{
  "schema_version": 1,
  "source_compilation_context": {
    "mn": {
      "attribution": {
        "inventory": {
          "name": "Compute Atlas",
          "creator": "Edward Kubiak",
          "url": "https://www.compute-atlas.com/api",
          "license": "CC BY 4.0",
          "license_url": "https://creativecommons.org/licenses/by/4.0/",
          "snapshot_url": "https://www.compute-atlas.com/api/facilities",
          "retrieved": "2026-10-14",
          "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37",
          "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally."
        },
        "counties": "U.S. Census Bureau county boundaries (public domain)",
        "research": "Field-specific source context. See the linked source and limits on each record."
      },
      "source_data_url": "https://datacentersatlas.com/data/mn.json",
      "updated": "2026-10-24"
    }
  },
  "scope": "Source compiled state collection. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.",
  "collection": {
    "kind": "states",
    "key": "mn",
    "label": "Minnesota"
  },
  "records": [
    {
      "id": "aaim-data-centers-blue-earth-mn",
      "state": "mn",
      "kind": "facility",
      "name": "AAIM Data Centers  -  Blue Earth (Minnesota 1)",
      "group": "operating",
      "status": "Reported service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "Faribault"
      ],
      "city": "Blue Earth",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Operatorstatusclaim, notindependentmeter.80MWdesigniswithin95MWfuturetotal; no175MWsum.15MWdoesnotproveallAIuse. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.aaimdc.com/data-centers/minnesota/",
          "host": "aaimdc.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.aaimdc.com/data-centers/minnesota-1/",
          "host": "www.aaimdc.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 43.67391,
        "lng": -93.94792,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "operator_reported_online_power_mw": 15,
            "power_basis": "online power, not explicitlycriticalIT",
            "in_service_month": "2025-06",
            "planned_expansion_power_mw": 80,
            "full_build_target_mw": 95,
            "expansion_target": "2027-Q3",
            "facility_area_sqft_approx": 10000,
            "published_city": "Blue Earth, Minnesota"
          },
          "notes": [
            "Operatorstatusclaim, notindependentmeter.80MWdesigniswithin95MWfuturetotal; no175MWsum.15MWdoesnotproveallAIuse.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.aaimdc.com/data-centers/minnesota/",
              "host": "aaimdc.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The current original AAIM Minnesota 1 page explicitly names Blue Earth and says the existing facility operates as a colocation site, with clients supplying hardware and the company managing infrastructure and connectivity. This supports reported service at the existing named facility. Its separate expansion is explicitly in design and targeted for a future quarter. The June 2025 in service month does not establish an exact physical opening day. No current load, future capacity, Tier certification, workload allocation or provider role is newly certified.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "original_named_current_colocation_service",
              "scope": "The current original AAIM Minnesota 1 page explicitly names Blue Earth and says the existing facility operates as a colocation site, with clients supplying hardware and the company managing infrastructure and connectivity. This supports reported service at the existing named facility. Its separate expansion is explicitly in design and targeted for a future quarter. The June 2025 in service month does not establish an exact physical opening day. No current load, future capacity, Tier certification, workload allocation or provider role is newly certified."
            },
            "source_read_scope": {
              "current_named_city_and_operates_as_colocation_body_read": true,
              "design_expansion_not_operating_capacity": true,
              "service_month_not_invented_exact_day": true,
              "no_quantity_or_role_export": true
            }
          },
          "notes": [
            "The current original AAIM Minnesota 1 page explicitly names Blue Earth and says the existing facility operates as a colocation site, with clients supplying hardware and the company managing infrastructure and connectivity. This supports reported service at the existing named facility. Its separate expansion is explicitly in design and targeted for a future quarter. The June 2025 in service month does not establish an exact physical opening day. No current load, future capacity, Tier certification, workload allocation or provider role is newly certified.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://www.aaimdc.com/data-centers/minnesota-1/",
              "host": "www.aaimdc.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Blue Earth · Faribault · Source context reviewed",
      "status_scope": "The current original AAIM Minnesota 1 page explicitly names Blue Earth and says the existing facility operates as a colocation site, with clients supplying hardware and the company managing infrastructure and connectivity. This supports reported service at the existing named facility. Its separate expansion is explicitly in design and targeted for a future quarter. The June 2025 in service month does not establish an exact physical opening day. No current load, future capacity, Tier certification, workload allocation or provider role is newly certified.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27043"
      }
    },
    {
      "id": "aaim-data-centers-hutchinson-mn",
      "state": "mn",
      "kind": "facility",
      "name": "AAIM Data Centers  -  Hutchinson (Minnesota 2 Energy Park)",
      "group": "proposed",
      "status": "Listed proposal",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "McLeod"
      ],
      "city": "Hutchinson",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Hutchinson city/utility FAQ,all five pages text reviewed. FAQ not underlying signed permit or PPA. Future expansion requires newCUP.20MWexpectedpeak not actual metered demand; no opening date. Document also usesMWperhour wording incorrectly, no energy calculation adopted. Utility-tariff and collateral descriptions not actual customer invoices or ratepayer-outcome measurement. UndatedJune2026file path not exact publication date. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2025-08-26",
          "The City of Hutchinson FAQ reports that Council approved the named data center project final permits August 26, 2025. This dates the City administrative account, without independent certification of an issued building permit, physical construction or computing service."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://hutchinsonmn.gov/wp-content/uploads/2026/06/Data-Center-Document-Q-A.pdf",
          "host": "hutchinsonmn.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.aaimdc.com/data-centers/minnesota-2/",
          "host": "www.aaimdc.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Reviewed operator source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1025+5th+Avenue+SE%2C+Hutchinson%2C+Minnesota&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Complete literal original street query, calculated range only"
        },
        {
          "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-94.358715482445%2C44.88206728853755%2C-94.344768517555%2C44.891948711462454&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
          "host": "imagery.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Actually viewed source setting; imagery acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -94.351742,
        "lat": 44.887008,
        "precision": "address",
        "basis": "The original City of Hutchinson source names 1025 5th Avenue SE, Hutchinson, Minnesota. One complete literal Census query uniquely supports this calculated street reference. The original City and Utilities FAQ explicitly identifies the computing project location as 1025 5th Avenue SE and independently names B-MN Data Centers Inc. doing business as AAIM DataCenters. The original August 2025 permit and September 2025 power agreement dates remain administrative source statements. No current operation, changed physical stage, technical quantity, roof, room or full campus is inferred. The PDF publication day remains unknown; its website path is not an exact publication clock. No roof, tenant floor, title, present operation or complete campus is certified. Imagery acquisition date is unknown and may predate construction."
      },
      "reviewed_evidence": [
        {
          "overlay": "government-primary-review-round7-2026-10-14.json",
          "scope": "Hutchinson city/utility FAQ,all five pages text reviewed",
          "fields": {
            "published_address": "1025 FifthAvenueSE,Hutchinson,Minnesota",
            "city_reported_final_permit_approval_date": "2025-08-26",
            "city_reported_power_agreement_date": "2025-09-24",
            "developer_entity": "B-MNDataCentersInc,dbaAAIMDataCenters",
            "initial_building_area_sqft": 7500,
            "potential_expanded_area_sqft": 15000,
            "expected_peak_power_mw": 20,
            "power_basis": "expected customer load,not explicitly criticalIT",
            "expected_jobs_less_than": 5,
            "city_reported_local_financial_assistance": "none"
          },
          "notes": [
            "FAQ not underlying signed permit or PPA. Future expansion requires newCUP.20MWexpectedpeak not actual metered demand; no opening date. Document also usesMWperhour wording incorrectly, no energy calculation adopted. Utility-tariff and collateral descriptions not actual customer invoices or ratepayer-outcome measurement. UndatedJune2026file path not exact publication date.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://hutchinsonmn.gov/wp-content/uploads/2026/06/Data-Center-Document-Q-A.pdf",
              "host": "hutchinsonmn.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The original City FAQ names the AAIM and BMN data center project and describes approved plans and future compliance, including analysis after the facility is running. It supports a named listed proposal within the City planning account. The original Minnesota 2 company page says its facility is in design and targeted for a future quarter but identifies only Minnesota rather than an exact City; that generic location is not newly certified as a precise crosswalk. The City account of final permits on August 26, 2025 does not independently certify an issued building permit, construction start or computing operation. A September power purchase agreement also does not prove service. Expected noise, water and utility behavior remain prospective institutional or issuer accounts, without new technical fields.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "original_named_city_planning_account_not_compute",
              "scope": "The original City FAQ names the AAIM and BMN data center project and describes approved plans and future compliance, including analysis after the facility is running. It supports a named listed proposal within the City planning account. The original Minnesota 2 company page says its facility is in design and targeted for a future quarter but identifies only Minnesota rather than an exact City; that generic location is not newly certified as a precise crosswalk. The City account of final permits on August 26, 2025 does not independently certify an issued building permit, construction start or computing operation. A September power purchase agreement also does not prove service. Expected noise, water and utility behavior remain prospective institutional or issuer accounts, without new technical fields."
            },
            "source_read_scope": {
              "city_faq_selected_text_pages": [
                1,
                2,
                3
              ],
              "full_five_page_faq_not_claimed_read": true,
              "issuer_minnesota2_body_read": true,
              "issuer_exact_city_crosswalk_not_newly_certified": true,
              "prospective_compliance_not_observed_measurement": true,
              "future_expansion_requires_additional_permission": true,
              "file_path_month_not_publication_day": true,
              "utility_mw_per_hour_wording_not_normalized_or_exported": true
            }
          },
          "notes": [
            "The original City FAQ names the AAIM and BMN data center project and describes approved plans and future compliance, including analysis after the facility is running. It supports a named listed proposal within the City planning account. The original Minnesota 2 company page says its facility is in design and targeted for a future quarter but identifies only Minnesota rather than an exact City; that generic location is not newly certified as a precise crosswalk. The City account of final permits on August 26, 2025 does not independently certify an issued building permit, construction start or computing operation. A September power purchase agreement also does not prove service. Expected noise, water and utility behavior remain prospective institutional or issuer accounts, without new technical fields.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://hutchinsonmn.gov/wp-content/uploads/2026/06/Data-Center-Document-Q-A.pdf",
              "host": "hutchinsonmn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            },
            {
              "url": "https://www.aaimdc.com/data-centers/minnesota-2/",
              "host": "www.aaimdc.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 74, 2026-10-24",
          "scope": "The original City and Utilities FAQ explicitly identifies the computing project location as 1025 5th Avenue SE and independently names B-MN Data Centers Inc. doing business as AAIM DataCenters. The original August 2025 permit and September 2025 power agreement dates remain administrative source statements. No current operation, changed physical stage, technical quantity, roof, room or full campus is inferred. The PDF publication day remains unknown; its website path is not an exact publication clock. All protected source history, status, roles, quantities, names, addresses and jurisdiction wrappers remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -94.351742,
                "lat": 44.887008,
                "precision": "address",
                "basis": "The original City of Hutchinson source names 1025 5th Avenue SE, Hutchinson, Minnesota. One complete literal Census query uniquely supports this calculated street reference. The original City and Utilities FAQ explicitly identifies the computing project location as 1025 5th Avenue SE and independently names B-MN Data Centers Inc. doing business as AAIM DataCenters. The original August 2025 permit and September 2025 power agreement dates remain administrative source statements. No current operation, changed physical stage, technical quantity, roof, room or full campus is inferred. The PDF publication day remains unknown; its website path is not an exact publication clock. No roof, tenant floor, title, present operation or complete campus is certified. Imagery acquisition date is unknown and may predate construction."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "1025 5th Avenue SE, Hutchinson, Minnesota",
              "county_fips": [
                "27085"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The original City and Utilities FAQ explicitly identifies the computing project location as 1025 5th Avenue SE and independently names B-MN Data Centers Inc. doing business as AAIM DataCenters. The original August 2025 permit and September 2025 power agreement dates remain administrative source statements. No current operation, changed physical stage, technical quantity, roof, room or full campus is inferred. The PDF publication day remains unknown; its website path is not an exact publication clock. All protected source history, status, roles, quantities, names, addresses and jurisdiction wrappers remain exact.",
            "The inherited general area coordinate was not independently admitted as a reviewed source reference. The original City and Utilities FAQ explicitly identifies the computing project location as 1025 5th Avenue SE and independently names B-MN Data Centers Inc. doing business as AAIM DataCenters. The original August 2025 permit and September 2025 power agreement dates remain administrative source statements. No current operation, changed physical stage, technical quantity, roof, room or full campus is inferred. The PDF publication day remains unknown; its website path is not an exact publication clock. The complete literal query and its independently checked calculated reference are inside the unchanged retained county 27085. The measured correction from the prior Native context is 2.8 metres. This is a source reference review, not a physical relocation. No source setting pixel supplies coordinates or construction stage.",
            "The source setting shows a broad street bordered by substantial buildings, parking, open land, planted trees, water and residential blocks. The street reference selects no computing roof, room, present construction stage or complete campus. Acquisition date is unknown."
          ],
          "sources": [
            {
              "url": "https://hutchinsonmn.gov/wp-content/uploads/2026/06/Data-Center-Document-Q-A.pdf",
              "host": "hutchinsonmn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Original explicit computing project location, separate from mail"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1025+5th+Avenue+SE%2C+Hutchinson%2C+Minnesota&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Complete literal original street query, calculated range only"
            },
            {
              "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-94.358715482445%2C44.88206728853755%2C-94.344768517555%2C44.891948711462454&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
              "host": "imagery.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Actually viewed source setting; imagery acquisition date unknown"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Calculated street reference, not a roof or tenant floor",
      "summary": "Hutchinson · McLeod · Source context reviewed",
      "status_scope": "The original City FAQ names the AAIM and BMN data center project and describes approved plans and future compliance, including analysis after the facility is running. It supports a named listed proposal within the City planning account. The original Minnesota 2 company page says its facility is in design and targeted for a future quarter but identifies only Minnesota rather than an exact City; that generic location is not newly certified as a precise crosswalk. The City account of final permits on August 26, 2025 does not independently certify an issued building permit, construction start or computing operation. A September power purchase agreement also does not prove service. Expected noise, water and utility behavior remain prospective institutional or issuer accounts, without new technical fields.",
      "event_evidence": [
        {
          "date": "2025-08-26",
          "text": "The City of Hutchinson FAQ reports that Council approved the named data center project final permits August 26, 2025. This dates the City administrative account, without independent certification of an issued building permit, physical construction or computing service.",
          "kind": "approved",
          "sources": [
            {
              "url": "https://hutchinsonmn.gov/wp-content/uploads/2026/06/Data-Center-Document-Q-A.pdf",
              "host": "hutchinsonmn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ]
        }
      ]
    },
    {
      "id": "aaim-data-centers-mountain-lake-mn",
      "state": "mn",
      "kind": "facility",
      "name": "AAIM Data Centers  -  Mountain Lake (Minnesota 3 Energy Park)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Cottonwood"
      ],
      "city": "Mountain Lake",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Mountain Lake historical council discussion. Minutes describe review request, not project approval, construction or operation. No operator named in minutes, AAIMalias requires separate match.250kannualrevenueestimate not taxaward paid.50dBexpectation without measurement/distance not achieved noise result. No exact street or researched parcelpoint. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://cityofmountainlakemn.gov/wp-content/uploads/10-7-24-City-Council-Minutes.pdf",
          "host": "cityofmountainlakemn.gov",
          "date": "2024-10-07",
          "published": "2024-10-07",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.aaimdc.com/data-centers/minnesota-3/",
          "host": "www.aaimdc.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 44.00713,
        "lng": -95.18119,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "government-primary-review-round7-2026-10-14.json",
          "scope": "Mountain Lake historical council discussion",
          "fields": {
            "historical_city_meeting_date": "2024-10-07",
            "proposed_initial_power_mw": 10,
            "power_basis": "anticipated start load,not explicitIT",
            "proposed_location_description": "industrial district nexttoMilkSpecialtiesandBalzer",
            "proposed_use_description": "AIonly,noBitcoinorcryptocurrency mining"
          },
          "notes": [
            "Minutes describe review request, not project approval, construction or operation. No operator named in minutes, AAIMalias requires separate match.250kannualrevenueestimate not taxaward paid.50dBexpectation without measurement/distance not achieved noise result. No exact street or researched parcelpoint.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://cityofmountainlakemn.gov/wp-content/uploads/10-7-24-City-Council-Minutes.pdf",
              "host": "cityofmountainlakemn.gov",
              "date": "2024-10-07",
              "published": "2024-10-07",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The selected original City minutes paragraph reports a future Utilities and Planning review of an AI computing proposal in the industrial district, without naming AAIM in that passage. The current original Minnesota 3 company page describes a facility in development with a future target and names only Minnesota. Those bodies do not independently complete the exact Mountain Lake and AAIM project crosswalk or establish physical construction or computing service. A closed attorney session without action is not project approval. Modeled cooling claims and anticipated utility effects are not exported as measured facility facts.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "unnamed_city_proposal_and_state_only_issuer_exact_identity_held",
              "scope": "The selected original City minutes paragraph reports a future Utilities and Planning review of an AI computing proposal in the industrial district, without naming AAIM in that passage. The current original Minnesota 3 company page describes a facility in development with a future target and names only Minnesota. Those bodies do not independently complete the exact Mountain Lake and AAIM project crosswalk or establish physical construction or computing service. A closed attorney session without action is not project approval. Modeled cooling claims and anticipated utility effects are not exported as measured facility facts."
