customer_exclusion": true, "universal_no_rate_impact_guarantee": false, "measured_bill_outcome_verified": false, "scope": "The order conditions approval on Google covering costs and assigns collateral shortfall risk to DTE. Its other-customer protection excludes customers not paying power supply costs, such as choice customers; footnote 19 reports the Staff finding that those customers will pay more. This is the stated order and cited analysis, not an observed bill outcome." }, "regulatory_followup_scope": { "resource_plan_case": "U-22168", "renewable_plan_case_consolidated_from": "U-22057", "resource_supplement_within_days": 21, "new_interconnection_tariff_application_within_days": 120, "reporting_begins": "2027-04-15", "collateral_review_within_years_after_ramp_completion": 3, "fulfillment_verified": false, "scope": "These are prospective requirements in the order. No completed filings, new scheduled job or fulfilled obligation is inferred; Green Chile combined-load analysis does not merge the sites or add their capacities." }, "physical_stage_and_location_limits": { "status_change": false, "location_change": false, "street_address_adopted": false, "parcel_geometry_adopted": false, "opening_date_adopted": false, "scope": "The original testimony describes about 280 acres, while local planning material uses 282.2 acres. Those are differently scoped plan descriptions, not a survey, title or permission to relocate the inherited approximate point. Site work reported retains its separate secondary confidence." }, "quantity_separation": { "legacy_mw_changed": false, "it_capacity_adopted": false, "approved_service_adopted": false, "metered_power_adopted": false, "grid_resources_added_to_request": false, "scope": "The original 1000 MW requested service is not added to renewable, storage, capacity-credit or regional grid-resource figures and is not normalized to IT load. No water quantity is introduced." }, "source_date_and_review_scope": { "order_date": "2026-10-01", "application_date": "2026-03-17", "checked": "2026-10-16", "order_pdf_pages_text_read": [ 1, 2, 3, 137, 138, 139, 140, 141 ], "order_pdf_pages_visually_checked": [ 1, 2, 137, 138, 139, 140, 141 ], "testimony_pdf_pages_text_and_visually_checked": [ 10 ], "whole_documents_certified": false, "scope": "Local October 16 capture/check date is separate from document dates and UTC October 17 response timestamps. Only the specified pages underpin this field review; no full 147-page order or 250-page filing audit is claimed." } }, "notes": [ "October 1 utility-contract approval is conditional. DTE acceptance, any required revisions and later compliance remain unverified. The order has an explicit choice-customer cost-protection exclusion. Original requested load and adjustable ramp are not delivered power or an opening. Site work reported retains its own secondary source; the point remains approximate." ], "sources": [ { "url": "https://mi-psc.my.site.com/sfc/servlet.shepherd/version/download/068cs00002YBZ99AAH", "host": "mi-psc.my.site.com", "published": "2026-10-01", "date": "2026-10-01", "checked": "2026-10-16", "label": "October 1, 2026 MPSC order U-22058-0187; operative provisions pages 137 to 141" }, { "url": "https://mi-psc.my.site.com/sfc/servlet.shepherd/version/download/068cs00001pUwYcAAK", "host": "mi-psc.my.site.com", "published": "2026-03-17", "date": "2026-03-17", "checked": "2026-10-16", "label": "March 17, 2026 original DTE application/testimony; maximum requested load and adjustable ramp, PDF page 10" }, { "url": "https://www.waynecountymi.gov/News/Commission/Wayne-County-Commission-Van-Buren-%E2%80%9CProject-Cannoli%E2%80%9D-Data-Center-Statement", "host": "www.waynecountymi.gov", "published": "2026-10-01", "date": "2026-10-01", "checked": "2026-10-16", "label": "Wayne County public statement, extracted text view" }, { "url": "https://vbtmi.gov/Document_Center/Agendas%20&%20Minutes/Planning%20Commission/2024/Packets/10-14-26%20PC%20Packet.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "October 14, 2026 agenda packet; August staff reviews and proposed final plans" } ], "checked": "2026-10-16", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Van Buren Township · Wayne · Source context reviewed", "search_extra": "Google Van Buren Township Project Cannoli Panattoni", "status_scope": "WEMU's October 15 report says preliminary construction has begun. Site work is reported, not independently inspected data-hall construction, delivered capacity or operation. The developer's proposed-campus wording is retained; the primary final-plan decision and conditions have not been read.", "event_evidence": [ { "date": "2026-03-17", "text": "Google announced a Michigan data-center/energy collaboration and said it was evaluating Van Buren Township. The later county statement identifies Cannoli; the date is not final-plan approval, site-work commencement or 2700 MW of site IT capacity.", "kind": "announced", "sources": [ { "url": "https://blog.google/innovation-and-ai/infrastructure-and-cloud/global-network/clean-energy-reliability-michigan/", "host": "blog.google", "published": "2026-03-17", "date": "2026-03-17", "checked": "2026-10-16", "label": "Michigan development and grid-resource announcement" } ] }, { "date": "2026-02-11", "text": "Van Buren Township Planning Commission granted Project Cannoli preliminary site plan approval with conditions, 5–2. This is a preliminary planning milestone, not final plan approval, an issued building permit, satisfied conditions or operation.", "kind": "approved", "sources": [ { "url": "https://vbtmi.gov/Document_Center/Agendas%20&%20Minutes/Planning%20Commission/2024/Minutes/2-11-26%20PC%20Min.pdf", "host": "vbtmi.gov", "published": "", "date": "", "checked": "2026-10-16", "label": "February 11, 2026 planning minutes, page 20: preliminary approval with conditions" } ] }, { "date": "2026-10-01", "text": "MPSC conditionally approved DTE and Google electricity contracts in U-22058. Acceptance and other conditions apply; this is a utility-contract milestone, not local siting or construction permission, completed obligations, energized service or operation.", "kind": "approved", "sources": [ { "url": "https://mi-psc.my.site.com/sfc/servlet.shepherd/version/download/068cs00002YBZ99AAH", "host": "mi-psc.my.site.com", "published": "2026-10-01", "date": "2026-10-01", "checked": "2026-10-16", "label": "October 1, 2026 MPSC order U-22058-0187; operative provisions pages 137 to 141" } ] } ], "typed_water_facts": [ { "measure": "supply_source", "value": "Planned Great Lakes Water Authority supply without groundwater use.", "unit": null, "as_of": null, "as_of_basis": "not_published", "observed_on": "2026-10-16", "basis": "operator_reported_statement", "scope": "Undated developer design commitment only. Not an executed water contract, a permit, measured withdrawal/consumption or zero total water use.", "sources": [ "https://www.panattoni.com/vanburen/" ] } ], "typed_power_facts": [ { "measure": "utility_service_request", "value": 1000, "unit": "MW", "basis": "requested", "as_of": "2026-03-17", "as_of_basis": "source_dated", "observed_on": "2026-10-16", "scope": "Original March 17 DTE applicant testimony, PDF page 10: 1000 MW maximum requested/contract load with an adjustable December 2027 to December 2028 ramp. Construction load may precede that ramp. Not measured demand, IT capacity, actual energization, an opening date or unconditionally approved service; the October 1 conditional utility order is recorded separately.", "sources": [ "https://mi-psc.my.site.com/sfc/servlet.shepherd/version/download/068cs00001pUwYcAAK" ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "cloverleaf-cherry-blossom-frenchtown-mi", "state": "mi", "kind": "facility", "name": "Project Cherry Blossom", "group": "proposed", "status": "Listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Monroe" ], "city": "Frenchtown Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Cherry Blossom developer concept and fiscal forecasts. Forecast tax categories may overlap capture/district structures; not summed or recorded as actual payments. No executed CBA, independent permit approval, numeric IT MW or observed groundbreaking. Developer describes eventual end-user selection after approvals and power, so do not invent hyperscaler. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://cherryblossomdatacenter.com/", "host": "cherryblossomdatacenter.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 41.92829, "lng": -83.53801, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "primary-source-review-round9-2026-10-14.json", "scope": "Cherry Blossom developer concept and fiscal forecasts", "fields": { "project_name": "Project Cherry Blossom", "locality": "former ProMedica Hospital site off I-75 and North Dixie Highway, Frenchtown Township, Michigan", "proposed_site_acres_approx": 200, "expected_construction_jobs_min_exclusive": 1000, "expected_longterm_fulltime_jobs_min_exclusive": 100, "developer_estimated_annual_local_government_tax_usd": 14800000, "developer_estimated_annual_college_tax_usd": 2100000, "developer_estimated_annual_monroe_isd_technology_tax_usd": 4700000, "developer_estimated_annual_jefferson_school_tax_usd": 1500000, "community_benefits_agreement_stage": "negotiating" }, "notes": [ "Forecast tax categories may overlap capture/district structures; not summed or recorded as actual payments. No executed CBA, independent permit approval, numeric IT MW or observed groundbreaking. Developer describes eventual end-user selection after approvals and power, so do not invent hyperscaler.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cherryblossomdatacenter.com/", "host": "cherryblossomdatacenter.