            },
            "source_read_scope": {
              "city_minutes_selected_project_paragraph_read": true,
              "city_project_paragraph_does_not_name_aaim": true,
              "issuer_minnesota3_main_body_read": true,
              "issuer_no_exact_city_in_main_body": true,
              "no_unnamed_project_identity_promotion": true,
              "no_closed_session_approval_inferred": true
            }
          },
          "notes": [
            "The selected original City minutes paragraph reports a future Utilities and Planning review of an AI computing proposal in the industrial district, without naming AAIM in that passage. The current original Minnesota 3 company page describes a facility in development with a future target and names only Minnesota. Those bodies do not independently complete the exact Mountain Lake and AAIM project crosswalk or establish physical construction or computing service. A closed attorney session without action is not project approval. Modeled cooling claims and anticipated utility effects are not exported as measured facility facts.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://cityofmountainlakemn.gov/wp-content/uploads/10-7-24-City-Council-Minutes.pdf",
              "host": "cityofmountainlakemn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            },
            {
              "url": "https://www.aaimdc.com/data-centers/minnesota-3/",
              "host": "www.aaimdc.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Mountain Lake · Cottonwood · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27033"
      }
    },
    {
      "id": "amazon-becker-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Amazon Becker Data Center (Suspended)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Sherburne"
      ],
      "city": "Becker",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. KNSINov14,2024reportsAmazonbought348acBeckerfor73.56MfromElkRiverTechnologies/Diode,whichhadboughtfromXcel7.97MinApril. Specificcertificate/deednotindependentlyread. Laterstageunknown;publishedlandtransactionnotconstruction/energization.1Bcapital100perm1200constructionwerecompanyforecasts,notlandpricepluscapex/actualjobs. Exactclosingdayunprinted. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://knsiradio.com/2024/11/14/amazon-purchases-348-acres-in-becker-for-data-center-development-near-retiring-sherco-plant/",
          "host": "knsiradio.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.ci.becker.mn.us/AgendaCenter/ViewFile/Minutes/_09292025-502",
          "host": "www.ci.becker.mn.us",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Reviewed government record"
        }
      ],
      "loc": {
        "lat": 45.4442,
        "lng": -93.7751,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json",
          "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.",
          "fields": {
            "dated_reported_context": "KNSINov14,2024reportsAmazonbought348acBeckerfor73.56MfromElkRiverTechnologies/Diode,whichhadboughtfromXcel7.97MinApril. Specificcertificate/deednotindependentlyread. Laterstageunknown;publishedlandtransactionnotconstruction/energization.1Bcapital100perm1200constructionwerecompanyforecasts,notlandpricepluscapex/actualjobs. Exactclosingdayunprinted."
          },
          "notes": [
            "KNSINov14,2024reportsAmazonbought348acBeckerfor73.56MfromElkRiverTechnologies/Diode,whichhadboughtfromXcel7.97MinApril. Specificcertificate/deednotindependentlyread. Laterstageunknown;publishedlandtransactionnotconstruction/energization.1Bcapital100perm1200constructionwerecompanyforecasts,notlandpricepluscapex/actualjobs. Exactclosingdayunprinted.",
            "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations."
          ],
          "sources": [
            {
              "url": "https://knsiradio.com/2024/11/14/amazon-purchases-348-acres-in-becker-for-data-center-development-near-retiring-sherco-plant/",
              "host": "knsiradio.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The original posted City minutes record a staff update relaying a Star Tribune report that Amazon halted Becker plans, followed by an account of possible property sale under limited circumstances. This is a City record of a secondary news account rather than an independently read original Amazon announcement or completed sale. The posted minutes retain a blank submission line. No original current company project disposition, precise legal cessation, physical computing closure, construction or service is certified from this passage.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "official_minutes_relay_secondary_account_current_physical_stage_held",
              "scope": "The original posted City minutes record a staff update relaying a Star Tribune report that Amazon halted Becker plans, followed by an account of possible property sale under limited circumstances. This is a City record of a secondary news account rather than an independently read original Amazon announcement or completed sale. The posted minutes retain a blank submission line. No original current company project disposition, precise legal cessation, physical computing closure, construction or service is certified from this passage."
            },
            "source_read_scope": {
              "selected_minutes_development_update_paragraph_read": true,
              "staff_explicitly_cites_secondary_newspaper": true,
              "blank_submission_line_retained": true,
              "potential_land_sale_not_completed": true,
              "no_news_report_promoted_to_original_operator_confirmation": true
            }
          },
          "notes": [
            "The original posted City minutes record a staff update relaying a Star Tribune report that Amazon halted Becker plans, followed by an account of possible property sale under limited circumstances. This is a City record of a secondary news account rather than an independently read original Amazon announcement or completed sale. The posted minutes retain a blank submission line. No original current company project disposition, precise legal cessation, physical computing closure, construction or service is certified from this passage.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://www.ci.becker.mn.us/AgendaCenter/ViewFile/Minutes/_09292025-502",
              "host": "www.ci.becker.mn.us",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Becker · Sherburne · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27141"
      }
    },
    {
      "id": "oppidan-apple-valley-technology-park-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Apple Valley Technology Park (Oppidan/Rockport)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Dakota"
      ],
      "city": "Apple Valley",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. The expected March 26 council action is not an observed result. Distinguish withdrawn rezoning, earlier plan denial and later recommendation; do not mark the whole project finally denied from this report alone. Oppidan's Eagan facility is separate. Seven overall buildings are not seven data halls; five were described as data centers. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.limitless-news.com/local/apple-valley-technology-park-update",
          "host": "limitless-news.com",
          "date": "2026-03-20",
          "published": "2026-03-20",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 44.70303,
        "lng": -93.04135,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round30-2026-10-14.json",
          "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.",
          "fields": {
            "reported_context": "Limitless News reports a March 18 Apple Valley planning recommendation to deny several Oppidan/Rockport requests after a January comprehensive-plan denial and March rezoning withdrawals.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "The expected March 26 council action is not an observed result. Distinguish withdrawn rezoning, earlier plan denial and later recommendation; do not mark the whole project finally denied from this report alone. Oppidan's Eagan facility is separate. Seven overall buildings are not seven data halls; five were described as data centers.",
            "Original approvals and later observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.limitless-news.com/local/apple-valley-technology-park-update",
              "host": "limitless-news.com",
              "date": "2026-03-20",
              "published": "2026-03-20",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Apple Valley · Dakota · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27037"
      }
    },
    {
      "id": "archer-datacenter-faribault-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Archer Datacenter Faribault",
      "group": "proposed",
      "status": "Listed proposal",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Rice"
      ],
      "city": "Faribault",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Faribault official project and review chronology. City reports no formal development applications or city financial-assistance requests yet, not no possible state exemption. Court ruling summarized by city, underlying order not independently read here. July7work session not signed resolution date. 2025negative EIS decision does not establish final 2026 environmental clearance. No MW adopted. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.faribaultmn.gov/815/Archer-Datacenters",
          "host": "faribaultmn.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 44.35423,
        "lng": -93.29673,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "government-primary-review-round7-2026-10-14.json",
          "scope": "Faribault official project and review chronology",
          "fields": {
            "proposed_building_area_sqft_max": 500000,
            "site_acres_approx": 87,
            "proposed_buildings_max": 6,
            "land_purchase_month": "2024-11",
            "city_reported_court_environmental_review_order_date": "2026-06-08",
            "city_reported_supplemental_review_extension_resolution_date": "2026-07-14",
            "supplemental_review_deadline": "2027-03-31",
            "status": "proposed; supplemental environmental review"
          },
          "notes": [
            "City reports no formal development applications or city financial-assistance requests yet, not no possible state exemption. Court ruling summarized by city, underlying order not independently read here. July7work session not signed resolution date. 2025negative EIS decision does not establish final 2026 environmental clearance. No MW adopted.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.faribaultmn.gov/815/Archer-Datacenters",
              "host": "faribaultmn.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The current original City Archer page explicitly describes a proposed development and states that no formal City applications have been submitted. This supports a listed proposal within the City review account. The City chronology records an August 12, 2025 environmental review determination and reports a June 8, 2026 appellate return for additional information or an impact statement, followed by a July 14 extension with supplemental review due March 31, 2027. The underlying court opinion was not independently read. None of those legal or review steps proves construction, operation, final approval or physical closure. The existing Native concern finding already covers this environmental review and appeal episode, so no duplicate concern is added.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "original_city_explicit_proposal_no_formal_applications",
              "scope": "The current original City Archer page explicitly describes a proposed development and states that no formal City applications have been submitted. This supports a listed proposal within the City review account. The City chronology records an August 12, 2025 environmental review determination and reports a June 8, 2026 appellate return for additional information or an impact statement, followed by a July 14 extension with supplemental review due March 31, 2027. The underlying court opinion was not independently read. None of those legal or review steps proves construction, operation, final approval or physical closure. The existing Native concern finding already covers this environmental review and appeal episode, so no duplicate concern is added."
            },
            "source_read_scope": {
              "original_city_current_intro_and_selected_environmental_chronology_read": true,
              "court_outcome_attributed_to_city_not_underlying_opinion": true,
              "supplemental_review_deadline_not_physical_schedule": true,
              "existing_concern_id": "concern:mn-faribault-environmental-review-appeal-record-2026",
              "existing_concern_not_duplicated": true
            }
          },
          "notes": [
            "The current original City Archer page explicitly describes a proposed development and states that no formal City applications have been submitted. This supports a listed proposal within the City review account. The City chronology records an August 12, 2025 environmental review determination and reports a June 8, 2026 appellate return for additional information or an impact statement, followed by a July 14 extension with supplemental review due March 31, 2027. The underlying court opinion was not independently read. None of those legal or review steps proves construction, operation, final approval or physical closure. The existing Native concern finding already covers this environmental review and appeal episode, so no duplicate concern is added.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://www.faribaultmn.gov/815/Archer-Datacenters",
              "host": "www.faribaultmn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Faribault · Rice · Source context reviewed",
      "status_scope": "The current original City Archer page explicitly describes a proposed development and states that no formal City applications have been submitted. This supports a listed proposal within the City review account. The City chronology records an August 12, 2025 environmental review determination and reports a June 8, 2026 appellate return for additional information or an impact statement, followed by a July 14 extension with supplemental review due March 31, 2027. The underlying court opinion was not independently read. None of those legal or review steps proves construction, operation, final approval or physical closure. The existing Native concern finding already covers this environmental review and appeal episode, so no duplicate concern is added.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27131"
      }
    },
    {
      "id": "atomic-data-minneapolis-central-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Atomic Data Minneapolis Central (MSP250)",
      "group": "operating",
      "status": "Reported service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Hennepin"
      ],
      "city": "Minneapolis",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Global service specifications cannot establish a specific building MW or street. Operator explicitly lists Minneapolis Central, Minneapolis East and Dallas service locations. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.atomicdata.com/infrastructure/",
          "host": "atomicdata.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 45.00463,
        "lng": -93.47661,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "field-verification-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "city": "Minneapolis",
            "location_label": "Minneapolis Central",
            "marketed_service": "colocation"
          },
          "notes": [
            "Global service specifications cannot establish a specific building MW or street.",
            "Operator explicitly lists Minneapolis Central, Minneapolis East and Dallas service locations.",
            "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.atomicdata.com/infrastructure/",
              "host": "atomicdata.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The current original infrastructure page explicitly names Minneapolis Central as a data center offering current colocation and describes services supporting client infrastructure. This supports reported service at the named Minneapolis Central facility within the provider account. General platform claims, uptime targets, generator specifications and security attestations are not independently certified or promoted as new technical fields. No exact physical opening day, full building occupancy or current measured load is established.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "original_named_current_colocation_service",
              "scope": "The current original infrastructure page explicitly names Minneapolis Central as a data center offering current colocation and describes services supporting client infrastructure. This supports reported service at the named Minneapolis Central facility within the provider account. General platform claims, uptime targets, generator specifications and security attestations are not independently certified or promoted as new technical fields. No exact physical opening day, full building occupancy or current measured load is established."
            },
            "source_read_scope": {
              "original_infrastructure_colocation_and_named_minneapolis_central_sections_read": true,
              "platform_specs_not_independent_certification": true,
              "no_quantity_or_role_export": true
            }
          },
          "notes": [
            "The current original infrastructure page explicitly names Minneapolis Central as a data center offering current colocation and describes services supporting client infrastructure. This supports reported service at the named Minneapolis Central facility within the provider account. General platform claims, uptime targets, generator specifications and security attestations are not independently certified or promoted as new technical fields. No exact physical opening day, full building occupancy or current measured load is established.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://www.atomicdata.com/infrastructure/",
              "host": "www.atomicdata.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Minneapolis · Hennepin · Source context reviewed",
      "status_scope": "The current original infrastructure page explicitly names Minneapolis Central as a data center offering current colocation and describes services supporting client infrastructure. This supports reported service at the named Minneapolis Central facility within the provider account. General platform claims, uptime targets, generator specifications and security attestations are not independently certified or promoted as new technical fields. No exact physical opening day, full building occupancy or current measured load is established.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27053"
      }
    },
    {
      "id": "tract-cannon-falls-technology-park-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Cannon Falls Technology Park (Tract)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Goodhue"
      ],
      "city": "Cannon Falls",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.. Annexation is jurisdiction change, not land purchase or final DC approval. Hundreds-of-millions-to-one-billion investment is a broad developer-narrative forecast, not actual capital. Conditional construction within next year and September hearings are future at publication. Roughly 250 footbuffer is described planned separation, not independently checked final standard.2,400 dollars annually for ten years is CITY payment to township under annexation, not a developer tax subsidy or annual site tax revenue. Utility/infrastructure cost intentions are not an executed ESA. Later original decisions and observed outcomes take precedence; future events have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.kttc.com/2025/08/27/cannon-falls-explores-major-data-center-project-following-land-annexation",
          "host": "kttc.com",
          "date": "2025-08-27",
          "published": "2025-08-27",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 44.42718,
        "lng": -92.74201,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round33-2026-10-14.json",
          "scope": "Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.",
          "fields": {
            "reported_context": "KTTC reports Cannon Falls annexed nearly 240 acres from Randolph Township for a possible Tract data center, still needing city-council project approval.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Annexation is jurisdiction change, not land purchase or final DC approval. Hundreds-of-millions-to-one-billion investment is a broad developer-narrative forecast, not actual capital. Conditional construction within next year and September hearings are future at publication. Roughly 250 footbuffer is described planned separation, not independently checked final standard.2,400 dollars annually for ten years is CITY payment to township under annexation, not a developer tax subsidy or annual site tax revenue. Utility/infrastructure cost intentions are not an executed ESA.",
            "Later original decisions and observed outcomes take precedence; future events have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.kttc.com/2025/08/27/cannon-falls-explores-major-data-center-project-following-land-annexation",
              "host": "kttc.com",
              "date": "2025-08-27",
              "published": "2025-08-27",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Cannon Falls · Goodhue · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27049"
      }
    },
    {
      "id": "centersquare-shakopee-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Centersquare Shakopee (MSP1 Campus)",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Scott"
      ],
      "city": "Shakopee",
      "address": "",
      "who": "Csquare",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. NamedsiteexplicitlabelutilityversusUPSversusgenerator, notcriticalIToradditive. Minneapolisismarketlabel. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.csquare.com/data-centers/minneapolis",
          "host": "csquare.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.csquare.com/hubfs/Centersquare%20website/docs/Csquare-MSP-SpecSheet.pdf",
          "host": "www.csquare.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Current named MSP1 operator specification sheet address"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=4450+Dean+Lakes+Boulevard%2C+Shakopee%2C+MN+55379&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Calculated Census street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-93.46861065025061%2C44.777580630624534%2C-93.45975166237938%2C44.78386880884947&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Aerial setting context only, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -93.464181156315,
        "lat": 44.780724719737,
        "precision": "address",
        "basis": "Published Centersquare facility address 4450 Dean Lakes Boulevard, Shakopee, MN 55379 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "operator_site_code": "MSP1",
            "published_city": "Shakopee, Minnesota",
            "raised_floor_sqft": 29800,
            "utility_power_mw": 19.1,
            "ups_capacity_mw": 2.4,
            "generator_capacity_mw": 3.6
          },
          "notes": [
            "NamedsiteexplicitlabelutilityversusUPSversusgenerator, notcriticalIToradditive. Minneapolisismarketlabel.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.csquare.com/data-centers/minneapolis",
              "host": "csquare.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "Csquare lists current colocation, connectivity and on-site support for its specifically named MSP1 in Shakopee facility. Source naming is retained as context; no provider-brand, address, point, capacity or certification field is promoted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "Csquare lists current colocation, connectivity and on-site support for its specifically named MSP1 in Shakopee facility. Source naming is retained as context; no provider-brand, address, point, capacity or certification field is promoted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "Csquare lists current colocation, connectivity and on-site support for its specifically named MSP1 in Shakopee facility. Source naming is retained as context; no provider-brand, address, point, capacity or certification field is promoted."
          ],
          "sources": [
            {
              "url": "https://www.csquare.com/data-centers/minneapolis",
              "host": "www.csquare.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 15, October 23, 2026",
          "scope": "Current official operator street reference only. All native protected facts and canonical address remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -93.464181156315,
                "lat": 44.780724719737,
                "precision": "address",
                "basis": "Published Centersquare facility address 4450 Dean Lakes Boulevard, Shakopee, MN 55379 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "4450 Dean Lakes Boulevard, Shakopee, MN 55379",
              "county_fips": [
                "27139"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The current official market page names the exact facility code and links the operator specification sheet. The named PDF facility address section was rendered and actually viewed. Related facilities, corporate offices and PDF map coordinates are excluded.",
            "The unique Census street range is a calculated address reference inside the existing state and county. Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. The street reference does not locate a surveyed roof, legal parcel, full campus, tenant suite or floor.",
            "Canonical address, stage, status, physical dates, quantities, company roles, jurisdiction and all unrelated wrappers remain exact. Current specifications and marketing do not certify commissioning or current operation.",
            "The retained Census method capture remains dated October 22. Actual operator, match and aerial captures are dated October 23. No source retrieval date is silently advanced.",
            "The old unreviewed inventory point is 2248.2 metres from the calculated street reference. Current official MSP1 specification sheet page 2 explicitly names 4450 Dean Lakes Boulevard, Shakopee. A unique Census range agrees with the existing Scott County context, and actually viewed official aerial context places the reference on the named street beside large commercial forms. No original precise point, legal parcel, building or ownership finding is overridden."
          ],
          "sources": [
            {
              "url": "https://www.csquare.com/hubfs/Centersquare%20website/docs/Csquare-MSP-SpecSheet.pdf",
              "host": "www.csquare.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current named MSP1 operator specification sheet address"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=4450+Dean+Lakes+Boulevard%2C+Shakopee%2C+MN+55379&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Calculated Census street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-93.46861065025061%2C44.777580630624534%2C-93.45975166237938%2C44.78386880884947&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Aerial setting context only, acquisition date unknown"
            },
            {
              "url": "https://www.csquare.com/data-centers/minneapolis",
              "host": "www.csquare.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current official market page names MSP1 and links the exact specification sheet"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check26, October23,2026",
          "scope": "The current Csquare provider website names this retained facility code and offers colocation and customer support. Operator per source identifies the provider brand only, not legal property ownership, a legal operating entity or sole operation of the whole building. Existing Centersquare record names are retained. No legal alias, corporate succession, identity merger, new physical building, status, point, street address, jurisdiction, power, water, equipment, certification or completion finding is adopted. Source marketing figures and service levels are not independent measurements. The page publication date remains unknown; retrieval is not an opening date. Only the named MSP1 service context is reviewed. Other codes on the shared market page keep their separate records and source scopes. The retained Shakopee campus is not split into separate physical sites from marketing terminology.",
          "fields": {
            "company_association": {
              "name": "Csquare",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "The current Csquare provider website names this retained facility code and offers colocation and customer support. Operator per source identifies the provider brand only, not legal property ownership, a legal operating entity or sole operation of the whole building. Existing Centersquare record names are retained. No legal alias, corporate succession, identity merger, new physical building, status, point, street address, jurisdiction, power, water, equipment, certification or completion finding is adopted. Source marketing figures and service levels are not independent measurements. The page publication date remains unknown; retrieval is not an opening date. Only the named MSP1 service context is reviewed. Other codes on the shared market page keep their separate records and source scopes. The retained Shakopee campus is not split into separate physical sites from marketing terminology."
            },
            "provider_role": "operator"
          },
          "notes": [
            "The current Csquare provider website names this retained facility code and offers colocation and customer support. Operator per source identifies the provider brand only, not legal property ownership, a legal operating entity or sole operation of the whole building. Existing Centersquare record names are retained. No legal alias, corporate succession, identity merger, new physical building, status, point, street address, jurisdiction, power, water, equipment, certification or completion finding is adopted. Source marketing figures and service levels are not independent measurements. The page publication date remains unknown; retrieval is not an opening date. Only the named MSP1 service context is reviewed. Other codes on the shared market page keep their separate records and source scopes. The retained Shakopee campus is not split into separate physical sites from marketing terminology."
          ],
          "sources": [
            {
              "url": "https://www.csquare.com/data-centers/minneapolis",
              "host": "www.csquare.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current named MSP1 provider relationship"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Shakopee · Scott · Source context reviewed",
      "status_scope": "Csquare lists current colocation, connectivity and on-site support for its specifically named MSP1 in Shakopee facility. Source naming is retained as context; no provider-brand, address, point, capacity or certification field is promoted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "centra-msp1-eagan-mn",
      "state": "mn",
      "kind": "facility",
      "name": "CENTRA MSP1",
      "group": "building",
      "status": "Reported construction",
      "raw_status": "under construction",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Dakota"
      ],
      "city": "Eagan",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. CENTRA Eagan utility and critical capacity. 12MVAapparentpowernotIT.92000footprintnotnecessarilycombinedtwo-storygrossarea. TierIIIplusisoperator-designclaim,notindependentUptimecertificate. PublishedISO270001spellingnotcorrectedtoverifiedISO27001cert. DesignPUEnotmeasured. No exactopeningdate. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.centradigital.com/data-centers/msp1",
          "host": "centradigital.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.centradigital.com/post/centra-breaks-ground-on-msp1",
          "host": "www.centradigital.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 44.67195,
        "lng": -93.06517,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round10-2026-10-14.json",
          "scope": "CENTRA Eagan utility and critical capacity",
          "fields": {
            "operator": "CENTRA Digital",
            "site_code": "MSP1",
            "address": "3640 Nasseff Way, Eagan, Minnesota55123",
            "utility_capacity_mva": 12,
            "critical_capacity_mw": 8.1,
            "building_footprint_sqft": 92000,
            "building_stories": 2,
            "rack_capability_kw_max": 150,
            "design_pue_target_max": 1.35
          },
          "notes": [
            "12MVAapparentpowernotIT.92000footprintnotnecessarilycombinedtwo-storygrossarea. TierIIIplusisoperator-designclaim,notindependentUptimecertificate. PublishedISO270001spellingnotcorrectedtoverifiedISO27001cert. DesignPUEnotmeasured. No exactopeningdate.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.centradigital.com/data-centers/msp1",
              "host": "centradigital.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The original CENTRA MSP1 project article announces groundbreaking and describes transforming and modernizing a former enterprise facility into a future interconnection hub in Eagan. This supports reported construction and adaptive reuse within the issuer account, without an independently established first physical work day or commissioned computing. The current facility page offers racks and suites, but that sales description alone does not prove customer deployment or completed commissioning. Its technical, Tier and compliance marketing is not independently certified or exported as new quantities, location or role fields.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "original_issuer_reports_groundbreaking_and_retrofit_service_not_proven",
              "scope": "The original CENTRA MSP1 project article announces groundbreaking and describes transforming and modernizing a former enterprise facility into a future interconnection hub in Eagan. This supports reported construction and adaptive reuse within the issuer account, without an independently established first physical work day or commissioned computing. The current facility page offers racks and suites, but that sales description alone does not prove customer deployment or completed commissioning. Its technical, Tier and compliance marketing is not independently certified or exported as new quantities, location or role fields."
            },
            "source_read_scope": {
              "original_project_article_main_body_read": true,
              "current_facility_page_main_body_read": true,
              "adaptive_reuse_and_future_service_wording_retained": true,
              "sales_offering_not_commissioned_computing": true,
              "groundbreaking_not_exact_first_physical_work_day": true,
              "tier_and_quantity_claims_not_exported": true
            }
          },
          "notes": [
            "The original CENTRA MSP1 project article announces groundbreaking and describes transforming and modernizing a former enterprise facility into a future interconnection hub in Eagan. This supports reported construction and adaptive reuse within the issuer account, without an independently established first physical work day or commissioned computing. The current facility page offers racks and suites, but that sales description alone does not prove customer deployment or completed commissioning. Its technical, Tier and compliance marketing is not independently certified or exported as new quantities, location or role fields.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://www.centradigital.com/data-centers/msp1",
              "host": "www.centradigital.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            },
            {
              "url": "https://www.centradigital.com/post/centra-breaks-ground-on-msp1",
              "host": "www.centradigital.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Eagan · Dakota · Source context reviewed",
      "status_scope": "The original CENTRA MSP1 project article announces groundbreaking and describes transforming and modernizing a former enterprise facility into a future interconnection hub in Eagan. This supports reported construction and adaptive reuse within the issuer account, without an independently established first physical work day or commissioned computing. The current facility page offers racks and suites, but that sales description alone does not prove customer deployment or completed commissioning. Its technical, Tier and compliance marketing is not independently certified or exported as new quantities, location or role fields.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27037"
      }
    },
    {
      "id": "cloudhq-msp-campus-chaska-mn",
      "state": "mn",
      "kind": "facility",
      "name": "CloudHQ MSP Campus (Chaska)",
      "group": "proposed",
      "status": "Listed proposal",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Carver"
      ],
      "city": "Chaska",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Chaska project review and design forecasts. No final site/plat approval or energization established. City local tax relief statement not all state/federal incentives. Water forecast not measured consumption. Undated six-month study estimate cannot produce exact completion date; proposed substation not site IT MW. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.chaskamn.gov/841/Cloud-HQ",
          "host": "chaskamn.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 44.82064,
        "lng": -93.80225,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "government-primary-review-round7-2026-10-14.json",
          "scope": "Chaska project review and design forecasts",
          "fields": {
            "published_address": "2007 Schoolmaster Drive, Chaska, Minnesota",
            "planned_area_sqft_approx": 1500000,
            "city_council_preliminary_approval_date": "2024-10-21",
            "city_council_conditional_use_approval_date": "2023-10-16",
            "current_city_reported_status": "final application not submitted; no final review timeline",
            "forecast_water_gallons_per_year": 14000000,
            "city_reported_local_tax_relief_status": "none applied for or offered"
          },
          "notes": [
            "No final site/plat approval or energization established. City local tax relief statement not all state/federal incentives. Water forecast not measured consumption. Undated six-month study estimate cannot produce exact completion date; proposed substation not site IT MW.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.chaskamn.gov/841/Cloud-HQ",
              "host": "chaskamn.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The current original City CloudHQ page labels the development proposed and describes preliminary approval in October 2024, with no final application and no timeline for final review. This supports a listed proposal within the City account. Environmental review, conditional use and preliminary planning steps do not establish construction or computing operation. A relative forecast about a power study is not converted to an exact future date. City technical assurances about planned noise, cooling and electricity remain prospective rather than measured facility performance.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "original_city_proposed_no_final_application",
              "scope": "The current original City CloudHQ page labels the development proposed and describes preliminary approval in October 2024, with no final application and no timeline for final review. This supports a listed proposal within the City account. Environmental review, conditional use and preliminary planning steps do not establish construction or computing operation. A relative forecast about a power study is not converted to an exact future date. City technical assurances about planned noise, cooling and electricity remain prospective rather than measured facility performance."
            },
            "source_read_scope": {
              "complete_city_project_main_body_read": true,
              "preliminary_approval_not_final_or_operation": true,
              "no_final_application_or_timeline_retained": true,
              "relative_power_study_estimate_not_exact_day": true,
              "no_technical_financial_export": true
            }
          },
          "notes": [
            "The current original City CloudHQ page labels the development proposed and describes preliminary approval in October 2024, with no final application and no timeline for final review. This supports a listed proposal within the City account. Environmental review, conditional use and preliminary planning steps do not establish construction or computing operation. A relative forecast about a power study is not converted to an exact future date. City technical assurances about planned noise, cooling and electricity remain prospective rather than measured facility performance.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://www.chaskamn.gov/841/Cloud-HQ",
              "host": "www.chaskamn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Chaska · Carver · Source context reviewed",
      "status_scope": "The current original City CloudHQ page labels the development proposed and describes preliminary approval in October 2024, with no final application and no timeline for final review. This supports a listed proposal within the City account. Environmental review, conditional use and preliminary planning steps do not establish construction or computing operation. A relative forecast about a power study is not converted to an exact future date. City technical assurances about planned noise, cooling and electricity remain prospective rather than measured facility performance.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27019"
      }
    },
    {
      "id": "cologix-minneapolis-511-building-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Cologix Minneapolis (511 Building, MIN1-MIN5)",
      "group": "operating",
      "status": "Operating phase",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Hennepin"
      ],
      "city": "Minneapolis",
      "address": "",
      "who": "Cologix",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. MIN5expansion inside511carrierhotel, not entirebuilding. MIN1 to 5sameaddressare suites/offerings; do not count five separate physical buildings fromcodes. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://cologix.com/data-centers/minneapolis/min5/",
          "host": "cologix.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=511+11th+Avenue+South%2C+Minneapolis%2C+Minnesota&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street method and limits"
        },
        {
          "url": "https://cologix.com/data-centers/minneapolis/",
          "host": "cologix.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "First party exact code or campus text, scoped provider relationship reviewed"
        }
      ],
      "loc": {
        "lat": 44.972378841882,
        "lng": -93.255587760133,
        "precision": "address",
        "basis": "Published Cologix facility address 511 11th Avenue South, Minneapolis, Minnesota matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "remaining-operators-review-round5-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "operator_site_code": "MIN5",
            "published_address": "511 11th Avenue South, Minneapolis, MN",
            "additional_colocation_area_sqft": 10000,
            "additional_power_capacity_mw": 1.5,
            "power_basis": "power capacity, not explicitly criticalIT"
          },
          "notes": [
            "MIN5expansion inside511carrierhotel, not entirebuilding. MIN1 to 5sameaddressare suites/offerings; do not count five separate physical buildings fromcodes.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://cologix.com/data-centers/minneapolis/min5/",
              "host": "cologix.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "Cologix lists current colocation and cloud interconnection at MIN5 within the 511 Building. This supports a service phase within the existing MIN1 to MIN5 campus record, not certification that every advertised hall or capacity is energized. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operating_phase",
              "scope": "Cologix lists current colocation and cloud interconnection at MIN5 within the 511 Building. This supports a service phase within the existing MIN1 to MIN5 campus record, not certification that every advertised hall or capacity is energized. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "Cologix lists current colocation and cloud interconnection at MIN5 within the 511 Building. This supports a service phase within the existing MIN1 to MIN5 campus record, not certification that every advertised hall or capacity is energized."
          ],
          "sources": [
            {
              "url": "https://cologix.com/data-centers/minneapolis/min5/",
              "host": "cologix.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 6, October 22, 2026",
          "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, jurisdiction, title, surveyed parcel, full campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 44.972378841882,
                "lng": -93.255587760133,
                "precision": "address",
                "basis": "Published Cologix facility address 511 11th Avenue South, Minneapolis, Minnesota matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "511 11th Avenue South, Minneapolis, Minnesota",
              "county_fips": [
                "27053"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The official Cologix named facility heading and immediately preceding numeric street address identify the existing research record. Related facility cards and corporate addresses are excluded. The native blank address field remains exact; the service address is retained as reviewed location evidence.",
            "The unique Census street point and retained county boundary agree with the existing county. This calculated address reference does not establish a building count, parcel boundary, ownership, commissioning, status, date, capacity or environmental finding."