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current original developer page expressly calls Project Cherry Blossom a proposed data center in Frenchtown Township at the former ProMedica Hospital site. It describes approvals and power confirmation before later selection of a computing end user. This supports a listed proposal only. Developer forecasts, claimed benefits, planned cooling and a benefits agreement under negotiation are not accomplished construction, payments, a signed tenant or computing operation.", "fields": { "current_stage_evidence": { "outcome": "current_original_named_proposal", "scope": "The current original developer page expressly calls Project Cherry Blossom a proposed data center in Frenchtown Township at the former ProMedica Hospital site. It describes approvals and power confirmation before later selection of a computing end user. This supports a listed proposal only. Developer forecasts, claimed benefits, planned cooling and a benefits agreement under negotiation are not accomplished construction, payments, a signed tenant or computing operation." } }, "notes": [ "The current original developer page expressly calls Project Cherry Blossom a proposed data center in Frenchtown Township at the former ProMedica Hospital site. It describes approvals and power confirmation before later selection of a computing end user. This supports a listed proposal only. Developer forecasts, claimed benefits, planned cooling and a benefits agreement under negotiation are not accomplished construction, payments, a signed tenant or computing operation.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://cherryblossomdatacenter.com/", "host": "cherryblossomdatacenter.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Frenchtown Township · Monroe · Source context reviewed", "status_scope": "The current original developer page expressly calls Project Cherry Blossom a proposed data center in Frenchtown Township at the former ProMedica Hospital site. It describes approvals and power confirmation before later selection of a computing end user. This supports a listed proposal only. Developer forecasts, claimed benefits, planned cooling and a benefits agreement under negotiation are not accomplished construction, payments, a signed tenant or computing operation.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26115" } }, { "id": "verrus-project-flex-lyon-township-oakland-county-mi", "state": "mi", "kind": "facility", "name": "Project Flex", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Lyon Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original reporter/issuer named-project context, with inference and stages explicit.. BrianAllnutt PlanetDetroit January13,2026 originalLyonmeetingreport. ProjectFlexconditionalSeptember8siteplanapprovalpendingindependentnoise/energyaudits, notfinalauthorization.6buildings/172acres/1.8Msfproposalonecampus. Alphabetinvestmentinparent notGoogleoperatororAnthropictenantproof. January7study44dBAforecastEXCLUDESdiesel; primaryBESSunder4hour/secondarydiesellongeroutages conflictwithsimplifiednodieselexecutivequote. No110dBAgenericmachinevalueassiteboundarynoise; noactualwellcontamination/healthharmfromresidentconcern.12monthmoratoriumwasresidentREQUESTnotenacted. Jan15/22meetings/Feb8questionshistorical, no outreachactions. Plans/historicalchanges/courtallegations/utilitycustomerinference not all-field,siteITorcurrentoperatingcertification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://planetdetroit.org/2026/01/lyon-township-data-center-plan/", "host": "planetdetroit.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.71449, "lng": -83.40032, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-withdrawals-power-redesign-and-review-stage-round79-2026-10-15.json", "scope": "Original reporter/issuer named-project context, with inference and stages explicit.", "fields": {}, "notes": [ "BrianAllnutt PlanetDetroit January13,2026 originalLyonmeetingreport. ProjectFlexconditionalSeptember8siteplanapprovalpendingindependentnoise/energyaudits, notfinalauthorization.6buildings/172acres/1.8Msfproposalonecampus. Alphabetinvestmentinparent notGoogleoperatororAnthropictenantproof.", "January7study44dBAforecastEXCLUDESdiesel; primaryBESSunder4hour/secondarydiesellongeroutages conflictwithsimplifiednodieselexecutivequote. No110dBAgenericmachinevalueassiteboundarynoise; noactualwellcontamination/healthharmfromresidentconcern.12monthmoratoriumwasresidentREQUESTnotenacted. Jan15/22meetings/Feb8questionshistorical, no outreachactions.", "Plans/historicalchanges/courtallegations/utilitycustomerinference not all-field,siteITorcurrentoperatingcertification." ], "sources": [ { "url": "https://planetdetroit.org/2026/01/lyon-township-data-center-plan/", "host": "planetdetroit.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lyon Township · Oakland · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26125" } }, { "id": "raeden-detroit-carrier-hotel-mi", "state": "mi", "kind": "facility", "name": "Raeden Detroit Carrier Hotel (615 W Lafayette)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Detroit", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. RAEDEN two Detroit properties and power-scope separation. 500kVAUPSnotcriticalIT;linked3MWplusnotautomatically615Lafayettecapacity.1050Woodward3MWSCALABLEpotentialnotactualenergizedIT. Distinctaddressesnotonephysicalbuilding. No originalopeningorindependentwholecarrierhotelownership. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://raeden.com/data-centers/detroit/", "host": "raeden.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.31143, "lng": -83.26043, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "RAEDEN two Detroit properties and power-scope separation", "fields": { "operator": "RAEDEN", "named_detroit_sites": [ { "address": "615 WestLafayetteBoulevard, Detroit, Michigan", "ups_apparent_power_kva": 500, "network_link": "directly connected to3MWplusenterprisecolocation" }, { "address": "1050 WoodwardAvenue, Detroit, Michigan", "alias": "One Campus Martius", "colocation_space_sqft": 10000, "scalable_power_mw_max": 3 } ] }, "notes": [ "500kVAUPSnotcriticalIT;linked3MWplusnotautomatically615Lafayettecapacity.1050Woodward3MWSCALABLEpotentialnotactualenergizedIT. Distinctaddressesnotonephysicalbuilding. No originalopeningorindependentwholecarrierhotelownership.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://raeden.com/data-centers/detroit/", "host": "raeden.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 51", "scope": "The current original provider page describes colocation and Remote Hands at 615 West Lafayette and advertises available space and ready infrastructure. These offerings and connection claims do not explicitly establish commissioned computing for this exact component in this bounded review. The page separately describes 1050 Woodward and a future mirror site. Their service, power and floor area are not transferred to the inherited Lafayette record.", "fields": { "current_stage_evidence": { "outcome": "available_colocation_not_explicit_current_computing", "scope": "The current original provider page describes colocation and Remote Hands at 615 West Lafayette and advertises available space and ready infrastructure. These offerings and connection claims do not explicitly establish commissioned computing for this exact component in this bounded review. The page separately describes 1050 Woodward and a future mirror site. Their service, power and floor area are not transferred to the inherited Lafayette record." }, "source_read_scope": { "selected_section": "615 West Lafayette", "separate_1050_woodward_component_excluded": true } }, "notes": [ "The current original provider page describes colocation and Remote Hands at 615 West Lafayette and advertises available space and ready infrastructure. These offerings and connection claims do not explicitly establish commissioned computing for this exact component in this bounded review. The page separately describes 1050 Woodward and a future mirror site. Their service, power and floor area are not transferred to the inherited Lafayette record.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://raeden.com/data-centers/detroit/", "host": "raeden.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Detroit · Wayne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "raeden-one-campus-martius-detroit-mi", "state": "mi", "kind": "facility", "name": "Raeden One Campus Martius (1050 Woodward)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Detroit", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.. RAEDENoperatorpageidentifies1050Woodward/OneCampusMartiusDetroit10000sfcolocation,up-to3MWSCALABLEpower. NoIT/grossbasis,currentcommittedorcommissioned3MWverified. Separate615WLafayette500kVAUPS andconnected3MW+colocation cannotbeadded/copiedtoOCM. TwoRAEDENmanagedhubsitesnotproofownswholebuildings. 1-6monthmarketingcallnotactualRFS. Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://raeden.com/data-centers/detroit/", "host": "raeden.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.25722, "lng": -83.2429, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-and-government-review-round46-2026-10-14.json", "scope": "Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.", "fields": { "named_original_context": "RAEDENoperatorpageidentifies1050Woodward/OneCampusMartiusDetroit10000sfcolocation,up-to3MWSCALABLEpower. NoIT/grossbasis,currentcommittedorcommissioned3MWverified. Separate615WLafayette500kVAUPS andconnected3MW+colocation cannotbeadded/copiedtoOCM. TwoRAEDENmanagedhubsitesnotproofownswholebuildings. 1-6monthmarketingcallnotactualRFS." }, "notes": [ "RAEDENoperatorpageidentifies1050Woodward/OneCampusMartiusDetroit10000sfcolocation,up-to3MWSCALABLEpower. NoIT/grossbasis,currentcommittedorcommissioned3MWverified. Separate615WLafayette500kVAUPS andconnected3MW+colocation cannotbeadded/copiedtoOCM. TwoRAEDENmanagedhubsitesnotproofownswholebuildings. 1-6monthmarketingcallnotactualRFS.", "Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol." ], "sources": [ { "url": "https://raeden.com/data-centers/detroit/", "host": "raeden.