          ],
          "sources": [
            {
              "url": "https://cologix.com/data-centers/minneapolis/min5/",
              "host": "cologix.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Cologix named facility heading and preceding street address"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=511+11th+Avenue+South%2C+Minneapolis%2C+Minnesota&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street method and limits"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 16, October 23, 2026",
          "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The operator role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The market page separately lists MIN1 to MIN5 at the 511 Building and describes Cologix operations there. Its conflicting four and five data center wording is retained as a source limitation, not resolved into a count of distinct buildings, floors or physical facilities.",
          "fields": {
            "company_association": {
              "name": "Cologix",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The operator role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The market page separately lists MIN1 to MIN5 at the 511 Building and describes Cologix operations there. Its conflicting four and five data center wording is retained as a source limitation, not resolved into a count of distinct buildings, floors or physical facilities."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Cologix explicitly identifies the retained named code or grouped campus in its own source. The operator role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The market page separately lists MIN1 to MIN5 at the 511 Building and describes Cologix operations there. Its conflicting four and five data center wording is retained as a source limitation, not resolved into a count of distinct buildings, floors or physical facilities.",
            "Publication dates, retrieval dates, targets and physical milestones stay separate. Raw response hashes remain original; gzip text derivatives are retained separately."
          ],
          "sources": [
            {
              "url": "https://cologix.com/data-centers/minneapolis/",
              "host": "cologix.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party exact code or campus text, scoped provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Minneapolis · Hennepin · Source context reviewed",
      "status_scope": "Cologix lists current colocation and cloud interconnection at MIN5 within the 511 Building. This supports a service phase within the existing MIN1 to MIN5 campus record, not certification that every advertised hall or capacity is energized. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "connect-data-centers-eagan-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Connect Data Centers - Eagan (powered by Oppidan)",
      "group": "building",
      "status": "Reported construction",
      "raw_status": "under construction",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Dakota"
      ],
      "city": "Eagan",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Oppidan Eagan build-to-suit groundbreaking. Year-onlycompletionforecastnotobservedopening. Onlytwoground-upactiveMinnesotaprojectsclaimishistoricaldeveloperstatementnotcurrentstatewidecensus. No numericITMW, tenantname, signedleaseorparcel. Excelsiorheadquartersnotfacility. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2025-06-05",
          "Oppidan published its June 5, 2025 account of the Connect Eagan groundbreaking and described the ground up project as underway. This dates issuer publication and reported construction context, not an independently established first work day, completion or commissioned computing."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://oppidan.com/blog/connect-data-centers-powered-by-oppidan-breaks-ground-on-new-data-center-in-eagan",
          "host": "oppidan.com",
          "date": "2025-06-05",
          "published": "2025-06-05",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 44.68723,
        "lng": -93.08184,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round10-2026-10-14.json",
          "scope": "Oppidan Eagan build-to-suit groundbreaking",
          "fields": {
            "developer": "Oppidan",
            "project": "Connect Data Centers Eagan",
            "groundbreaking_announcement_date": "2025-06-05",
            "planned_area_sqft": 61000,
            "site_description": "Argenta Trail, south of YMCA, Eagan, Minnesota",
            "developer_role": "landlord financing and developing build-to-suit with unnamed tenant",
            "expected_completion_year": 2026
          },
          "notes": [
            "Year-onlycompletionforecastnotobservedopening. Onlytwoground-upactiveMinnesotaprojectsclaimishistoricaldeveloperstatementnotcurrentstatewidecensus. No numericITMW, tenantname, signedleaseorparcel. Excelsiorheadquartersnotfacility.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://oppidan.com/blog/connect-data-centers-powered-by-oppidan-breaks-ground-on-new-data-center-in-eagan",
              "host": "oppidan.com",
              "date": "2025-06-05",
              "published": "2025-06-05",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The original June 5, 2025 Oppidan release reports breaking ground at the named Connect data center project on Argenta Trail in Eagan and explicitly describes ground up projects currently underway. This supports reported construction within the issuer account as of that publication. Its target completion in 2026 is not an accomplished opening. The ceremony and release date are not independently certified as the first day of physical work. The source describes financing, landlord and development relationships, which are not converted into a new computing operator role. Expected community benefits and quantities are not promoted.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "original_issuer_reports_named_project_underway",
              "scope": "The original June 5, 2025 Oppidan release reports breaking ground at the named Connect data center project on Argenta Trail in Eagan and explicitly describes ground up projects currently underway. This supports reported construction within the issuer account as of that publication. Its target completion in 2026 is not an accomplished opening. The ceremony and release date are not independently certified as the first day of physical work. The source describes financing, landlord and development relationships, which are not converted into a new computing operator role. Expected community benefits and quantities are not promoted."
            },
            "source_read_scope": {
              "original_dated_issuer_release_main_body_read": true,
              "ground_up_currently_underway_language_read": true,
              "target2026_not_actual_completion": true,
              "landlord_developer_not_promoted_to_computing_operator": true,
              "no_quantity_or_role_export": true
            }
          },
          "notes": [
            "The original June 5, 2025 Oppidan release reports breaking ground at the named Connect data center project on Argenta Trail in Eagan and explicitly describes ground up projects currently underway. This supports reported construction within the issuer account as of that publication. Its target completion in 2026 is not an accomplished opening. The ceremony and release date are not independently certified as the first day of physical work. The source describes financing, landlord and development relationships, which are not converted into a new computing operator role. Expected community benefits and quantities are not promoted.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://oppidan.com/blog/connect-data-centers-powered-by-oppidan-breaks-ground-on-new-data-center-in-eagan",
              "host": "oppidan.com",
              "published": "2025-06-05",
              "date": "2025-06-05",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Eagan · Dakota · Source context reviewed",
      "status_scope": "The original June 5, 2025 Oppidan release reports breaking ground at the named Connect data center project on Argenta Trail in Eagan and explicitly describes ground up projects currently underway. This supports reported construction within the issuer account as of that publication. Its target completion in 2026 is not an accomplished opening. The ceremony and release date are not independently certified as the first day of physical work. The source describes financing, landlord and development relationships, which are not converted into a new computing operator role. Expected community benefits and quantities are not promoted.",
      "event_evidence": [
        {
          "date": "2025-06-05",
          "text": "Oppidan published its June 5, 2025 account of the Connect Eagan groundbreaking and described the ground up project as underway. This dates issuer publication and reported construction context, not an independently established first work day, completion or commissioned computing.",
          "kind": "announced",
          "sources": [
            {
              "url": "https://oppidan.com/blog/connect-data-centers-powered-by-oppidan-breaks-ground-on-new-data-center-in-eagan",
              "host": "oppidan.com",
              "published": "2025-06-05",
              "date": "2025-06-05",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27037"
      }
    },
    {
      "id": "databank-brooklyn-park-mn",
      "state": "mn",
      "kind": "facility",
      "name": "DataBank Brooklyn Park Campus",
      "group": "operating",
      "status": "Operating phase",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Hennepin"
      ],
      "city": "Brooklyn Park",
      "address": "8111 Oxbow Creek N, Brooklyn Park, MN 55445",
      "who": "DataBank",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "Operator-listed IT capacity. The source does not publish an as-of date; checked 2026-10-15. Metered consumption and utility-service capacity remain separate scopes.",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Catalog marketing establishes identity/specification; independently verify actual commissioning date and utilization. Current operator card explicitly names this facility and separates its specification from the market/campus totals. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. named source. Operator separately labels critical IT and utility feeds. No redundancy arithmetic, energized-load measurement or independent uptime claim. Dated operator assertion, not reviewed DEED certificate or legal verification of current2026tax treatment. Claimed client savings and electricity exemptions need current government law; no incentive value or award disbursement inferred.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.databank.com/data-centers/minneapolis/brooklyn-park-campus/",
          "host": "databank.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.databank.com/resources/press-releases/databank-officially-qualifies-for-minnesota-tax-incentives/",
          "host": "databank.com",
          "date": "2024-10-15",
          "published": "2024-10-15",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://echodata.epa.gov/echo/echo_rest_services.get_facilities?p_ncs=518210&output=JSON&responseset=1000&tablelist=Y&maplist=N&summarylist=Y&qcolumns=1%2C2%2C3%2C4%2C5%2C6%2C7%2C17%2C15%2C19%2C20%2C21%2C23%2C24%2C32%2C97%2C88%2C89%2C90%2C93%2C144%2C106%2C108%2C100",
          "host": "echodata.epa.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-15",
          "label": "EPA registry query"
        },
        {
          "url": "https://gis.hennepin.us/arcgis/rest/services/HennepinData/LAND_PROPERTY/MapServer/1/query?where=HOUSE_NO%3D8111+AND+UPPER%28STREET_NM%29+LIKE+%27%25OXBOW%25%27&outFields=OBJECTID%2CPID%2CPID_TEXT%2CHOUSE_NO%2CFRAC_HOUSE_NO%2CSTREET_NM%2CMUNIC_NM%2CZIP_CD%2CMULTI_ADDR_IND%2CFEATURECODE%2CCONDO_NO&returnGeometry=true&outSR=4326&resultRecordCount=25&f=json",
          "host": "gis.hennepin.us",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "One exact public county or assessor reference parcel"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-93.39038759950223%2C45.14045591088753%2C-93.38147240049777%2C45.14674408911247&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Actually viewed setting only, acquisition date unknown"
        },
        {
          "url": "https://gis.hennepin.us/arcgis/rest/services/HennepinData/LAND_PROPERTY/MapServer/1?f=pjson",
          "host": "gis.hennepin.us",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Official reference parcel field definitions and attribution"
        }
      ],
      "loc": {
        "lng": -93.38593,
        "lat": 45.1436,
        "precision": "approximate",
        "basis": "Approximate reference parcel center for DataBank service address 8111 Oxbow Creek N, Brooklyn Park, MN 55445. Official reference 0611921410009 only, not a roof, surveyed title, tenant unit or full campus. Aerial acquisition date is unknown and may predate construction. Existing native status remains operating."
      },
      "reviewed_evidence": [
        {
          "overlay": "field-verification-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "facility_code": "MSP3",
            "street": "8111 Oxbow Creek N",
            "city": "Brooklyn Park",
            "critical_it_capacity_mw": 9,
            "it_area_sqft": 82231,
            "power_basis": "operator advertised criticalIT specification, not measured consumption",
            "marketed_service": "colocation"
          },
          "notes": [
            "Catalog marketing establishes identity/specification; independently verify actual commissioning date and utilization.",
            "Current operator card explicitly names this facility and separates its specification from the market/campus totals.",
            "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/brooklyn-park-campus/",
              "host": "databank.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "databank-equinix-review-round5-2026-10-14.json",
          "scope": "named source",
          "fields": {
            "operator_site_code": "MSP3",
            "published_address": "8111 Oxbow Creek N, Brooklyn Park, MN55445",
            "campus_acres": 14,
            "it_area_sqft": 82231,
            "critical_it_mw": 9,
            "utility_feeds": {
              "count": 2,
              "mw_each": 4.5,
              "utility": "Xcel Energy"
            }
          },
          "notes": [
            "Operator separately labels critical IT and utility feeds. No redundancy arithmetic, energized-load measurement or independent uptime claim.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/brooklyn-park-campus/",
              "host": "databank.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "databank-equinix-review-round5-2026-10-14.json",
          "scope": "named source",
          "fields": {
            "historical_operator_statement": "MSP3 certified by Minnesota DEED; joins MSP2",
            "historical_msp3_opening_year": 2021
          },
          "notes": [
            "Dated operator assertion, not reviewed DEED certificate or legal verification of current2026tax treatment. Claimed client savings and electricity exemptions need current government law; no incentive value or award disbursement inferred.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/resources/press-releases/databank-officially-qualifies-for-minnesota-tax-incentives/",
              "host": "databank.com",
              "date": "2024-10-15",
              "published": "2024-10-15",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "S1-EPA-operator-followup-20261015",
          "scope": "Existing MSP3 component of the Brooklyn Park campus; expansion land remains separate.",
          "fields": {
            "current_status": "partly operating",
            "operator_published_address": "8111 Oxbow Creek N, Brooklyn Park, MN 55445",
            "operator_listed_critical_it_mw": 9,
            "epa_frs_registry_id": "110070945564",
            "epa_reported_address": "8111 OXBOW CREEK N, BROOKLYN PARK, MN"
          },
          "notes": [
            "The operator describes one existing data center and room to expand. Its MSP4 reference is a separate downtown Minneapolis carrier hotel, not another Brooklyn Park building. The 9 MW catalog figure is not a metered usage reading; source publication/as-of date is not established. No precise parcel adopted."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/brooklyn-park-campus/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-15",
              "label": "Reviewed operator listing"
            },
            {
              "url": "https://echodata.epa.gov/echo/echo_rest_services.get_facilities?p_ncs=518210&output=JSON&responseset=1000&tablelist=Y&maplist=N&summarylist=Y&qcolumns=1%2C2%2C3%2C4%2C5%2C6%2C7%2C17%2C15%2C19%2C20%2C21%2C23%2C24%2C32%2C97%2C88%2C89%2C90%2C93%2C144%2C106%2C108%2C100",
              "host": "echodata.epa.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-15",
              "label": "EPA registry query"
            }
          ],
          "checked": "2026-10-15",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 27, October 23, 2026",
          "scope": "Approximate remains approximate. One bounded official reference parcel only. Existing native status remains operating.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -93.38593,
                "lat": 45.1436,
                "precision": "approximate",
                "basis": "Approximate reference parcel center for DataBank service address 8111 Oxbow Creek N, Brooklyn Park, MN 55445. Official reference 0611921410009 only, not a roof, surveyed title, tenant unit or full campus. Aerial acquisition date is unknown and may predate construction. Existing native status remains operating."
              },
              "reference_method": "Approximate county reference parcel center",
              "reference_parcel": {
                "identifier": "0611921410009",
                "identifier_field": "PID",
                "objectid": 72092,
                "agency": "Hennepin County GIS Office, Survey Division and Real Estate Services",
                "reference_method": "calculated_polygon_centroid",
                "not_survey_quality": true,
                "legal_title_verified": false,
                "independent_building_identity": false,
                "full_campus_verified": false,
                "operator_ownership_verified": false,
                "published_street_type_omitted": true
              },
              "operator_coordinates_adopted": false,
              "census_range_adopted": false
            }
          },
          "notes": [
            "This is one explicitly reviewed approximate tax or fee reference parcel, not a surveyed roof, legal title, property ownership, tenant unit, independent building or complete campus boundary.",
            "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. No current operation, construction, technical quantity or physical milestone is adopted from the location evidence.",
            "Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. No residential roof is selected. Raw parcel geometry is not exported.",
            "The current named operator Brooklyn Park campus section lists its MSP3 service address as 8111 Oxbow Creek N. The single exact Hennepin feature gives 8111 Oxbow Creek Drive North in Brooklyn Park, postal 55445, PID 0611921410009. County raw trailing spaces remain unchanged. Drive is supplied by the authoritative county situs; no independent roof, new code mapping, future hall or complete campus boundary is certified. The agency describes monthly compilation and potentially stacked identical geometries with different tax IDs, which is retained as a reference limit.",
            "The inherited Compute Atlas point is an unreviewed general area, not an earlier accepted parcel or service street. The current named DataBank Brooklyn Park campus section gives MSP3 at 8111 Oxbow Creek N. Exactly one Hennepin county feature gives 8111 Oxbow Creek Drive North, Brooklyn Park, ZIP 55445, PID 0611921410009. Its approximate mathematical center is inside that source polygon and retained Hennepin County, 3069.0 metres from the inherited point. Viewed imagery shows open or development ground beside industrial forms and may predate campus construction. No independent hall, full campus, legal title or construction milestone is certified."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/brooklyn-park-campus/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current named operator service address section"
            },
            {
              "url": "https://gis.hennepin.us/arcgis/rest/services/HennepinData/LAND_PROPERTY/MapServer/1/query?where=HOUSE_NO%3D8111+AND+UPPER%28STREET_NM%29+LIKE+%27%25OXBOW%25%27&outFields=OBJECTID%2CPID%2CPID_TEXT%2CHOUSE_NO%2CFRAC_HOUSE_NO%2CSTREET_NM%2CMUNIC_NM%2CZIP_CD%2CMULTI_ADDR_IND%2CFEATURECODE%2CCONDO_NO&returnGeometry=true&outSR=4326&resultRecordCount=25&f=json",
              "host": "gis.hennepin.us",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "One exact public county or assessor reference parcel"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-93.39038759950223%2C45.14045591088753%2C-93.38147240049777%2C45.14674408911247&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Actually viewed setting only, acquisition date unknown"
            },
            {
              "url": "https://gis.hennepin.us/arcgis/rest/services/HennepinData/LAND_PROPERTY/MapServer/1?f=pjson",
              "host": "gis.hennepin.us",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Official reference parcel field definitions and attribution"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 34, October 23, 2026",
          "scope": "DataBank identifies the same named Brooklyn Park Campus in its own source. The page identifies MSP3 as the campus anchor and separately identifies downtown MSP4. Neither that downtown facility nor its output is reassigned to this campus. This review records the DataBank brand relationship, without establishing legal title, sole control or a distinct legal entity. Existing status, location, address, county, quantities, dates and component identity remain exact. Undated source publication dates remain unknown.",
          "fields": {
            "company_association": {
              "name": "DataBank",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "DataBank identifies the same named Brooklyn Park Campus in its own source. The page identifies MSP3 as the campus anchor and separately identifies downtown MSP4. Neither that downtown facility nor its output is reassigned to this campus. This review records the DataBank brand relationship, without establishing legal title, sole control or a distinct legal entity. Existing status, location, address, county, quantities, dates and component identity remain exact. Undated source publication dates remain unknown."
            },
            "provider_role": "operator"
          },
          "notes": [
            "DataBank identifies the same named Brooklyn Park Campus in its own source. The page identifies MSP3 as the campus anchor and separately identifies downtown MSP4. Neither that downtown facility nor its output is reassigned to this campus. This review records the DataBank brand relationship, without establishing legal title, sole control or a distinct legal entity. Existing status, location, address, county, quantities, dates and component identity remain exact. Undated source publication dates remain unknown."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/brooklyn-park-campus/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Approximate reference parcel, not a surveyed building or full campus",
      "summary": "Brooklyn Park · Hennepin · Source context reviewed",
      "status_scope": "Existing MSP3 component of the Brooklyn Park campus; expansion land remains separate.",
      "typed_power_facts": [
        {
          "measure": "it_capacity",
          "value": 9,
          "unit": "MW",
          "as_of": null,
          "as_of_basis": "not_published",
          "observed_on": "2026-10-15",
          "basis": "operator_reported_capacity",
          "scope": "Operator-listed critical IT service specification for this named building/component. This is not a metered usage reading.",
          "sources": [
            "https://www.databank.com/data-centers/minneapolis/brooklyn-park-campus/"
          ]
        }
      ]
    },
    {
      "id": "databank-downtown-minneapolis-msp4-mn",
      "state": "mn",
      "kind": "facility",
      "name": "DataBank Downtown Minneapolis Data Center (MSP4)",
      "group": "operating",
      "status": "Operator-listed service",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Colocation",
      "counties": [
        "Hennepin"
      ],
      "city": "Minneapolis",
      "address": "511 11th Avenue S - Minneapolis, MN 55145",
      "who": "DataBank",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "Operator-listed Critical IT Load for this facility code. The technical as-of date is not published. Advertised/design capacity does not establish current consumption, utilization or all phases energized.",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Catalog marketing establishes identity/specification; independently verify actual commissioning date and utilization. Carrier-hotel tenant suite; group with building, not whole-building metrics. Current operator card explicitly names this facility and separates its specification from the market/campus totals. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.databank.com/data-centers/minneapolis/",
          "host": "databank.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.databank.com/data-centers/minneapolis/511-11th-avenue/",
          "host": "www.databank.com",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "DataBank current facility or company statement"
        },
        {
          "url": "https://www.databank.com/data-centers/",
          "host": "www.databank.com",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "DataBank current facility or company statement"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=511+11th+Avenue+S%2C+Minneapolis%2C+MN+55145&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://storage.pardot.com/1103952/1786640584nuzUfCIf/MSP4_datasheet.pdf",
          "host": "storage.pardot.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "DataBank current facility datasheet, page 1 address"
        },
        {
          "url": "https://go.databank.com/l/1103952/2026-02-18/8z656n/1103952/1771463711hLPuRfEg/MSP4_datasheet.pdf",
          "host": "go.databank.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Official datasheet PDF embed wrapper"
        }
      ],
      "loc": {
        "lat": 44.972378841882,
        "lng": -93.255587760133,
        "precision": "address",
        "basis": "Published DataBank facility datasheet address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "field-verification-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "facility_code": "MSP4",
            "street": "511 11th Avenue S",
            "city": "Minneapolis",
            "critical_it_capacity_mw": 0.779,
            "it_area_sqft": 8170,
            "power_basis": "operator advertised criticalIT specification, not measured consumption",
            "marketed_service": "colocation"
          },
          "notes": [
            "Catalog marketing establishes identity/specification; independently verify actual commissioning date and utilization.",
            "Carrier-hotel tenant suite; group with building, not whole-building metrics.",
            "Current operator card explicitly names this facility and separates its specification from the market/campus totals.",
            "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/",
              "host": "databank.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "S4-DataBank-Existing-Depth-20261016",
          "scope": "Targeted existing-record DataBank code/service or project-stage, published-address and typed IT-capacity review. No admission, geocoding, physical-site certification or legal ownership finding.",
          "fields": {
            "operator_facility_code": "MSP4",
            "record_association_scope": "Existing research record associated by its DataBank facility code, state and named locality with the current operator page. The address is published service context, not independent parcel, municipal, ownership or physical-building identity verification.",
            "published_location_address": {
              "address": "511 11th Avenue S - Minneapolis, MN 55145",
              "scope": "Operator location heading as printed, including suite and postal text. No geocoding or point movement."
            },
            "published_technical_specs": {
              "IT Square Feet": "8,170",
              "Critical IT Load": "0.779MW",
              "Power Design": "2N",
              "Cooling Design": "N+1",
              "Cab Density Air": "10kW+"
            },
            "technical_capacity_scope": "Critical IT Load is the named-code operator-listed capacity, not utility service, backup generation, current metered use or proof every advertised MW is energized. The page does not establish a technical as-of date. Floor area is labeled IT Square Feet, not gross building area; power/cooling designs and cabinet densities are descriptions, not water use or total IT demand.",
            "metro_campus_scope": "Metro/campus headline totals and future expansion envelopes are not assigned to this code or added to its capacity. Published street and postal locality do not independently resolve legal jurisdiction. SLA, certification and renewable-energy marketing are not verified operational outcomes.",
            "current_status_basis": "Current operator-listed MSP4 colocation service component, supported by its named facility page and current metro listing. The observation does not certify complete campus buildout, all advertised capacity energized, current availability, ownership or an exact opening day."
          },
          "notes": [
            "Partial field review only. Original name, point/precision, city/county/jurisdiction, opening field and legacy MW/financial values remain unchanged.",
            "Capacity is operator-listed Critical IT Load, not metered consumption or a utility/generator figure. No sum across overlapping code, campus or expansion envelopes is asserted."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/511-11th-avenue/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "DataBank current facility or company statement"
            },
            {
              "url": "https://www.databank.com/data-centers/minneapolis/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "DataBank current facility or company statement"
            },
            {
              "url": "https://www.databank.com/data-centers/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "DataBank current facility or company statement"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 3, October 22, 2026",
          "scope": "Published operator street reference only. No status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 44.972378841882,
                "lng": -93.255587760133,
                "precision": "address",
                "basis": "Published DataBank facility datasheet address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "511 11th Avenue S - Minneapolis, MN 55145",
              "county_fips": [
                "27053"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The official facility page links the retained PDF through its public PDF embed. The datasheet names the existing facility code and service address. Only address presentation punctuation is normalized for comparison; the canonical address remains unchanged.",
            "The datasheet version is retained as printed. No exact publication day is inferred from its quarter or version. Capacity, technical figures, source photographs and certifications are not adopted in this location review.",
            "Floors and suites remain address context. The Census reference is not a building, parcel boundary, legal title or exclusive occupancy finding. The response county and retained Census county geometry agree.",
            "The operator publishes ZIP 55145, while Census returns 55415 for the same numbered street and city. The source address is preserved. Postal equivalence is not asserted."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/511-11th-avenue/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "DataBank official facility page and datasheet link"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=511+11th+Avenue+S%2C+Minneapolis%2C+MN+55145&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://storage.pardot.com/1103952/1786640584nuzUfCIf/MSP4_datasheet.pdf",
              "host": "storage.pardot.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "DataBank current facility datasheet, page 1 address"
            },
            {
              "url": "https://go.databank.com/l/1103952/2026-02-18/8z656n/1103952/1771463711hLPuRfEg/MSP4_datasheet.pdf",
              "host": "go.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Official datasheet PDF embed wrapper"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 33, October 23, 2026",
          "scope": "DataBank identifies the same named MSP4 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown.",
          "fields": {
            "company_association": {
              "name": "DataBank",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "DataBank identifies the same named MSP4 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown."
            },
            "provider_role": "operator"
          },
          "notes": [
            "DataBank identifies the same named MSP4 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/511-11th-avenue/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Minneapolis · Hennepin · Source context reviewed",
      "status_scope": "Current operator-listed MSP4 colocation service component, supported by its named facility page and current metro listing. The observation does not certify complete campus buildout, all advertised capacity energized, current availability, ownership or an exact opening day.",
      "typed_power_facts": [
        {
          "measure": "it_capacity",
          "value": 0.779,
          "unit": "MW",
          "as_of": null,
          "as_of_basis": "not_published",
          "observed_on": "2026-10-16",
          "basis": "operator_reported_capacity",
          "scope": "Current named-code operator-listed Critical IT Load, not utility capacity, backup generation or measured consumption. Technical as-of date and energized/occupied share are not published.",
          "sources": [
            "https://www.databank.com/data-centers/minneapolis/511-11th-avenue/"
          ]
        }
      ]
    },
    {
      "id": "databank-east-twin-cities-eagan-mn",
      "state": "mn",
      "kind": "facility",
      "name": "DataBank East Twin Cities Data Center (MSP2)",
      "group": "operating",
      "status": "Operator-listed service",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Colocation",
      "counties": [
        "Dakota"
      ],
      "city": "Eagan",
      "address": "3255 Neil Armstrong Blvd - Eagan, MN 55121",
      "who": "DataBank",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "Operator-listed Critical IT Load for this facility code. The technical as-of date is not published. Advertised/design capacity does not establish current consumption, utilization or all phases energized.",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Catalog marketing establishes identity/specification; independently verify actual commissioning date and utilization. Current operator card explicitly names this facility and separates its specification from the market/campus totals. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. named source. Dated operator assertion, not reviewed DEED certificate or legal verification of current2026tax treatment. Claimed client savings and electricity exemptions need current government law; no incentive value or award disbursement inferred. Current operator specification; not a measurement or independently reviewed FedRAMP/uptime certification.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.databank.com/data-centers/minneapolis/eagan/",
          "host": "databank.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.databank.com/resources/press-releases/databank-officially-qualifies-for-minnesota-tax-incentives/",
          "host": "databank.com",
          "date": "2024-10-15",
          "published": "2024-10-15",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.databank.com/data-centers/minneapolis/",
          "host": "www.databank.com",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "DataBank current facility or company statement"
        },
        {
          "url": "https://www.databank.com/data-centers/",
          "host": "www.databank.com",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "DataBank current facility or company statement"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3255+Neil+Armstrong+Blvd%2C+Eagan%2C+MN+55121&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://storage.pardot.com/1103952/1786640554O8ovpS6D/MSP2_datasheet.pdf",
          "host": "storage.pardot.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "DataBank current facility datasheet, page 1 address"
        },
        {
          "url": "https://go.databank.com/l/1103952/2026-02-18/8z656k/1103952/17714637118oGZDZAl/MSP2_datasheet.pdf",
          "host": "go.databank.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Official datasheet PDF embed wrapper"
        }
      ],
      "loc": {
        "lat": 44.837518065636,
        "lng": -93.145337864507,
        "precision": "address",
        "basis": "Published DataBank facility datasheet address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "field-verification-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "facility_code": "MSP2",
            "street": "3255 Neil Armstrong Blvd",
            "city": "Eagan",
            "critical_it_capacity_mw": 5,
            "it_area_sqft": 48860,
            "power_basis": "operator advertised criticalIT specification, not measured consumption",
            "marketed_service": "colocation"
          },
          "notes": [
            "Catalog marketing establishes identity/specification; independently verify actual commissioning date and utilization.",
            "Current operator card explicitly names this facility and separates its specification from the market/campus totals.",
            "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/eagan/",
              "host": "databank.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "databank-equinix-review-round5-2026-10-14.json",
          "scope": "named source",
          "fields": {
            "historical_operator_statement": "MSP3 certified by Minnesota DEED; joins MSP2",
            "historical_msp3_opening_year": 2021
          },
          "notes": [
            "Dated operator assertion, not reviewed DEED certificate or legal verification of current2026tax treatment. Claimed client savings and electricity exemptions need current government law; no incentive value or award disbursement inferred.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/resources/press-releases/databank-officially-qualifies-for-minnesota-tax-incentives/",
              "host": "databank.com",
              "date": "2024-10-15",
              "published": "2024-10-15",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "databank-equinix-review-round5-2026-10-14.json",
          "scope": "named source",
          "fields": {
            "operator_site_code": "MSP2",
            "it_area_sqft": 48860,
            "critical_it_mw": 5
          },
          "notes": [
            "Current operator specification; not a measurement or independently reviewed FedRAMP/uptime certification.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/eagan/",
              "host": "databank.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "S4-DataBank-Existing-Depth-20261016",
          "scope": "Targeted existing-record DataBank code/service or project-stage, published-address and typed IT-capacity review. No admission, geocoding, physical-site certification or legal ownership finding.",
          "fields": {
            "operator_facility_code": "MSP2",
            "record_association_scope": "Existing research record associated by its DataBank facility code, state and named locality with the current operator page. The address is published service context, not independent parcel, municipal, ownership or physical-building identity verification.",
            "published_location_address": {
              "address": "3255 Neil Armstrong Blvd - Eagan, MN 55121",
              "scope": "Operator location heading as printed, including suite and postal text. No geocoding or point movement."
            },
            "published_technical_specs": {
              "IT Square Feet": "48,860",
              "Critical IT Load": "5MW",
              "Power Design": "2N",
              "Cooling Design": "N+1",
              "Cab Density Air": "10kW+"
            },
            "technical_capacity_scope": "Critical IT Load is the named-code operator-listed capacity, not utility service, backup generation, current metered use or proof every advertised MW is energized. The page does not establish a technical as-of date. Floor area is labeled IT Square Feet, not gross building area; power/cooling designs and cabinet densities are descriptions, not water use or total IT demand.",
            "metro_campus_scope": "Metro/campus headline totals and future expansion envelopes are not assigned to this code or added to its capacity. Published street and postal locality do not independently resolve legal jurisdiction. SLA, certification and renewable-energy marketing are not verified operational outcomes.",
            "current_status_basis": "Current operator-listed MSP2 colocation service component, supported by its named facility page and current metro listing. The observation does not certify complete campus buildout, all advertised capacity energized, current availability, ownership or an exact opening day."