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 52", "scope": "The current original provider page separately describes 1050 Woodward Avenue as One Campus Martius and offers purpose built colocation and Remote Hands. It describes scalable potential and available space, not explicit exact current computing occupancy or commissioned service in this bounded review. The distinct 615 West Lafayette premise and future mirror site are not this building. No capacity, facility identity, role or location changes are made.", "fields": { "current_stage_evidence": { "outcome": "available_space_and_scalable_power_current_stage_held", "scope": "The current original provider page separately describes 1050 Woodward Avenue as One Campus Martius and offers purpose built colocation and Remote Hands. It describes scalable potential and available space, not explicit exact current computing occupancy or commissioned service in this bounded review. The distinct 615 West Lafayette premise and future mirror site are not this building. No capacity, facility identity, role or location changes are made." }, "source_read_scope": { "selected_section": "1050 Woodward Avenue", "separate_lafayette_component_not_transferred": true } }, "notes": [ "The current original provider page separately describes 1050 Woodward Avenue as One Campus Martius and offers purpose built colocation and Remote Hands. It describes scalable potential and available space, not explicit exact current computing occupancy or commissioned service in this bounded review. The distinct 615 West Lafayette premise and future mirror site are not this building. No capacity, facility identity, role or location changes are made.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://raeden.com/data-centers/detroit/", "host": "raeden.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Detroit · Wayne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "detroit-shoemaker-street-data-center-mi", "state": "mi", "kind": "facility", "name": "Shoemaker Street Data Center Proposal (11031 & 11081 Shoemaker St, Detroit east side)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Detroit", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.28249, "lng": -83.28262, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo." }, "notes": [ "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Detroit · Wayne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26163" } }, { "id": "solon-township-data-center-kent-mi", "state": "mi", "kind": "facility", "name": "Solon Township Data Center (16-17 Mile Road, US-131)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Kent" ], "city": "Solon Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Jurisdictional policy context, not site-specific permit rejection or cancellation.. ExtensionincorporatesalloriginalFebruary9orders/conditions;thatseparateoriginalnotreadhere,sodonotcertifyeveryexceptionortransition. GoalofnewordinanceeffectivebeforeFebruary9,2027isnotadoption. StateSenateBill1046-1051discussionisconditionalpendinglegislation,notproofenactedlaw. Latertermination,litigationorordinanceadoptionunreviewed.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.solontwp.org/wp-content/uploads/2026/07/26-10-Extend-Moratorium-on-Data-Centers.pdf", "host": "solontwp.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.99825, "lng": -85.54633, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "TheGander’s MarchURLdirectory explicitly updatedOctober 8 reports named Michiganproject stages:DeepGreenLansingAprilwithdrawal;Pavilionrezoningwithdrawal;Morleyunfiledconcept;HarborFarmzpropertymarketing;Lowellutilitytalksstalled;OaklandUniversityduediligence;Yorkwithdrawal;Solonpauseextension;Tonduunfiledconcept.", "independently_verified_current_operating_status": null, "site_stage_scope": "Reported pause extension, original dates/scope unexamined" }, "notes": [ "Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "government-primary-review-round37-2026-10-14.json", "scope": "Jurisdictional policy context, not site-specific permit rejection or cancellation.", "fields": { "jurisdictional_pause_extension_adopted": "2026-07-13", "extension_until_printed": "2027-02-09", "campus_specific_denial_verified": false }, "notes": [ "ExtensionincorporatesalloriginalFebruary9orders/conditions;thatseparateoriginalnotreadhere,sodonotcertifyeveryexceptionortransition. GoalofnewordinanceeffectivebeforeFebruary9,2027isnotadoption. StateSenateBill1046-1051discussionisconditionalpendinglegislation,notproofenactedlaw. Latertermination,litigationorordinanceadoptionunreviewed.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.solontwp.org/wp-content/uploads/2026/07/26-10-Extend-Moratorium-on-Data-Centers.pdf", "host": "solontwp.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 52", "scope": "The original signed July 13, 2026 Resolution 26 10 extends the Township application review moratorium and expressly states February 9, 2027 as its end, rather than an end calculated from a secondary report. It is Townshipwide administrative context, not the current physical stage or an exact project decision for the inherited unnamed campus. The resolution incorporates prior conditions whose full original text was not separately read here. No specific project closure, construction or computing operation is inferred.", "fields": { "current_stage_evidence": { "outcome": "township_extension_not_exact_project_physical_stage", "scope": "The original signed July 13, 2026 Resolution 26 10 extends the Township application review moratorium and expressly states February 9, 2027 as its end, rather than an end calculated from a secondary report. It is Townshipwide administrative context, not the current physical stage or an exact project decision for the inherited unnamed campus. The resolution incorporates prior conditions whose full original text was not separately read here. No specific project closure, construction or computing operation is inferred." }, "source_read_scope": { "resolution_visual_pages": [ 1, 2, 3, 4 ], "executed_extension_end_february9_not_secondary_february10": true, "prior_resolution_full_terms_not_separately_read": true, "no_site_timeline_event_from_general_rule": true } }, "notes": [ "The original signed July 13, 2026 Resolution 26 10 extends the Township application review moratorium and expressly states February 9, 2027 as its end, rather than an end calculated from a secondary report. It is Townshipwide administrative context, not the current physical stage or an exact project decision for the inherited unnamed campus. The resolution incorporates prior conditions whose full original text was not separately read here. No specific project closure, construction or computing operation is inferred.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.solontwp.org/wp-content/uploads/2026/07/26-10-Extend-Moratorium-on-Data-Centers.pdf", "host": "www.solontwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Solon Township · Kent · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26081" } }, { "id": "springfield-township-andersonville-road-data-center-mi", "state": "mi", "kind": "facility", "name": "Springfield Township Data Center Proposal (Andersonville Road & White Lake Road, 84 acres)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Springfield Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Springfield official change from DC inquiry to storage and offices. This is a changed property-owner direction after earlier DC inquiry, not an operating data center. Future storage/office proposal not automatically completed. Posted resident groundwater analysis explicitly not groundwater-flow model or prediction of harm. Linked moratorium title does not establish exact enacted expiry without underlying decision. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.springfield-twp.us/departments/supervisor/data_centers/latest_updates.php", "host": "springfield-twp.us", "date": "2026-08-27", "published": "2026-08-27", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 42.63294, "lng": -83.34263, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Springfield official change from DC inquiry to storage and offices", "fields": { "agency": "Springfield Township, Michigan", "update_date": "2026-08-27", "owner_meeting_date": "2026-08-26", "parcel": "07-36-401-012", "site_acres_approx": 84.49, "location": "Andersonville Road and White Lake Road", "agency_reported_current_direction": "owner pursuing high-end storage and office development; property not presently available for other development" }, "notes": [ "This is a changed property-owner direction after earlier DC inquiry, not an operating data center. Future storage/office proposal not automatically completed. Posted resident groundwater analysis explicitly not groundwater-flow model or prediction of harm. Linked moratorium title does not establish exact enacted expiry without underlying decision.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.springfield-twp.us/departments/supervisor/data_centers/latest_updates.php", "host": "springfield-twp.us", "date": "2026-08-27", "published": "2026-08-27", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Springfield Township · Oakland · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26125" } }, { "id": "stargate-saline-township-mi", "state": "mi", "kind": "facility", "name": "Stargate The Barn Campus", "group": "building", "status": "Under construction", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Washtenaw" ], "city": "Saline Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Michigan final storage-project approval, separate from DC IT. 1.383GWand332MWareENERGYSTORAGEpowernotSalineAIcriticalIToradditionalDCload.332isfirstsubsetoftotal1.383not1.715GW. Orderapprovesstorageandcontracts,notallDCconstructionorenergization. CustomerfundingundertheESAandno-rate-increasefindingforthisapprovalnotunlimitedfuturebillguarantee;costallocation/recoveryreservedforfutureappropriate ratecase. Storagecrediteligibilitycompanyclaimnotactualtaxcreditpaid. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://adms.apps.lara.state.mi.us/Mpsc/ViewCommissionOrderDocument/27397", "host": "adms.apps.lara.state.mi.us", "date": "2026-03-27", "published": "2026-03-27", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.walbridge.com/about/news-events/news-item/walbridge-is-building-the-largest-project-in-its-110-year-history-right-here-in-michigan/", "host": "www.walbridge.com", "published": "2026-05-05", "date": "2026-05-05", "checked": "2026-10-16", "label": "Reviewed current operator evidence" } ], "loc": { "lat": 42.22763, "lng": -83.83656, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Michigan final storage-project approval, separate from DC IT", "fields": { "regulator": "Michigan Public Service Commission", "case": "U-21990", "order_date": "2026-03-27", "action": "approvedColdCreek,FishCreek,PineRiverstorageprojectsandrelatedcontracts", "customer": "Green Chile Ventures LLC, Oracle subsidiary", "earlier_special_contract_approval_date": "2025-12-18", "dte_conditions_acceptance_date": "2026-01-15", "authorized_storage_resource_total_gw": 1.383, "storage_projects_this_order_mw": 332, "projects": [ { "name": "Cold Creek", "county": "Branch, Michigan", "storage_dispatchable_mw": 100 }, { "name": "Fish Creek", "county": "Montcalm, Michigan", "storage_dispatchable_mw": 132 }, { "name": "Pine River", "county": "Gratiot, Michigan", "storage_dispatchable_mw": 100 } ], "expected_storage_commercial_operation_no_later_than": "2027-Q2", "cost_allocation_recovery_method_approved_by_this_order": false }, "notes": [ "1.383GWand332MWareENERGYSTORAGEpowernotSalineAIcriticalIToradditionalDCload.332isfirstsubsetoftotal1.383not1.715GW. Orderapprovesstorageandcontracts,notallDCconstructionorenergization. CustomerfundingundertheESAandno-rate-increasefindingforthisapprovalnotunlimitedfuturebillguarantee;costallocation/recoveryreservedforfutureappropriate ratecase. Storagecrediteligibilitycompanyclaimnotactualtaxcreditpaid.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://adms.apps.lara.state.mi.us/Mpsc/ViewCommissionOrderDocument/27397", "host": "adms.apps.lara.state.mi.us", "date": "2026-03-27", "published": "2026-03-27", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "overnight-status-2026-10-16", "scope": "Named project and operator-service status review; phase and source limits retained.", "fields": { "current_stage_evidence": { "outcome": "supported_label", "label": "Under construction", "basis": "Walbridge’s May 5, 2026 release identifies itself as general contractor for Related Digital’s Saline Township campus for Oracle and OpenAI and reports substantial trade work already completed at the site.", "checked_on": "2026-10-16" }, "stage_review_limits": "This is the contractor’s direct report of physical work. It is separate from the MPSC storage approvals and does not establish completed data halls, operational capacity, a precise first-work date or an unconditional customer-bill guarantee." }, "notes": [ "This is the contractor’s direct report of physical work. It is separate from the MPSC storage approvals and does not establish completed data halls, operational capacity, a precise first-work date or an unconditional customer-bill guarantee.", "Current service and project labels are source-scoped research contexts. No entire record, physical site, technical quantity or exact parcel is certified." ], "sources": [ { "url": "https://www.walbridge.com/about/news-events/news-item/walbridge-is-building-the-largest-project-in-its-110-year-history-right-here-in-michigan/", "host": "www.walbridge.com", "published": "2026-05-05", "date": "2026-05-05", "checked": "2026-10-16", "label": "Reviewed current operator evidence" } ], "checked": "2026-10-16", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Saline Township · Washtenaw · Source context reviewed", "status_scope": "Primary source review checked 2026-10-16. Walbridge’s May 5, 2026 release identifies itself as general contractor for Related Digital’s Saline Township campus for Oracle and OpenAI and reports substantial trade work already completed at the site. This is the contractor’s direct report of physical work. It is separate from the MPSC storage approvals and does not establish completed data halls, operational capacity, a precise first-work date or an unconditional customer-bill guarantee.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26161" } }, { "id": "tondu-stronach-township-manistee-mi", "state": "mi", "kind": "facility", "name": "Stronach Township Data Center (Stronach Road)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Manistee" ], "city": "Stronach", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 44.33297, "lng": -86.05696, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "TheGander’s MarchURLdirectory explicitly updatedOctober 8 reports named Michiganproject stages:DeepGreenLansingAprilwithdrawal;Pavilionrezoningwithdrawal;Morleyunfiledconcept;HarborFarmzpropertymarketing;Lowellutilitytalksstalled;OaklandUniversityduediligence;Yorkwithdrawal;Solonpauseextension;Tonduunfiledconcept.", "independently_verified_current_operating_status": null, "site_stage_scope": "Exploratory unfiled concept and reported temporary pause" }, "notes": [ "Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Stronach · Manistee · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26101" } }, { "id": "switch-pyramid-campus-grand-rapids-mi", "state": "mi", "kind": "facility", "name": "Switch Pyramid Campus", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Kent" ], "city": "Gaines Township", "address": "", "who": "Switch", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Publicationdate from article:published_time, not2024modifieddate. Firstphaseopen does not energize full320MWdesign. Power basis not explicitlyIT. Later2017grandopeningceremony is not first operatingdate. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. 2017proposal does not establish current tariff approval, measured renewable supply or campusMW.1.8Marea describes planned campus, not completed firstphase.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.switch.com/switch-grand-rapids-now-open-largest-advanced-data-center-campus-eastern-u-s/", "host": "switch.com", "date": "2017-03-09", "published": "2017-03-09", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.switch.com/switch-leads-consumers-energys-program-bring-100-renewable-energy-michigan-businesses/", "host": "switch.com", "date": "2017-05-15", "published": "2017-05-15", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.switch.com/grand-rapids/", "host": "www.switch.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact campus text, scoped provider relationship reviewed" }, { "url": "https://www.switch.com/schneider-electric-and-switch-expand-partnership-with-1-9-billion-supply-capacity-agreement-to-power-ai-factories/", "host": "www.switch.com", "published": "2025-11-19", "date": "2025-11-19", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 43.06521, "lng": -85.52395, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "remaining-operators-review-round5-2026-10-14.json", "scope": "named operator source", "fields": { "first_phase_opening_announcement_date": "2017-03-09", "full_campus_design_area_sqft_max": 1800000, "full_campus_design_power_mw_max": 320, "first_phase_design_area_sqft_min_exclusive": 225000, "subsequent_grand_rapids1_planned_area_sqft": 471248 }, "notes": [ "Publicationdate from article:published_time, not2024modifieddate. Firstphaseopen does not energize full320MWdesign. Power basis not explicitlyIT. Later2017grandopeningceremony is not first operatingdate.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.switch.com/switch-grand-rapids-now-open-largest-advanced-data-center-campus-eastern-u-s/", "host": "switch.com", "date": "2017-03-09", "published": "2017-03-09", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "remaining-operators-review-round5-2026-10-14.json", "scope": "named operator source", "fields": { "operator_reported_opening_month": "2017-03", "historical_renewable_program_stage": "proposed to Michigan PSC" }, "notes": [ "2017proposal does not establish current tariff approval, measured renewable supply or campusMW.1.8Marea describes planned campus, not completed firstphase.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.switch.com/switch-leads-consumers-energys-program-bring-100-renewable-energy-michigan-businesses/", "host": "switch.com", "date": "2017-05-15", "published": "2017-05-15", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Company role source check 14, October 23, 2026", "scope": "Switch explicitly names this campus in its current location portfolio. Operator is the attributed provider brand relationship, not independent legal ownership, a commissioning finding or completion of every campus phase. Future power, sustainability, certification, reliability and tax marketing claims are not adopted. No status, point, address, physical date, resource value or environmental outcome is promoted. The current page explicitly names Pyramid. The older first phase opening story is not used as a current whole campus operating or completion finding.", "fields": { "company_association": { "name": "Switch", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Switch explicitly names this campus in its current location portfolio. Operator is the attributed provider brand relationship, not independent legal ownership, a commissioning finding or completion of every campus phase. Future power, sustainability, certification, reliability and tax marketing claims are not adopted. No status, point, address, physical date, resource value or environmental outcome is promoted. The current page explicitly names Pyramid. The older first phase opening story is not used as a current whole campus operating or completion finding." }, "provider_role": "operator" }, "notes": [ "Switch explicitly names this campus in its current location portfolio. Operator is the attributed provider brand relationship, not independent legal ownership, a commissioning finding or completion of every campus phase. Future power, sustainability, certification, reliability and tax marketing claims are not adopted. No status, point, address, physical date, resource value or environmental outcome is promoted. The current page explicitly names Pyramid. The older first phase opening story is not used as a current whole campus operating or completion finding.", "Source publication and retrieval dates remain separate from physical milestones." ], "sources": [ { "url": "https://www.switch.com/grand-rapids/", "host": "www.switch.