          },
          "notes": [
            "Partial field review only. Original name, point/precision, city/county/jurisdiction, opening field and legacy MW/financial values remain unchanged.",
            "Capacity is operator-listed Critical IT Load, not metered consumption or a utility/generator figure. No sum across overlapping code, campus or expansion envelopes is asserted."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/eagan/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "DataBank current facility or company statement"
            },
            {
              "url": "https://www.databank.com/data-centers/minneapolis/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "DataBank current facility or company statement"
            },
            {
              "url": "https://www.databank.com/data-centers/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "DataBank current facility or company statement"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 3, October 22, 2026",
          "scope": "Published operator street reference only. No status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 44.837518065636,
                "lng": -93.145337864507,
                "precision": "address",
                "basis": "Published DataBank facility datasheet address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "3255 Neil Armstrong Blvd - Eagan, MN 55121",
              "county_fips": [
                "27037"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The official facility page links the retained PDF through its public PDF embed. The datasheet names the existing facility code and service address. Only address presentation punctuation is normalized for comparison; the canonical address remains unchanged.",
            "The datasheet version is retained as printed. No exact publication day is inferred from its quarter or version. Capacity, technical figures, source photographs and certifications are not adopted in this location review.",
            "Floors and suites remain address context. The Census reference is not a building, parcel boundary, legal title or exclusive occupancy finding. The response county and retained Census county geometry agree."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/eagan/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "DataBank official facility page and datasheet link"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3255+Neil+Armstrong+Blvd%2C+Eagan%2C+MN+55121&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://storage.pardot.com/1103952/1786640554O8ovpS6D/MSP2_datasheet.pdf",
              "host": "storage.pardot.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "DataBank current facility datasheet, page 1 address"
            },
            {
              "url": "https://go.databank.com/l/1103952/2026-02-18/8z656k/1103952/17714637118oGZDZAl/MSP2_datasheet.pdf",
              "host": "go.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Official datasheet PDF embed wrapper"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 33, October 23, 2026",
          "scope": "DataBank identifies the same named MSP2 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown.",
          "fields": {
            "company_association": {
              "name": "DataBank",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "DataBank identifies the same named MSP2 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown."
            },
            "provider_role": "operator"
          },
          "notes": [
            "DataBank identifies the same named MSP2 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/eagan/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Eagan · Dakota · Source context reviewed",
      "status_scope": "Current operator-listed MSP2 colocation service component, supported by its named facility page and current metro listing. The observation does not certify complete campus buildout, all advertised capacity energized, current availability, ownership or an exact opening day.",
      "typed_power_facts": [
        {
          "measure": "it_capacity",
          "value": 5,
          "unit": "MW",
          "as_of": null,
          "as_of_basis": "not_published",
          "observed_on": "2026-10-16",
          "basis": "operator_reported_capacity",
          "scope": "Current named-code operator-listed Critical IT Load, not utility capacity, backup generation or measured consumption. Technical as-of date and energized/occupied share are not published.",
          "sources": [
            "https://www.databank.com/data-centers/minneapolis/eagan/"
          ]
        }
      ]
    },
    {
      "id": "databank-west-twin-cities-edina-mn",
      "state": "mn",
      "kind": "facility",
      "name": "DataBank West Twin Cities Data Center (MSP1)",
      "group": "operating",
      "status": "Operator-listed service",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Colocation",
      "counties": [
        "Hennepin"
      ],
      "city": "Edina",
      "address": "7700 France Ave S - Edina, MN 55435",
      "who": "DataBank",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "Operator-listed Critical IT Load for this facility code. The technical as-of date is not published. Advertised/design capacity does not establish current consumption, utilization or all phases energized.",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Catalog marketing establishes identity/specification; independently verify actual commissioning date and utilization. Current operator card explicitly names this facility and separates its specification from the market/campus totals. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.databank.com/data-centers/minneapolis/",
          "host": "databank.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.databank.com/data-centers/minneapolis/edina/",
          "host": "www.databank.com",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "DataBank current facility or company statement"
        },
        {
          "url": "https://www.databank.com/data-centers/",
          "host": "www.databank.com",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "DataBank current facility or company statement"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=7700+France+Ave+S%2C+Edina%2C+MN+55435&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://storage.pardot.com/1103952/1786640535AbLkwihE/MSP1_datasheet.pdf",
          "host": "storage.pardot.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "DataBank current facility datasheet, page 1 address"
        },
        {
          "url": "https://go.databank.com/l/1103952/2026-02-18/8z656g/1103952/1771463710ADP5jwKy/MSP1_datasheet.pdf",
          "host": "go.databank.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Official datasheet PDF embed wrapper"
        }
      ],
      "loc": {
        "lat": 44.863354540032,
        "lng": -93.329013866712,
        "precision": "address",
        "basis": "Published DataBank facility datasheet address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "field-verification-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "facility_code": "MSP1",
            "street": "7700 FranceAveS",
            "city": "Edina",
            "critical_it_capacity_mw": 1.35,
            "it_area_sqft": 26240,
            "power_basis": "operator advertised criticalIT specification, not measured consumption",
            "marketed_service": "colocation"
          },
          "notes": [
            "Catalog marketing establishes identity/specification; independently verify actual commissioning date and utilization.",
            "Current operator card explicitly names this facility and separates its specification from the market/campus totals.",
            "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/",
              "host": "databank.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "S4-DataBank-Existing-Depth-20261016",
          "scope": "Targeted existing-record DataBank code/service or project-stage, published-address and typed IT-capacity review. No admission, geocoding, physical-site certification or legal ownership finding.",
          "fields": {
            "operator_facility_code": "MSP1",
            "record_association_scope": "Existing research record associated by its DataBank facility code, state and named locality with the current operator page. The address is published service context, not independent parcel, municipal, ownership or physical-building identity verification.",
            "published_location_address": {
              "address": "7700 France Ave S - Edina, MN 55435",
              "scope": "Operator location heading as printed, including suite and postal text. No geocoding or point movement."
            },
            "published_technical_specs": {
              "IT Square Feet": "26,240",
              "Critical IT Load": "1.35MW",
              "Power Design": "N+1",
              "Cooling Design": "N+1",
              "Cab Density Air": "10kW+",
              "Cab Density Liquid": "25kW+"
            },
            "technical_capacity_scope": "Critical IT Load is the named-code operator-listed capacity, not utility service, backup generation, current metered use or proof every advertised MW is energized. The page does not establish a technical as-of date. Floor area is labeled IT Square Feet, not gross building area; power/cooling designs and cabinet densities are descriptions, not water use or total IT demand.",
            "metro_campus_scope": "Metro/campus headline totals and future expansion envelopes are not assigned to this code or added to its capacity. Published street and postal locality do not independently resolve legal jurisdiction. SLA, certification and renewable-energy marketing are not verified operational outcomes.",
            "current_status_basis": "Current operator-listed MSP1 colocation service component, supported by its named facility page and current metro listing. The observation does not certify complete campus buildout, all advertised capacity energized, current availability, ownership or an exact opening day."
          },
          "notes": [
            "Partial field review only. Original name, point/precision, city/county/jurisdiction, opening field and legacy MW/financial values remain unchanged.",
            "Capacity is operator-listed Critical IT Load, not metered consumption or a utility/generator figure. No sum across overlapping code, campus or expansion envelopes is asserted."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/edina/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "DataBank current facility or company statement"
            },
            {
              "url": "https://www.databank.com/data-centers/minneapolis/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "DataBank current facility or company statement"
            },
            {
              "url": "https://www.databank.com/data-centers/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "DataBank current facility or company statement"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 3, October 22, 2026",
          "scope": "Published operator street reference only. No status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 44.863354540032,
                "lng": -93.329013866712,
                "precision": "address",
                "basis": "Published DataBank facility datasheet address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "7700 France Ave S - Edina, MN 55435",
              "county_fips": [
                "27053"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The official facility page links the retained PDF through its public PDF embed. The datasheet names the existing facility code and service address. Only address presentation punctuation is normalized for comparison; the canonical address remains unchanged.",
            "The datasheet version is retained as printed. No exact publication day is inferred from its quarter or version. Capacity, technical figures, source photographs and certifications are not adopted in this location review.",
            "Floors and suites remain address context. The Census reference is not a building, parcel boundary, legal title or exclusive occupancy finding. The response county and retained Census county geometry agree."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/edina/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "DataBank official facility page and datasheet link"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=7700+France+Ave+S%2C+Edina%2C+MN+55435&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://storage.pardot.com/1103952/1786640535AbLkwihE/MSP1_datasheet.pdf",
              "host": "storage.pardot.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "DataBank current facility datasheet, page 1 address"
            },
            {
              "url": "https://go.databank.com/l/1103952/2026-02-18/8z656g/1103952/1771463710ADP5jwKy/MSP1_datasheet.pdf",
              "host": "go.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Official datasheet PDF embed wrapper"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 33, October 23, 2026",
          "scope": "DataBank identifies the same named MSP1 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown.",
          "fields": {
            "company_association": {
              "name": "DataBank",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "DataBank identifies the same named MSP1 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown."
            },
            "provider_role": "operator"
          },
          "notes": [
            "DataBank identifies the same named MSP1 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown."
          ],
          "sources": [
            {
              "url": "https://www.databank.com/data-centers/minneapolis/edina/",
              "host": "www.databank.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Edina · Hennepin · Source context reviewed",
      "status_scope": "Current operator-listed MSP1 colocation service component, supported by its named facility page and current metro listing. The observation does not certify complete campus buildout, all advertised capacity energized, current availability, ownership or an exact opening day.",
      "typed_power_facts": [
        {
          "measure": "it_capacity",
          "value": 1.35,
          "unit": "MW",
          "as_of": null,
          "as_of_basis": "not_published",
          "observed_on": "2026-10-16",
          "basis": "operator_reported_capacity",
          "scope": "Current named-code operator-listed Critical IT Load, not utility capacity, backup generation or measured consumption. Technical as-of date and energized/occupied share are not published.",
          "sources": [
            "https://www.databank.com/data-centers/minneapolis/edina/"
          ]
        }
      ]
    },
    {
      "id": "edgeconnex-msp01-eden-prairie-mn",
      "state": "mn",
      "kind": "facility",
      "name": "EdgeConneX Minneapolis (EDCMSP01)",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Hennepin"
      ],
      "city": "Eden Prairie",
      "address": "",
      "who": "EdgeConneX",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. PDFpage2visuallyreviewed.2.85MWscalableincludes1.35notextra. PDFvisiblysaysSOC2Type10; certificationclaimquarantinedratherthansilentlycorrectedtoType2. Noindependentcurrentcertificate. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.edgeconnex.com/wp-content/uploads/2024/09/Minneapolis-Data-Sheet.pdf",
          "host": "edgeconnex.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.edgeconnex.com/locations/americas/minneapolis-mn/",
          "host": "www.edgeconnex.com",
          "published": "",
          "date": "",
          "checked": "2026-10-19",
          "label": "Operator source for the qualified stage"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=6875+Shady+Oak+Road%2C+Eden+Prairie%2C+MN+55344&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Complete unique literal published street range, with unchanged raw response"
        },
        {
          "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-93.41199950213495%2C44.87397928853755%2C-93.39805449786506%2C44.883860711462454&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
          "host": "imagery.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Actually viewed source setting, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -93.405027,
        "lat": 44.87892,
        "precision": "address",
        "basis": "The original EdgeConneX MSP01 data sheet prints 6875 Shady Oak Road, Eden Prairie, MN 55344. One complete unique literal Census street range gives a calculated reference inside Hennepin County. No particular roof, tenant floor, surveyed title or complete campus is selected. Imagery acquisition date is unknown and may predate construction."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "operator_site_code": "MSP01",
            "published_address": "6875 Shady Oak Road, Eden Prairie, MN55344",
            "facility_area_sqft": 32738,
            "raised_floor_sqft": 14935,
            "advertised_power_mw": 1.35,
            "scalable_power_mw": 2.85,
            "power_basis": "N+1power, not explicitlycriticalIT"
          },
          "notes": [
            "PDFpage2visuallyreviewed.2.85MWscalableincludes1.35notextra. PDFvisiblysaysSOC2Type10; certificationclaimquarantinedratherthansilentlycorrectedtoType2. Noindependentcurrentcertificate.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.edgeconnex.com/wp-content/uploads/2024/09/Minneapolis-Data-Sheet.pdf",
              "host": "edgeconnex.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "EdgeConneX lists current colocation, tenant facilities and interconnection for its specifically named MSP01 facility in the Minneapolis market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "EdgeConneX lists current colocation, tenant facilities and interconnection for its specifically named MSP01 facility in the Minneapolis market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "EdgeConneX lists current colocation, tenant facilities and interconnection for its specifically named MSP01 facility in the Minneapolis market."
          ],
          "sources": [
            {
              "url": "https://www.edgeconnex.com/locations/americas/minneapolis-mn/",
              "host": "www.edgeconnex.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check24, October23,2026",
          "scope": "EdgeConneX names this facility or the retained campus components on its current website and offers colocation and facility services there. Operator per source is the attributed provider brand relationship only, not a finding of the legal operating entity or property title. No physical status, coordinates, street address, quantity, cooling volume, air permit, certification, measured reliability, environmental compliance, tenant identity or completed expansion is adopted. First publication dates remain unknown; retrieval does not establish a physical opening date. The current page explicitly names MSP01. The existing record name EDCMSP01 is retained without creating a legal alias, new component or point.",
          "fields": {
            "company_association": {
              "name": "EdgeConneX",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "EdgeConneX names this facility or the retained campus components on its current website and offers colocation and facility services there. Operator per source is the attributed provider brand relationship only, not a finding of the legal operating entity or property title. No physical status, coordinates, street address, quantity, cooling volume, air permit, certification, measured reliability, environmental compliance, tenant identity or completed expansion is adopted. First publication dates remain unknown; retrieval does not establish a physical opening date. The current page explicitly names MSP01. The existing record name EDCMSP01 is retained without creating a legal alias, new component or point."
            },
            "provider_role": "operator"
          },
          "notes": [
            "EdgeConneX names this facility or the retained campus components on its current website and offers colocation and facility services there. Operator per source is the attributed provider brand relationship only, not a finding of the legal operating entity or property title. No physical status, coordinates, street address, quantity, cooling volume, air permit, certification, measured reliability, environmental compliance, tenant identity or completed expansion is adopted. First publication dates remain unknown; retrieval does not establish a physical opening date. The current page explicitly names MSP01. The existing record name EDCMSP01 is retained without creating a legal alias, new component or point."
          ],
          "sources": [
            {
              "url": "https://www.edgeconnex.com/locations/americas/minneapolis-mn/",
              "host": "www.edgeconnex.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current first party named facility, provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 62, 2026-10-24",
          "scope": "Original operator computing street identity and calculated Census street reference only. The explicit Hawthorne street set remains approximate. Existing Native status and all other facts remain unchanged. No building footprint, title, technical figure or complete campus is certified.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -93.405027,
                "lat": 44.87892,
                "precision": "address",
                "basis": "The original EdgeConneX MSP01 data sheet prints 6875 Shady Oak Road, Eden Prairie, MN 55344. One complete unique literal Census street range gives a calculated reference inside Hennepin County. No particular roof, tenant floor, surveyed title or complete campus is selected. Imagery acquisition date is unknown and may predate construction."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "6875 Shady Oak Road, Eden Prairie, MN 55344",
              "county_fips": [
                "27053"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "Original operator computing street identity and calculated Census street reference only. The explicit Hawthorne street set remains approximate. Existing Native status and all other facts remain unchanged. No building footprint, title, technical figure or complete campus is certified.",
            "The inherited general area coordinate was not an independently reviewed service street reference. Original operator computing identity and complete unique literal Census street evidence support this bounded reference inside the retained county. The measured inherited point correction is 69.1 metres. All predecessor coordinates and source versions remain in history. Existing operating status and every other fact remain unchanged; no new operation, roof, ownership, tenant floor or complete campus is certified.",
            "The calculated street setting contains commercial or industrial roofs, paved parking and service roads. No individual roof, floor, legal parcel or complete campus is selected."
          ],
          "sources": [
            {
              "url": "https://www.edgeconnex.com/wp-content/uploads/2024/09/Minneapolis-Data-Sheet.pdf",
              "host": "www.edgeconnex.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Original operator data sheet prints the named computing service street, extracted original text"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=6875+Shady+Oak+Road%2C+Eden+Prairie%2C+MN+55344&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Complete unique literal published street range, with unchanged raw response"
            },
            {
              "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-93.41199950213495%2C44.87397928853755%2C-93.39805449786506%2C44.883860711462454&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
              "host": "imagery.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Actually viewed source setting, acquisition date unknown"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Calculated street reference, not a roof or tenant floor",
      "summary": "Eden Prairie · Hennepin · Source context reviewed",
      "status_scope": "EdgeConneX lists current colocation, tenant facilities and interconnection for its specifically named MSP01 facility in the Minneapolis market. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "elk-river-capital-swervo-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Elk River Data Center (Elk River Capital / Swervo Development)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Sherburne"
      ],
      "city": "Elk River",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.. Requested draft one-year moratorium is not an adopted moratorium. August 3 anticipated permit denial not observed in this July article. Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.mprnews.org/story/2026/07/07/elk-river-rejects-changing-rules-to-allow-data-centers",
          "host": "mprnews.org",
          "date": "2026-07-07",
          "published": "2026-07-07",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.elkrivermn.gov/1270/City-Ordinances",
          "host": "www.elkrivermn.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Reviewed government record"
        }
      ],
      "loc": {
        "lat": 45.45482,
        "lng": -93.7867,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-outcomes-review-round20-2026-10-14.json",
          "scope": "Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.",
          "fields": {
            "reported_action_type": "ordinance-amendment-rejected",
            "reported_finding": "MPR reports Elk River rejected ordinance changes needed for Elk River Capital / Swervo project; conditional-use permit decision still expected later.",
            "report_display_date": "2026-07-07",
            "independently_verified_current_status": null
          },
          "notes": [
            "Requested draft one-year moratorium is not an adopted moratorium. August 3 anticipated permit denial not observed in this July article.",
            "Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.mprnews.org/story/2026/07/07/elk-river-rejects-changing-rules-to-allow-data-centers",
              "host": "mprnews.org",
              "date": "2026-07-07",
              "published": "2026-07-07",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The original City ordinance index lists a data center moratorium entry but the full linked instrument was not independently read in this bounded facility review. The selected separate hearing notice path returned HTTP 404. Neither an ordinance index title, a missing notice nor private accounts of a rejected zoning change independently establish the exact inherited Capital and Swervo project crosswalk, present legal disposition or physical computing status. No closure, adoption day or Countywide rule is inferred.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "city_ordinance_index_not_exact_project_stage",
              "scope": "The original City ordinance index lists a data center moratorium entry but the full linked instrument was not independently read in this bounded facility review. The selected separate hearing notice path returned HTTP 404. Neither an ordinance index title, a missing notice nor private accounts of a rejected zoning change independently establish the exact inherited Capital and Swervo project crosswalk, present legal disposition or physical computing status. No closure, adoption day or Countywide rule is inferred."
            },
            "source_read_scope": {
              "city_index_selected_data_center_row_read": true,
              "full_moratorium_instrument_not_read": true,
              "selected_notice404_not_physical_closure": true,
              "exact_project_crosswalk_not_newly_certified": true
            }
          },
          "notes": [
            "The original City ordinance index lists a data center moratorium entry but the full linked instrument was not independently read in this bounded facility review. The selected separate hearing notice path returned HTTP 404. Neither an ordinance index title, a missing notice nor private accounts of a rejected zoning change independently establish the exact inherited Capital and Swervo project crosswalk, present legal disposition or physical computing status. No closure, adoption day or Countywide rule is inferred.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://www.elkrivermn.gov/1270/City-Ordinances",
              "host": "www.elkrivermn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Elk River · Sherburne · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27141"
      }
    },
    {
      "id": "tract-farmington-technology-park-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Farmington Technology Park (Tract)",
      "group": "proposed",
      "status": "Listed proposal",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Dakota"
      ],
      "city": "Farmington",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Farmington city planning chronology and qualified litigation update. City is a litigant; filed dismissals not independently read final court dismissal order. AUAR andpreliminarydevelopment approvals not specific operatingtenant or building occupancy. November13,2025no-specific-application statement not automatically refreshed toOctober14,2026. No currentMWorcapexadopted. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2026-04-20",
          "The City Farmington chronology records April 20, 2026 Council approval of dividing the Technology Park final plat into two additions and of updated development contracts. This dates the recorded planning action, without proving an individual computing building permit, construction start or operation."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.farmingtonmn.gov/473/Data-Center-Farmington-Technology-Park",
          "host": "farmingtonmn.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 44.66408,
        "lng": -93.1097,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "government-primary-review-round7-2026-10-14.json",
          "scope": "Farmington city planning chronology and qualified litigation update",
          "fields": {
            "city_reported_litigation_update_date": "2026-09-16",
            "city_reported_litigation_status": "plaintiffs filed dismissals; final directions from court awaited",
            "published_case_number": "19HA-CV-25-992",
            "city_council_final_auar_adoption_date": "2024-11-04",
            "city_council_preliminary_pud_plat_approval_date": "2024-11-04"
          },
          "notes": [
            "City is a litigant; filed dismissals not independently read final court dismissal order. AUAR andpreliminarydevelopment approvals not specific operatingtenant or building occupancy. November13,2025no-specific-application statement not automatically refreshed toOctober14,2026. No currentMWorcapexadopted.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.farmingtonmn.gov/473/Data-Center-Farmington-Technology-Park",
              "host": "farmingtonmn.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The current original City Farmington Technology Park page identifies Tract and describes planning and development approvals while retaining the statement that no specific development application had been received in its November 2025 update. Its April 20, 2026 chronology records approval of dividing the final plat into two additions and updated development contracts. These are named development planning steps and support a listed proposal, without observed construction or computing service. The September 16, 2026 update reports plaintiffs filed dismissals that await final court directions. Those filings do not independently establish final judgments, resolution of concerns, construction authorization or physical computing closure.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "original_named_development_planning_not_physical_service",
              "scope": "The current original City Farmington Technology Park page identifies Tract and describes planning and development approvals while retaining the statement that no specific development application had been received in its November 2025 update. Its April 20, 2026 chronology records approval of dividing the final plat into two additions and updated development contracts. These are named development planning steps and support a listed proposal, without observed construction or computing service. The September 16, 2026 update reports plaintiffs filed dismissals that await final court directions. Those filings do not independently establish final judgments, resolution of concerns, construction authorization or physical computing closure."
            },
            "source_read_scope": {
              "original_city_current_updates_and_selected_project_chronology_read": true,
              "november2025_no_specific_application_statement_not_undated_current_claim": true,
              "plaintiff_filing_not_final_court_dismissal": true,
              "plat_and_development_contract_not_compute": true
            }
          },
          "notes": [
            "The current original City Farmington Technology Park page identifies Tract and describes planning and development approvals while retaining the statement that no specific development application had been received in its November 2025 update. Its April 20, 2026 chronology records approval of dividing the final plat into two additions and updated development contracts. These are named development planning steps and support a listed proposal, without observed construction or computing service. The September 16, 2026 update reports plaintiffs filed dismissals that await final court directions. Those filings do not independently establish final judgments, resolution of concerns, construction authorization or physical computing closure.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://www.farmingtonmn.gov/473/Data-Center-Farmington-Technology-Park",
              "host": "www.farmingtonmn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Farmington · Dakota · Source context reviewed",
      "status_scope": "The current original City Farmington Technology Park page identifies Tract and describes planning and development approvals while retaining the statement that no specific development application had been received in its November 2025 update. Its April 20, 2026 chronology records approval of dividing the final plat into two additions and updated development contracts. These are named development planning steps and support a listed proposal, without observed construction or computing service. The September 16, 2026 update reports plaintiffs filed dismissals that await final court directions. Those filings do not independently establish final judgments, resolution of concerns, construction authorization or physical computing closure.",
      "event_evidence": [
        {
          "date": "2026-04-20",
          "text": "The City Farmington chronology records April 20, 2026 Council approval of dividing the Technology Park final plat into two additions and of updated development contracts. This dates the recorded planning action, without proving an individual computing building permit, construction start or operation.",
          "kind": "approved",
          "sources": [
            {
              "url": "https://www.farmingtonmn.gov/473/Data-Center-Farmington-Technology-Park",
              "host": "www.farmingtonmn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27037"
      }
    },
    {
      "id": "flexential-minneapolis-chaska-msp01-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Flexential Minneapolis - Chaska (MSP01)",
      "group": "operating",
      "status": "Operator listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Carver"
      ],
      "city": "Chaska",
      "address": "",
      "who": "Flexential",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.. Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396",
          "host": "flexential.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf",
          "host": "www.flexential.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Original issued certificate computing location table, historical street context only"
        },
        {
          "url": "https://www.flexential.com/system/files/file/2021-12/Flexential-2021-PCI-DSS-AOC-Cloud-Operations.pdf",
          "host": "www.flexential.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Original named computing facility list, historical location context only"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3500+Lyman+Boulevard%2C+Chaska%2C+Minnesota+55318&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Complete unique literal published street range, raw version retained"
        },
        {
          "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-93.60637594133648%2C44.84457228853755%2C-93.59243805866352%2C44.854453711462455&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
          "host": "imagery.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Actually viewed source setting, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -93.599407,
        "lat": 44.849513,
        "precision": "address",
        "basis": "Operator facility documents identify 3500 Lyman Boulevard, Chaska, Minnesota 55318. One complete unique Census street range supports this calculated reference inside Carver County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round14-2026-10-14.json",
          "scope": "Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.",
          "fields": {
            "operator_named_facility": "Flexential Minneapolis - Chaska (MSP01)",
            "publisher_reported_footprint_sqft": 160838,
            "publisher_reported_critical_power_mw": 9,
            "power_basis": "operator critical load UPS capacity; Douglasville sections call it critical power",
            "current_measured_demand_mw": null,
            "commissioning_date": null,
            "exact_address_verified_by_this_document": false
          },
          "notes": [
            "Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396",
              "host": "flexential.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 64, 2026-10-24",
          "scope": "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -93.599407,
                "lat": 44.849513,
                "precision": "address",
                "basis": "Operator facility documents identify 3500 Lyman Boulevard, Chaska, Minnesota 55318. One complete unique Census street range supports this calculated reference inside Carver County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "3500 Lyman Boulevard, Chaska, Minnesota 55318",
              "county_fips": [
                "27019"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.",
            "The inherited general area coordinate was not an independently reviewed computing street reference. The original operator published computing location documents and complete unique literal Census street evidence support this bounded reference inside the retained county. The measured correction is 236.8 metres. All original source wordings, dates, predecessor coordinates and versions remain retained. Existing status group unknown and every other fact stay unchanged. This is a reference correction without physical relocation, a new operation, selected roof, tenant floor, legal title or complete campus certification.",
            "Wooded land and ponds lie west of commercial roofs, parking areas and roads with roundabouts. No individual building or current operation is selected."
          ],
          "sources": [
            {
              "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf",
              "host": "www.flexential.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Original issued certificate computing location table, historical street context only"
            },
            {
              "url": "https://www.flexential.com/system/files/file/2021-12/Flexential-2021-PCI-DSS-AOC-Cloud-Operations.pdf",
              "host": "www.flexential.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Original named computing facility list, historical location context only"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3500+Lyman+Boulevard%2C+Chaska%2C+Minnesota+55318&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Complete unique literal published street range, raw version retained"
            },
            {
              "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-93.60637594133648%2C44.84457228853755%2C-93.59243805866352%2C44.854453711462455&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image",
              "host": "imagery.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Actually viewed source setting, acquisition date unknown"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check64, October24,2026",
          "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 44 and 45. The Chaska profile identifies Flexential computing services for this retained location. The body and specification page state different power densities; neither density is adopted or reconciled. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted.",
          "fields": {
            "company_association": {
              "name": "Flexential",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 44 and 45. The Chaska profile identifies Flexential computing services for this retained location. The body and specification page state different power densities; neither density is adopted or reconciled. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Flexential identifies the named location in the original fleet guide, PDF pages 44 and 45. The Chaska profile identifies Flexential computing services for this retained location. The body and specification page state different power densities; neither density is adopted or reconciled. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted."
          ],
          "sources": [
            {
              "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396",
              "host": "www.flexential.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 80",
          "scope": "Selected original fleet guide physical page 44 names the Minneapolis Chaska center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "original_guide_named_minneapolis_chaska_service",
              "scope": "Selected original fleet guide physical page 44 names the Minneapolis Chaska center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged."
            },
            "source_read_scope": {
              "original_owned_raw_guide_and_retrieval_receipt_reused": true,
              "no_new_request_for_denied_market_body": true,
              "original_named_provider_service_text_selected_physical_page": 44,
              "not_entire_102_page_guide_or_maps_read": true,
              "named_center_scope_not_every_inherited_component_code": true,
              "no_capacity_audit_legal_or_uptime_certification": true,
              "no_planned_expansion_or_advertised_inventory_as_completed_phase": true
            }
          },
          "notes": [
            "Selected original fleet guide physical page 44 names the Minneapolis Chaska center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396",
              "host": "www.flexential.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Calculated street reference, not a roof or tenant floor",
      "summary": "Chaska · Carver · Source context reviewed",
      "status_scope": "Selected original fleet guide physical page 44 names the Minneapolis Chaska center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged."
    },
    {
      "id": "google-hermantown-mn",
      "state": "mn",
      "kind": "project",
      "name": "Google Hermantown Data Center",
      "group": "proposed",
      "status": "Service agreement under review",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "St. Louis"
      ],
      "city": "Hermantown",
      "address": "",
      "who": "Google",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Minnesota PUC named ESA index, no final order reviewed. Captured PUCpage says agreement under review, but passed comment deadline not a final decision. Generic statutory annual2to5Mfee is demand-dependent policy, not an awarded/paid site amount. Separate PineIsland EchoZone docket26-170 not Hermantown. No site MW from backup-generation permit thresholds. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://mn.gov/puc/activities/v-l-e-c/data-centers/",
          "host": "mn.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.datacenters.google/locations/",
          "host": "www.datacenters.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Google official location source"
        }
      ],
      "loc": {
        "lat": 47.60297,
        "lng": -92.47061,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "government-primary-review-round7-2026-10-14.json",
          "scope": "Minnesota PUC named ESA index, no final order reviewed",
          "fields": {
            "hermantown_service_applicant": "Harmony Group LLC,Alphabet/Google subsidiary",
            "hermantown_esa_filing_date": "2026-03-26",
            "hermantown_utility_docket": "26-159",
            "hermantown_comment_deadline": "2026-08-28"
          },
          "notes": [
            "Captured PUCpage says agreement under review, but passed comment deadline not a final decision. Generic statutory annual2to5Mfee is demand-dependent policy, not an awarded/paid site amount. Separate PineIsland EchoZone docket26-170 not Hermantown. No site MW from backup-generation permit thresholds.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://mn.gov/puc/activities/v-l-e-c/data-centers/",
              "host": "mn.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "S4-Google-Pending-20261016",
          "scope": "Scoped Google regional identity and lifecycle review; existing approximate points, jurisdiction, legacy totals and opening fields are retained.",
          "fields": {
            "record_association_scope": "Explicit association of the existing named Google Hermantown, Minnesota research context with the primary named location. This does not resolve a parcel, building allocation or distinct physical-site census; inherited project-code aliases are retained rather than independently certified.",
            "electric_service_agreement_review": {
              "utility": "Minnesota Power",
              "named_counterparty": "Harmony Group, LLC",
              "reported_affiliation": "Alphabet/Google subsidiary, as identified by the PUC",
              "docket": "26-159",
              "filed_on": "2026-03-26",
              "status": "Under review on the cited PUC summary",
              "scope": "Public regulatory context only; no legal entity/ownership crosswalk or load figure is inferred."
            },
            "current_status_basis": "The Minnesota PUC currently lists Minnesota Power/Harmony Group LLC’s Hermantown electric service agreement as under review, filed March26,2026. The regulator identifies the Google affiliation. A filed agreement is not PUC approval, a construction permit, an energized facility or commissioned power; the page’s elapsed comment deadline does not prove a decision."
          },
          "notes": [
            "Partial record/field review only. No point movement, exact opening day, commissioned IT capacity, or whole-state freshness certification."
          ],
          "sources": [
            {
              "url": "https://mn.gov/puc/activities/v-l-e-c/data-centers/",
              "host": "mn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Minnesota Public Utilities Commission reviewed primary source"
            },
            {
              "url": "https://www.datacenters.google/locations/",
              "host": "www.datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Google official location source"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Hermantown · St. Louis · Source context reviewed",
      "status_scope": "The Minnesota PUC currently lists Minnesota Power/Harmony Group LLC’s Hermantown electric service agreement as under review, filed March26,2026. The regulator identifies the Google affiliation. A filed agreement is not PUC approval, a construction permit, an energized facility or commissioned power; the page’s elapsed comment deadline does not prove a decision.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27137"
      }
    },
    {
      "id": "google-skyway-pine-island-mn",
      "state": "mn",
      "kind": "project",
      "name": "Google Project Skyway (Pine Island)",
      "group": "approved",
      "status": "Approved phase",
      "raw_status": "approved",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Goodhue"
      ],
      "city": "Pine Island",
      "address": "",
      "who": "Google",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Pine Island land-use approval and conditional municipal subsidy summary. AUAR maximum buildout not current phase.36.5Mconditional reimbursement over28years not cash paid;290jobs assumes9stages. Page conflicts December2025versusDecember2026preliminary dates and April14PUCversusApril15city ESA date; those dates held. City says potential site energy usage unknown. Offsite wind/solar/storage excluded from ITMW; air-cooling design not zero domestic water. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2026-01-20",
          "Pine Island reports initial Project Skyway land-use approvals: rezoning, annexation, final plat/development plan and conditional use permit. Initial phase only; separate electric-service approval, construction and operation are not established."