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact campus text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 52", "scope": "The current original provider page offers Grand Rapids Pyramid Campus colocation and connectivity, while the November 19, 2025 provider release explicitly includes Grand Rapids among its operating campuses. The original opening account concerns the first adaptive reuse phase of the Pyramid, with surrounding campus buildings still planned. Reported campus service does not make all planned phases operating, establish current load or certify an exact opening day. The selected opening body has no exact day independently verified in this bounded review, so no opening event is invented.", "fields": { "current_stage_evidence": { "outcome": "current_named_campus_service", "scope": "The current original provider page offers Grand Rapids Pyramid Campus colocation and connectivity, while the November 19, 2025 provider release explicitly includes Grand Rapids among its operating campuses. The original opening account concerns the first adaptive reuse phase of the Pyramid, with surrounding campus buildings still planned. Reported campus service does not make all planned phases operating, establish current load or certify an exact opening day. The selected opening body has no exact day independently verified in this bounded review, so no opening event is invented." }, "source_read_scope": { "selected_sections": [ "Current Grand Rapids campus account", "November 2025 release operating campus paragraph", "Historical first phase opening and later planned buildings" ], "all_future_phases_not_operating": true, "technical_quantities_not_exported": true } }, "notes": [ "The current original provider page offers Grand Rapids Pyramid Campus colocation and connectivity, while the November 19, 2025 provider release explicitly includes Grand Rapids among its operating campuses. The original opening account concerns the first adaptive reuse phase of the Pyramid, with surrounding campus buildings still planned. Reported campus service does not make all planned phases operating, establish current load or certify an exact opening day. The selected opening body has no exact day independently verified in this bounded review, so no opening event is invented.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.switch.com/grand-rapids/", "host": "www.switch.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.switch.com/schneider-electric-and-switch-expand-partnership-with-1-9-billion-supply-capacity-agreement-to-power-ai-factories/", "host": "www.switch.com", "published": "2025-11-19", "date": "2025-11-19", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.switch.com/switch-grand-rapids-now-open-largest-advanced-data-center-campus-eastern-u-s/", "host": "www.switch.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Gaines Township · Kent · Source context reviewed", "status_scope": "The current original provider page offers Grand Rapids Pyramid Campus colocation and connectivity, while the November 19, 2025 provider release explicitly includes Grand Rapids among its operating campuses. The original opening account concerns the first adaptive reuse phase of the Pyramid, with surrounding campus buildings still planned. Reported campus service does not make all planned phases operating, establish current load or certify an exact opening day. The selected opening body has no exact day independently verified in this bounded review, so no opening event is invented.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26081" } }, { "id": "thor-equities-augusta-township-mi", "state": "mi", "kind": "facility", "name": "Thor Equities Augusta Township Data Center (Form8tion)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Washtenaw" ], "city": "Augusta Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Operator or original local-reporting context; source dates and proposal stages retained.. Planet Detroit August29,2025 explicitly connects Thor Equities to a522acre Augusta Township proposal near Milan, with a reported July22 board rezoning. Organizers submitted957signatures;561valid were needed. Submission is not signature validation, a referendum result or a ban. Possible May/August2026 ballot dates in this2025 article are not observed election outcomes. Billion-dollar investment and future tax benefits remain projections. Adjacent solar, FBI range and Ypsilanti projects are separate; no generic hyperscaler reference is a tenant commitment. Not whole-record or current operating-census certification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://planetdetroit.org/2025/08/augusta-data-center-petition/", "host": "planetdetroit.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.27823, "lng": -83.81965, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-and-original-local-reporting-round57-2026-10-15.json", "scope": "Operator or original local-reporting context; source dates and proposal stages retained.", "fields": {}, "notes": [ "Planet Detroit August29,2025 explicitly connects Thor Equities to a522acre Augusta Township proposal near Milan, with a reported July22 board rezoning. Organizers submitted957signatures;561valid were needed. Submission is not signature validation, a referendum result or a ban. Possible May/August2026 ballot dates in this2025 article are not observed election outcomes. Billion-dollar investment and future tax benefits remain projections. Adjacent solar, FBI range and Ypsilanti projects are separate; no generic hyperscaler reference is a tenant commitment.", "Not whole-record or current operating-census certification." ], "sources": [ { "url": "https://planetdetroit.org/2025/08/augusta-data-center-petition/", "host": "planetdetroit.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Augusta Township · Washtenaw · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26161" } }, { "id": "umich-lanl-research-computing-ypsilanti-township-mi", "state": "mi", "kind": "facility", "name": "U-M / Los Alamos Research Computing Center", "group": "proposed", "status": "Listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Washtenaw" ], "city": "Ypsilanti", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named government source. One proposed facility with two computing centers not automatically two physical buildings.15Mfiveyearresearchcontract is existing collaboration funding, not facility construction budget. Lab NewMexico footer not Michigan site address; specificYpsilantiTownship location not established in this release. No completion, MW or exact site. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2024-12-06", "Los Alamos National Laboratory published its Michigan partnership announcement on December 6, 2024, describing a planned research computing development. This dates publication of the plan, not an executed building approval, physical start or current computing operation." ], [ "2026-03-31", "The certified Township Resolution 2026 05 records approval at the March 31, 2026 Special Meeting and formal opposition to siting the proposed Los Alamos facility. Its security and environmental justice allegations are attributed Board positions, not an independent threat classification, a court finding, permit denial or physical closure." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.lanl.gov/media/news/1206-university-of-michigan-collaboration", "host": "lanl.gov", "date": "2024-12-06", "published": "2024-12-06", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://files.ypsitownship.org/government/boards___commissions/board_of_trustees/data_center_information.php", "host": "files.ypsitownship.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://files.ypsitownship.org/Documents/Departments/Clerks-Office/Ordinances-Resolutions/2026/2026-Resolutions/Resolution-No.-2026-05-Data-Center-High-Value-Target-Risk.pdf?t=202606301548230", "host": "files.ypsitownship.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://files.ypsitownship.org/Documents/Departments/Clerks-Office/Ordinances-Resolutions/2026/2026-Resolutions/Resolution-No.-2026-08-Data-Center-YCUA-Moratorium.pdf?t=202604161122310&t=202604161122310", "host": "files.ypsitownship.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 42.24691, "lng": -83.87461, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "named government source", "fields": { "partnership_facility_announcement_date": "2024-12-06", "proposed_facility_county": "Washtenaw,Michigan", "proposed_computing_centers": 2, "facility_funding_status_as_of_release": "not finalized" }, "notes": [ "One proposed facility with two computing centers not automatically two physical buildings.15Mfiveyearresearchcontract is existing collaboration funding, not facility construction budget. Lab NewMexico footer not Michigan site address; specificYpsilantiTownship location not established in this release. No completion, MW or exact site.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.lanl.gov/media/news/1206-university-of-michigan-collaboration", "host": "lanl.gov", "date": "2024-12-06", "published": "2024-12-06", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 52", "scope": "The current original Township project account identifies the University of Michigan and Los Alamos planned research computing center at Bridge and Textile Roads and announces a later panel about that proposal. LANL original December 6, 2024 account describes a planned pair of computing centers. This supports a current listed proposal only. Township formal opposition and its separate request for a utility service pause do not establish final project denial, an enacted YCUA pause, physical closure or commissioned computing. The selected University FAQ returned HTTP 403 and was not used as evidence. No alternate identity or access route was used for that denied page.", "fields": { "current_stage_evidence": { "outcome": "current_original_named_research_proposal", "scope": "The current original Township project account identifies the University of Michigan and Los Alamos planned research computing center at Bridge and Textile Roads and announces a later panel about that proposal. LANL original December 6, 2024 account describes a planned pair of computing centers. This supports a current listed proposal only. Township formal opposition and its separate request for a utility service pause do not establish final project denial, an enacted YCUA pause, physical closure or commissioned computing. The selected University FAQ returned HTTP 403 and was not used as evidence. No alternate identity or access route was used for that denied page." }, "source_read_scope": { "township_current_project_and_new_panel_sections_read": true, "opposition_resolution_text_pages": [ 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 ], "opposition_certification_visual_pages": [ 10 ], "utility_request_selected_text_pages": [ 1, 2, 3, 4, 5, 6, 7, 8, 9 ], "utility_request_certification_visual_pages": [ 9 ], "future_panel_not_accomplished": true, "university_403_body_not_adopted": true } }, "notes": [ "The current original Township project account identifies the University of Michigan and Los Alamos planned research computing center at Bridge and Textile Roads and announces a later panel about that proposal. LANL original December 6, 2024 account describes a planned pair of computing centers. This supports a current listed proposal only. Township formal opposition and its separate request for a utility service pause do not establish final project denial, an enacted YCUA pause, physical closure or commissioned computing. The selected University FAQ returned HTTP 403 and was not used as evidence. No alternate identity or access route was used for that denied page.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://files.ypsitownship.org/government/boards___commissions/board_of_trustees/data_center_information.php", "host": "files.ypsitownship.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.lanl.gov/media/news/1206-university-of-michigan-collaboration", "host": "www.lanl.gov", "published": "2024-12-06", "date": "2024-12-06", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://files.ypsitownship.org/Documents/Departments/Clerks-Office/Ordinances-Resolutions/2026/2026-Resolutions/Resolution-No.-2026-05-Data-Center-High-Value-Target-Risk.pdf?t=202606301548230", "host": "files.ypsitownship.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://files.ypsitownship.org/Documents/Departments/Clerks-Office/Ordinances-Resolutions/2026/2026-Resolutions/Resolution-No.-2026-08-Data-Center-YCUA-Moratorium.pdf?t=202604161122310&t=202604161122310", "host": "files.ypsitownship.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Ypsilanti · Washtenaw · Source context reviewed", "status_scope": "The current original Township project account identifies the University of Michigan and Los Alamos planned research computing center at Bridge and Textile Roads and announces a later panel about that proposal. LANL original December 6, 2024 account describes a planned pair of computing centers. This supports a current listed proposal only. Township formal opposition and its separate request for a utility service pause do not establish final project denial, an enacted YCUA pause, physical closure or commissioned computing. The selected University FAQ returned HTTP 403 and was not used as evidence. No alternate identity or access route was used for that denied page.", "event_evidence": [ { "date": "2024-12-06", "text": "Los Alamos National Laboratory published its Michigan partnership announcement on December 6, 2024, describing a planned research computing development. This dates publication of the plan, not an executed building approval, physical start or current computing operation.", "kind": "announced", "sources": [ { "url": "https://www.lanl.gov/media/news/1206-university-of-michigan-collaboration", "host": "www.lanl.gov", "published": "2024-12-06", "date": "2024-12-06", "checked": "2026-10-23", "label": "Reviewed government record" } ] }, { "date": "2026-03-31", "text": "The certified Township Resolution 2026 05 records approval at the March 31, 2026 Special Meeting and formal opposition to siting the proposed Los Alamos facility. Its security and environmental justice allegations are attributed Board positions, not an independent threat classification, a court finding, permit denial or physical closure.", "kind": "announced", "sources": [ { "url": "https://files.ypsitownship.org/Documents/Departments/Clerks-Office/Ordinances-Resolutions/2026/2026-Resolutions/Resolution-No.-2026-05-Data-Center-High-Value-Target-Risk.pdf?t=202606301548230", "host": "files.ypsitownship.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26161" } }, { "id": "us-signal-mi01-kentwood-mi", "state": "mi", "kind": "facility", "name": "US Signal MI01 Grand Rapids Data Center", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Kent" ], "city": "Kentwood", "address": "", "who": "US Signal", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. operator location index only. Network hub supplies no exact addresses or facility MW for the three bound records. 17 is operator network count, not three building capacities or independently reconciled census. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ussignal.com/data-centers", "host": "ussignal.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://ussignal.com/data-centers/mi01-grand-rapids/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=4765+Barden+Court%2C+Kentwood%2C+MI+49512&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "loc": { "lat": 42.876905936752, "lng": -85.563699179621, "precision": "address", "basis": "Published US Signal facility address 4765 Barden Court, Kentwood, MI 49512 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "operator location index only", "fields": { "named_locations": [ "MI01 Grand Rapids", "MN01 Minneapolis", "WI02 Madison" ], "operator_network_data_center_count": 17 }, "notes": [ "Network hub supplies no exact addresses or facility MW for the three bound records. 17 is operator network count, not three building capacities or independently reconciled census.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://ussignal.com/data-centers", "host": "ussignal.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "US Signal describes MI01 as its flagship Grand Rapids-market facility with a local operating history. The market name does not independently establish the legal municipality or a new parcel. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "US Signal describes MI01 as its flagship Grand Rapids-market facility with a local operating history. The market name does not independently establish the legal municipality or a new parcel. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "US Signal describes MI01 as its flagship Grand Rapids-market facility with a local operating history. The market name does not independently establish the legal municipality or a new parcel." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi01-grand-rapids/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 8, October 22, 2026", "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 42.876905936752, "lng": -85.563699179621, "precision": "address", "basis": "Published US Signal facility address 4765 Barden Court, Kentwood, MI 49512 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "4765 Barden Court, Kentwood, MI 49512", "county_fips": [ "26081" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named official facility source publishes this service address. Corporate headquarters, related locations and maps are excluded. The blank native address wrapper remains exact, with the facility address retained only in reviewed location evidence.", "The unique Census street match and retained county boundary agree with the existing county. A calculated street reference does not establish a roof, floor, suite, full campus boundary, parcel, title or independent physical building. Status, dates, capacity and jurisdiction remain exact." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi01-grand-rapids/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named facility street address block" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=4765+Barden+Court%2C+Kentwood%2C+MI+49512&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 27, October 23, 2026", "scope": "US Signal identifies the retained MI01 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts.", "fields": { "company_association": { "name": "US Signal", "role": "operator", "identity_scope": "provider_brand_only", "scope": "US Signal identifies the retained MI01 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts." }, "provider_role": "operator" }, "notes": [ "US Signal identifies the retained MI01 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi01-grand-rapids/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Current named MI01 provider relationship" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Kentwood · Kent · Source context reviewed", "status_scope": "US Signal describes MI01 as its flagship Grand Rapids-market facility with a local operating history. The market name does not independently establish the legal municipality or a new parcel. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "us-signal-mi02-byron-center-mi", "state": "mi", "kind": "facility", "name": "US Signal MI02 Grand Rapids Data Center", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Kent" ], "city": "Byron Center", "address": "", "who": "US Signal", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening. Same published street address as 123NET DC4; co-location, ownership change or duplicate requires reconciliation before physical-building count. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ussignal.com/data-centers/mi02-grand-rapids/", "host": "ussignal.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=400+76th+Street+SW%2C+Byron+Center%2C+MI+49315&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "loc": { "lat": 42.826205564178, "lng": -85.672684300757, "precision": "address", "basis": "Published US Signal facility address 400 76th Street SW, Byron Center, MI 49315 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "operator_site_code": "MI02", "published_address": "400 76th Street SW, Byron Center, MI49315", "generator_kw": 450, "ups_kw": 250, "utility_kva": 1500, "operator_reported_year_built": null }, "notes": [ "Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening.", "Same published street address as 123NET DC4; co-location, ownership change or duplicate requires reconciliation before physical-building count.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi02-grand-rapids/", "host": "ussignal.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "US Signal describes MI02 in Byron Center as a current in-market disaster-recovery counterpart to MI01. These remain separate existing research records. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "US Signal describes MI02 in Byron Center as a current in-market disaster-recovery counterpart to MI01. These remain separate existing research records. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "US Signal describes MI02 in Byron Center as a current in-market disaster-recovery counterpart to MI01. These remain separate existing research records." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi02-grand-rapids/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 8, October 22, 2026", "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 42.826205564178, "lng": -85.672684300757, "precision": "address", "basis": "Published US Signal facility address 400 76th Street SW, Byron Center, MI 49315 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "400 76th Street SW, Byron Center, MI 49315", "county_fips": [ "26081" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named official facility source publishes this service address. Corporate headquarters, related locations and maps are excluded. The blank native address wrapper remains exact, with the facility address retained only in reviewed location evidence.", "The unique Census street match and retained county boundary agree with the existing county. A calculated street reference does not establish a roof, floor, suite, full campus boundary, parcel, title or independent physical building. Status, dates, capacity and jurisdiction remain exact." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi02-grand-rapids/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named facility street address block" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=400+76th+Street+SW%2C+Byron+Center%2C+MI+49315&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 27, October 23, 2026", "scope": "US Signal identifies the retained MI02 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts.", "fields": { "company_association": { "name": "US Signal", "role": "operator", "identity_scope": "provider_brand_only", "scope": "US Signal identifies the retained MI02 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts." }, "provider_role": "operator" }, "notes": [ "US Signal identifies the retained MI02 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi02-grand-rapids/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Current named MI02 provider relationship" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Byron Center · Kent · Source context reviewed", "status_scope": "US Signal describes MI02 in Byron Center as a current in-market disaster-recovery counterpart to MI01. These remain separate existing research records. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "us-signal-mi03-van-buren-township-mi", "state": "mi", "kind": "facility", "name": "US Signal MI03 Detroit Data Center", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wayne" ], "city": "Belleville", "address": "", "who": "US Signal", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening. Belleville postal city does not independently resolve Van Buren Township municipal/parcel boundary. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ussignal.com/data-centers/mi03-detroit/", "host": "ussignal.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=9275+Haggerty+Road%2C+Belleville%2C+MI+48111&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "loc": { "lat": 42.235623390647, "lng": -83.445062189884, "precision": "address", "basis": "Published US Signal facility address 9275 Haggerty Road, Belleville, MI 48111 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "operator_site_code": "MI03", "published_address": "9275 Haggerty Road, Belleville, MI48111", "generator_kw": 2000, "ups_kw": 1500, "utility_kva": 2500, "operator_reported_year_built": 2020 }, "notes": [ "Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening.", "Belleville postal city does not independently resolve Van Buren Township municipal/parcel boundary.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi03-detroit/", "host": "ussignal.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "US Signal describes MI03 as a recently expanded customer facility supporting AI and edge workloads. Expansion and power quantities are not adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "US Signal describes MI03 as a recently expanded customer facility supporting AI and edge workloads. Expansion and power quantities are not adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "US Signal describes MI03 as a recently expanded customer facility supporting AI and edge workloads. Expansion and power quantities are not adopted." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi03-detroit/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 8, October 22, 2026", "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 42.235623390647, "lng": -83.445062189884, "precision": "address", "basis": "Published US Signal facility address 9275 Haggerty Road, Belleville, MI 48111 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "9275 Haggerty Road, Belleville, MI 48111", "county_fips": [ "26163" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named official facility source publishes this service address. Corporate headquarters, related locations and maps are excluded. The blank native address wrapper remains exact, with the facility address retained only in reviewed location evidence.", "The unique Census street match and retained county boundary agree with the existing county. A calculated street reference does not establish a roof, floor, suite, full campus boundary, parcel, title or independent physical building. Status, dates, capacity and jurisdiction remain exact." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi03-detroit/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named facility street address block" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=9275+Haggerty+Road%2C+Belleville%2C+MI+48111&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 27, October 23, 2026", "scope": "US Signal identifies the retained MI03 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts.", "fields": { "company_association": { "name": "US Signal", "role": "operator", "identity_scope": "provider_brand_only", "scope": "US Signal identifies the retained MI03 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts." }, "provider_role": "operator" }, "notes": [ "US Signal identifies the retained MI03 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi03-detroit/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Current named MI03 provider relationship" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Belleville · Wayne · Source context reviewed", "status_scope": "US Signal describes MI03 as a recently expanded customer facility supporting AI and edge workloads. Expansion and power quantities are not adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "us-signal-mi04-southfield-mi", "state": "mi", "kind": "facility", "name": "US Signal MI04 Detroit Data Center", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Southfield", "address": "", "who": "US Signal", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ussignal.com/data-centers/mi04-detroit/", "host": "ussignal.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=21648+Melrose+Avenue%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "loc": { "lat": 42.447358816771, "lng": -83.256306955815, "precision": "address", "basis": "Published US Signal facility address 21648 Melrose Avenue, Southfield, MI 48075 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "operator_site_code": "MI04", "published_address": "21648 Melrose Avenue, Southfield, MI48075", "generator_kw": 800, "ups_kw": 250, "utility_kva": 1500, "operator_reported_year_built": 1972 }, "notes": [ "Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi04-detroit/", "host": "ussignal.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "US Signal lists MI04 in Southfield as a current second-site offering for customer infrastructure in the Detroit market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "US Signal lists MI04 in Southfield as a current second-site offering for customer infrastructure in the Detroit market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "US Signal lists MI04 in Southfield as a current second-site offering for customer infrastructure in the Detroit market." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi04-detroit/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 8, October 22, 2026", "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 42.447358816771, "lng": -83.256306955815, "precision": "address", "basis": "Published US Signal facility address 21648 Melrose Avenue, Southfield, MI 48075 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "21648 Melrose Avenue, Southfield, MI 48075", "county_fips": [ "26125" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named official facility source publishes this service address. Corporate headquarters, related locations and maps are excluded. The blank native address wrapper remains exact, with the facility address retained only in reviewed location evidence.", "The unique Census street match and retained county boundary agree with the existing county. A calculated street reference does not establish a roof, floor, suite, full campus boundary, parcel, title or independent physical building. Status, dates, capacity and jurisdiction remain exact." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi04-detroit/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named facility street address block" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=21648+Melrose+Avenue%2C+Southfield%2C+MI+48075&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 27, October 23, 2026", "scope": "US Signal identifies the retained MI04 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts.", "fields": { "company_association": { "name": "US Signal", "role": "operator", "identity_scope": "provider_brand_only", "scope": "US Signal identifies the retained MI04 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts." }, "provider_role": "operator" }, "notes": [ "US Signal identifies the retained MI04 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi04-detroit/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Current named MI04 provider relationship" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Southfield · Oakland · Source context reviewed", "status_scope": "US Signal lists MI04 in Southfield as a current second-site offering for customer infrastructure in the Detroit market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "us-signal-mi05-auburn-hills-mi", "state": "mi", "kind": "facility", "name": "US Signal MI05 Detroit Data Center", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Auburn Hills", "address": "", "who": "US Signal", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ussignal.com/data-centers/mi05-detroit/", "host": "ussignal.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1035+W+Entrance+Drive%2C+Auburn+Hills%2C+MI+48326&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "loc": { "lat": 42.652878188853, "lng": -83.214963570537, "precision": "address", "basis": "Published US Signal facility address 1035 W Entrance Drive, Auburn Hills, MI 48326 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "operator_site_code": "MI05", "published_address": "1035 W Entrance Drive, Auburn Hills, MI48326", "generator_kw": 6000, "ups_kw": 4000, "utility_kva": 4000, "operator_reported_year_built": null }, "notes": [ "Headline zero counters not usable area or IT capacity. Generator/UPS and utility kVA retained separately; redundancy does not multiply usable IT MW. Year built not exact data-center opening.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi05-detroit/", "host": "ussignal.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "US Signal lists its purpose-built MI05 facility in Auburn Hills for current and future high-density customer deployments. Future scaling is not certified as energized capacity. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "US Signal lists its purpose-built MI05 facility in Auburn Hills for current and future high-density customer deployments. Future scaling is not certified as energized capacity. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "US Signal lists its purpose-built MI05 facility in Auburn Hills for current and future high-density customer deployments. Future scaling is not certified as energized capacity." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi05-detroit/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 8, October 22, 2026", "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 42.652878188853, "lng": -83.214963570537, "precision": "address", "basis": "Published US Signal facility address 1035 W Entrance Drive, Auburn Hills, MI 48326 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "1035 W Entrance Drive, Auburn Hills, MI 48326", "county_fips": [ "26125" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named official facility source publishes this service address. Corporate headquarters, related locations and maps are excluded. The blank native address wrapper remains exact, with the facility address retained only in reviewed location evidence.", "The unique Census street match and retained county boundary agree with the existing county. A calculated street reference does not establish a roof, floor, suite, full campus boundary, parcel, title or independent physical building. Status, dates, capacity and jurisdiction remain exact." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi05-detroit/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named facility street address block" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1035+W+Entrance+Drive%2C+Auburn+Hills%2C+MI+48326&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 27, October 23, 2026", "scope": "US Signal identifies the retained MI05 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts.", "fields": { "company_association": { "name": "US Signal", "role": "operator", "identity_scope": "provider_brand_only", "scope": "US Signal identifies the retained MI05 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts." }, "provider_role": "operator" }, "notes": [ "US Signal identifies the retained MI05 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts." ], "sources": [ { "url": "https://ussignal.com/data-centers/mi05-detroit/", "host": "ussignal.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Current named MI05 provider relationship" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Auburn Hills · Oakland · Source context reviewed", "status_scope": "US Signal lists its purpose-built MI05 facility in Auburn Hills for current and future high-density customer deployments. Future scaling is not certified as energized capacity. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "prologis-washington-township-mi", "state": "mi", "kind": "facility", "name": "Washington Township Technical Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Macomb" ], "city": "Washington", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 42.7092, "lng": -82.94684, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo." }, "notes": [ "GanderdirectorybodyupdatedOct8,2026,relevantselectedprojectpassagesonlyread. Shoemakerproposalreporteddropped;FlintHillwood-Sterling200acUNDERCONTRACTnotclosed,MetaTexaspastprojectnotFlinttenant. SouthfieldMetrobloks1.5B100MW218ksf13acsiteplanapprovedbutfinancing/additionalpermitsincomplete. AllenParkSolstice26MW45ksfPCrejectedJune,appealpossible. PrologisWashingtonTownship312acwithdrewMay,sixmonthmoranotpermanentban. GibraltarRaeden100MWformerMcLouthpaused,waiverpossible,lawsuitallegationsnotcourtfindings. Poll/electionheadlinesnotreadasadoptedlaw. HowellMeta-linked1077acproposaldoesnotidentifyStantec/Randee;Telkite/Aeris/KISawyernotfound,noexactIDcreditforthosetwo.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Washington · Macomb · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26099" } }, { "id": "sansone-wixom-road-mi", "state": "mi", "kind": "facility", "name": "Wixom Road Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Oakland" ], "city": "Wixom", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.. Developer Sansone is not named in readable roundup and exact parcel crosswalk remains unconfirmed. Denial concerns a moratorium exemption, not necessarily final land-use denial. Reported pause through end of August does not establish October status. Lansing 182-day pause, Saline 12-year 50% property-tax action and $43 billion valuation concern separate jurisdictions/projects; statewide historical $13 million tax breaks are not an award to this Wixom proposal. Governor plan and voluntary commitments are not enacted legislation. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://civicmedia.us/news/2026/07/20/michigan-data-centers-the-weekly-download-2", "host": "civicmedia.us", "date": "2026-07-20", "published": "2026-07-20", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 42.65242, "lng": -83.43082, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round32-2026-10-14.json", "scope": "Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.", "fields": { "reported_context": "Michigan Advance’s weekly roundup republished by Civic Media reports Wixom unanimously denied a requested waiver for a proposed 54-acre Wixom Road data center site.", "independently_verified_current_operating_status": null, "operator_or_exact_site_identity_needs_crosswalk": true }, "notes": [ "Developer Sansone is not named in readable roundup and exact parcel crosswalk remains unconfirmed. Denial concerns a moratorium exemption, not necessarily final land-use denial. Reported pause through end of August does not establish October status. Lansing 182-day pause, Saline 12-year 50% property-tax action and $43 billion valuation concern separate jurisdictions/projects; statewide historical $13 million tax breaks are not an award to this Wixom proposal. Governor plan and voluntary commitments are not enacted legislation.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://civicmedia.us/news/2026/07/20/michigan-data-centers-the-weekly-download-2", "host": "civicmedia.us", "date": "2026-07-20", "published": "2026-07-20", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Wixom · Oakland · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26125" } }, { "id": "sansone-york-township-washtenaw-mi", "state": "mi", "kind": "facility", "name": "York Township Data Center (Platt Road / former Toyota land)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Washtenaw" ], "city": "York Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 42.26552, "lng": -83.85221, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "TheGander’s MarchURLdirectory explicitly updatedOctober 8 reports named Michiganproject stages:DeepGreenLansingAprilwithdrawal;Pavilionrezoningwithdrawal;Morleyunfiledconcept;HarborFarmzpropertymarketing;Lowellutilitytalksstalled;OaklandUniversityduediligence;Yorkwithdrawal;Solonpauseextension;Tonduunfiledconcept.", "independently_verified_current_operating_status": null, "site_stage_scope": "Reported land-acquisition effort withdrawn after deed-restriction issue" }, "notes": [ "Update date is not everyprojectevent. Oakland 26 MWisplannedundefinedbasisandtrusteesauthorizedduediligence,notfinalconstruction. HarborFarmz 4 acresforsaleaspossibleDCisnotanannounced/permittedcampus. GenHhydroconceptisnotgenerationlicense/IT. Lowellpausedmunicipalnegotiations is not MSwithdrawal or siteclosure. Deedrestrictionclaims, moratoriumdates/exceptions andcourtoutcomesneedoriginalrecords. UP 1000 acreportdoesnotnameTelkite/KSawyer,address,operatororfiledapplication,so noexactTelkitecredit. OthercampusMW/taxes/poll 70 percent/oppositionclaimsmustnotbeassignedacrossthis 10-IDgroup. NoOctober 14 futurevoteorNovemberrecalloutcomeassumed.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gandernewsroom.com/2026/03/02/how-many-ai-data-centers-are-planned-in-michigan-we-counted/", "host": "gandernewsroom.com", "date": "2026-10-08", "published": "2026-10-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "York Township · Washtenaw · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "26161" } } ], "compilation_license": "withheld_pending_owner_decision" }