        ],
        [
          "2026-02-24",
          "Google announced Pine Island as a future data center location and an Xcel Energy partnership. Publication date; not an opening or construction-start milestone."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://pineislandmn.gov/skyway",
          "host": "pineislandmn.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.datacenters.google/locations/",
          "host": "www.datacenters.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Google official location source"
        },
        {
          "url": "https://blog.google/innovation-and-ai/infrastructure-and-cloud/global-network/data-center-pine-island/",
          "host": "blog.google",
          "published": "2026-02-24",
          "date": "2026-02-24",
          "checked": "2026-10-16",
          "label": "Google reviewed primary source"
        },
        {
          "url": "https://mn.gov/puc/activities/v-l-e-c/data-centers/",
          "host": "mn.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Minnesota Public Utilities Commission reviewed primary source"
        }
      ],
      "loc": {
        "lat": 44.40966,
        "lng": -92.72288,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "government-primary-review-round7-2026-10-14.json",
          "scope": "Pine Island land-use approval and conditional municipal subsidy summary",
          "fields": {
            "auar_study_area_acres_approx": 482,
            "city_council_final_land_use_approval_date": "2026-01-20",
            "city_reported_tax_abatement_approval_date": "2026-02-04",
            "city_reported_abatement_total_usd_approx": 36500000,
            "abatement_term_years": 28,
            "first_stage_employment_condition_jobs": 38,
            "city_reported_operator": "Google",
            "utility_docket": "26-170",
            "current_permit_stage_description": "developer pursuing state permits"
          },
          "notes": [
            "AUAR maximum buildout not current phase.36.5Mconditional reimbursement over28years not cash paid;290jobs assumes9stages. Page conflicts December2025versusDecember2026preliminary dates and April14PUCversusApril15city ESA date; those dates held. City says potential site energy usage unknown. Offsite wind/solar/storage excluded from ITMW; air-cooling design not zero domestic water.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://pineislandmn.gov/skyway",
              "host": "pineislandmn.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "S4-Google-Pending-20261016",
          "scope": "Scoped Google regional identity and lifecycle review; existing approximate points, jurisdiction, legacy totals and opening fields are retained.",
          "fields": {
            "record_association_scope": "Explicit association of the existing named Google Pine Island, Minnesota research context with the primary named location. This does not resolve a parcel, building allocation or distinct physical-site census; inherited project-code aliases are retained rather than independently certified.",
            "local_phase_approval": {
              "date": "2026-01-20",
              "scope": "Initial Project Skyway phase; local approvals only",
              "approvals": [
                "rezoning",
                "annexation",
                "final plat",
                "final development plan",
                "conditional use permit"
              ],
              "study_area_is_full_project": false
            },
            "provider_identity_scope": "The city connects Project Skyway with the Google/Xcel development; Google’s dated announcement names Pine Island. PUC lists Xcel/Echo Zone LLC with a Google affiliation. These establish a research association without resolving land ownership or each building.",
            "electric_service_agreement_review": {
              "utility": "Xcel Energy",
              "named_counterparty": "Echo Zone, LLC",
              "docket": "26-170",
              "status": "PUC summary lists under review",
              "scope": "Filing dates differ between city and PUC; no completed regulatory approval or IT load is asserted."
            },
            "source_date_discrepancies": "The city dates the Google/Xcel announcement February24,2025; Google’s original announcement is February24,2026. The city dates the ESA filing April15,2026; PUC summary gives April14,2026. Announcement chronology follows the dated operator publication; the inconsistent filing day remains unresolved and is not an event.",
            "planned_cooling_scope": "City describes planned air cooling with a sealed chilled-water loop for the initial phase. This is design information, not measured operation or zero total site water use.",
            "grid_supply_not_it_capacity": "Google’s announced wind, solar and battery additions serve Xcel’s grid. No part of those grid-generation/storage quantities is assigned as Pine Island IT capacity or current consumption.",
            "current_status_basis": "Pine Island reports January20,2026 approval of rezoning, annexation, final plat, final development plan and conditional use permit for Project Skyway’s initial phase. This is phase-specific local land-use approval, not approval of the entire 482-acre study area, PUC electric-service approval, construction completion or operation. The regulator still lists the separate ESA under review."
          },
          "notes": [
            "Partial record/field review only. No point movement, exact opening day, commissioned IT capacity, or whole-state freshness certification."
          ],
          "sources": [
            {
              "url": "https://pineislandmn.gov/skyway",
              "host": "pineislandmn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "City of Pine Island reviewed primary source"
            },
            {
              "url": "https://www.datacenters.google/locations/",
              "host": "www.datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Google official location source"
            },
            {
              "url": "https://blog.google/innovation-and-ai/infrastructure-and-cloud/global-network/data-center-pine-island/",
              "host": "blog.google",
              "published": "2026-02-24",
              "date": "2026-02-24",
              "checked": "2026-10-16",
              "label": "Google reviewed primary source"
            },
            {
              "url": "https://mn.gov/puc/activities/v-l-e-c/data-centers/",
              "host": "mn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Minnesota Public Utilities Commission reviewed primary source"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Pine Island · Goodhue · Source context reviewed",
      "status_scope": "Pine Island reports January20,2026 approval of rezoning, annexation, final plat, final development plan and conditional use permit for Project Skyway’s initial phase. This is phase-specific local land-use approval, not approval of the entire 482-acre study area, PUC electric-service approval, construction completion or operation. The regulator still lists the separate ESA under review.",
      "event_evidence": [
        {
          "date": "2026-01-20",
          "text": "Pine Island reports initial Project Skyway land-use approvals: rezoning, annexation, final plat/development plan and conditional use permit. Initial phase only; separate electric-service approval, construction and operation are not established.",
          "kind": "approved",
          "sources": [
            {
              "url": "https://pineislandmn.gov/skyway",
              "host": "pineislandmn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "City of Pine Island reviewed primary source"
            }
          ]
        },
        {
          "date": "2026-02-24",
          "text": "Google announced Pine Island as a future data center location and an Xcel Energy partnership. Publication date; not an opening or construction-start milestone.",
          "kind": "announced",
          "sources": [
            {
              "url": "https://blog.google/innovation-and-ai/infrastructure-and-cloud/global-network/data-center-pine-island/",
              "host": "blog.google",
              "published": "2026-02-24",
              "date": "2026-02-24",
              "checked": "2026-10-16",
              "label": "Google reviewed primary source"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27049"
      }
    },
    {
      "id": "h5-data-centers-st-paul-mn",
      "state": "mn",
      "kind": "facility",
      "name": "H5 Data Centers St. Paul",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Ramsey"
      ],
      "city": "St. Paul",
      "address": "",
      "who": "H5 Data Centers",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Minneapolis is the market label; actual published municipality is St.Paul. A power uptime SLA is not measured uptime. Operator service/design assertions, not an independent uptime or certification audit. Repeated Ashburn42MW/Q32024 promotional footer is excluded from this location. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://h5datacenters.com/minneapolis-data-center.html",
          "host": "h5datacenters.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1125+Energy+Park+Dr.%2C+St.+Paul%2C+MN+55108&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street method and limits"
        }
      ],
      "loc": {
        "lat": 44.970583735114,
        "lng": -93.147193805725,
        "precision": "address",
        "basis": "Published H5 Data Centers facility address 1125 Energy Park Dr., Suite 100, St. Paul, MN  55108 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "h5-primary-review-round4-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "published_address": "1125 Energy Park Dr., Suite100, St. Paul, MN 55108",
            "advertised_facility_sqft": 17000
          },
          "notes": [
            "Minneapolis is the market label; actual published municipality is St.Paul. A power uptime SLA is not measured uptime.",
            "Operator service/design assertions, not an independent uptime or certification audit. Repeated Ashburn42MW/Q32024 promotional footer is excluded from this location.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://h5datacenters.com/minneapolis-data-center.html",
              "host": "h5datacenters.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "H5 offers current colocation and immediate IT deployments at its Minneapolis-market facility in St. Paul. Market naming is not a change to its legal municipality. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "H5 offers current colocation and immediate IT deployments at its Minneapolis-market facility in St. Paul. Market naming is not a change to its legal municipality. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "H5 offers current colocation and immediate IT deployments at its Minneapolis-market facility in St. Paul. Market naming is not a change to its legal municipality."
          ],
          "sources": [
            {
              "url": "https://h5datacenters.com/minneapolis-data-center.html",
              "host": "h5datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 7, October 22, 2026",
          "scope": "Official facility service street reference only. No canonical address, current operation, physical date, capacity, company role, jurisdiction, parcel, complete campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 44.970583735114,
                "lng": -93.147193805725,
                "precision": "address",
                "basis": "Published H5 Data Centers facility address 1125 Energy Park Dr., Suite 100, St. Paul, MN  55108 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "1125 Energy Park Dr., Suite 100, St. Paul, MN  55108",
              "county_fips": [
                "27123"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named operator facility page publishes this service address in its facility location section. Navigation, related facilities, corporate addresses, embedded maps and operator template coordinates are excluded. The canonical address wrapper remains exact; the published address is retained as reviewed location evidence.",
            "The unique Census street match and retained county boundary agree with the existing county. Street interpolation does not identify a roof, suite, floor, campus boundary, legal parcel, ownership or distinct physical building. Status, dates, quantities and jurisdiction remain unchanged.",
            "The complete operator suite or floor qualifier remains in visible address evidence. The Census query omits only that qualifier and uses the published street and locality. No suite or floor point is inferred."
          ],
          "sources": [
            {
              "url": "https://h5datacenters.com/minneapolis-data-center.html",
              "host": "h5datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Official named facility street address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1125+Energy+Park+Dr.%2C+St.+Paul%2C+MN+55108&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street method and limits"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 12, October 23, 2026",
          "scope": "H5 Data Centers presents this named facility or campus in its own colocation service portfolio. Operator is the attributed provider brand relationship, not an independently established legal operating entity, property owner or confirmation that every building and phase is operating. No status, location, physical date, capacity, certification, outage guarantee, utility price or environmental outcome is promoted. Minneapolis is the marketed name while the source locates the offering in St. Paul. No jurisdiction change is inferred.",
          "fields": {
            "company_association": {
              "name": "H5 Data Centers",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "H5 Data Centers presents this named facility or campus in its own colocation service portfolio. Operator is the attributed provider brand relationship, not an independently established legal operating entity, property owner or confirmation that every building and phase is operating. No status, location, physical date, capacity, certification, outage guarantee, utility price or environmental outcome is promoted. Minneapolis is the marketed name while the source locates the offering in St. Paul. No jurisdiction change is inferred."
            },
            "provider_role": "operator"
          },
          "notes": [
            "H5 Data Centers presents this named facility or campus in its own colocation service portfolio. Operator is the attributed provider brand relationship, not an independently established legal operating entity, property owner or confirmation that every building and phase is operating. No status, location, physical date, capacity, certification, outage guarantee, utility price or environmental outcome is promoted. Minneapolis is the marketed name while the source locates the offering in St. Paul. No jurisdiction change is inferred.",
            "Source dates remain separate from physical milestones and the retained status field."
          ],
          "sources": [
            {
              "url": "https://h5datacenters.com/minneapolis-data-center.html",
              "host": "h5datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party named colocation portfolio page, scoped provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "St. Paul · Ramsey · Source context reviewed",
      "status_scope": "H5 offers current colocation and immediate IT deployments at its Minneapolis-market facility in St. Paul. Market naming is not a change to its legal municipality. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "legacy-investing-north-loop-minneapolis-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Legacy Investing North Loop (former Star Tribune printing plant)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Hennepin"
      ],
      "city": "Minneapolis",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. An agreement is not a confirmed closing. Thirteen acres converted to roughly 566,000 square feet is land area, not building floor area. The separate Sleep Number site is 30 MW and must not be added. The article reverses the moratorium threshold in one sentence; the city bulletin describes an exception up to 350,000 square feet downtown, but an original ordinance and this site's eligibility still require review. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. This is a council member account on the city bulletin service, not the adopted ordinance. It describes an interim step with later hearing and council/mayor action. Do not assume a final six-month start or expiry. The July CBS article reverses the threshold in one sentence. Land area is not building floor area and does not decide the Legacy project exemption.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.cbsnews.com/minnesota/news/data-center-minnesota-star-tribune-downtown-minneapolis/",
          "host": "cbsnews.com",
          "date": "2026-07-30",
          "published": "2026-07-30",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://content.govdelivery.com/accounts/MPLS/bulletins/41889b9",
          "host": "content.govdelivery.com",
          "date": "2026-05-22",
          "published": "2026-05-22",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 44.97213,
        "lng": -93.47375,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round27-2026-10-14.json",
          "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.",
          "fields": {
            "reported_context": "CBS Minnesota reports Legacy Investing's agreement to buy the former Star Tribune printing property for a proposed 20 MW data center and possible mixed use.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "An agreement is not a confirmed closing. Thirteen acres converted to roughly 566,000 square feet is land area, not building floor area. The separate Sleep Number site is 30 MW and must not be added. The article reverses the moratorium threshold in one sentence; the city bulletin describes an exception up to 350,000 square feet downtown, but an original ordinance and this site's eligibility still require review.",
            "Original approvals and later observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.cbsnews.com/minnesota/news/data-center-minnesota-star-tribune-downtown-minneapolis/",
              "host": "cbsnews.com",
              "date": "2026-07-30",
              "published": "2026-07-30",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "regional-development-review-round27-2026-10-14.json",
          "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.",
          "fields": {
            "reported_context": "City council member bulletin reports May 21 temporary action and a downtown exception for projects up to 350,000 square feet, with further legislative action pending.",
            "source_reported_threshold_direction": "exception up to 350,000 square feet downtown",
            "specific_site_exemption_verified": false
          },
          "notes": [
            "This is a council member account on the city bulletin service, not the adopted ordinance. It describes an interim step with later hearing and council/mayor action. Do not assume a final six-month start or expiry.",
            "The July CBS article reverses the threshold in one sentence. Land area is not building floor area and does not decide the Legacy project exemption.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://content.govdelivery.com/accounts/MPLS/bulletins/41889b9",
              "host": "content.govdelivery.com",
              "date": "2026-05-22",
              "published": "2026-05-22",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The selected original City Council newsletter describes a data center moratorium debate and an exception, but does not substantively identify the exact Legacy North Loop project in the selected data center section. It is an attributed Council communication rather than the complete final ordinance or an original Legacy purchase termination statement. Private accounts of a terminated purchase agreement are not adopted as an original project outcome, and a land deal termination would not itself prove physical computing closure.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "general_city_policy_not_exact_legacy_project_stage",
              "scope": "The selected original City Council newsletter describes a data center moratorium debate and an exception, but does not substantively identify the exact Legacy North Loop project in the selected data center section. It is an attributed Council communication rather than the complete final ordinance or an original Legacy purchase termination statement. Private accounts of a terminated purchase agreement are not adopted as an original project outcome, and a land deal termination would not itself prove physical computing closure."
            },
            "source_read_scope": {
              "selected_official_council_newsletter_data_center_section_read": true,
              "opinion_and_general_rule_account_not_final_instrument": true,
              "exact_project_not_identified_in_selected_section": true,
              "no_private_purchase_termination_promoted": true
            }
          },
          "notes": [
            "The selected original City Council newsletter describes a data center moratorium debate and an exception, but does not substantively identify the exact Legacy North Loop project in the selected data center section. It is an attributed Council communication rather than the complete final ordinance or an original Legacy purchase termination statement. Private accounts of a terminated purchase agreement are not adopted as an original project outcome, and a land deal termination would not itself prove physical computing closure.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://content.govdelivery.com/accounts/MPLS/bulletins/41889b9",
              "host": "content.govdelivery.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Minneapolis · Hennepin · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27053"
      }
    },
    {
      "id": "lightedge-chaska-mn",
      "state": "mn",
      "kind": "facility",
      "name": "LightEdge Chaska (fka Stream Data Centers Minneapolis I)",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Carver"
      ],
      "city": "Chaska",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Lightedge Chaska named address. Capacity/areaheadingswithoutvaluesinthecapture;notzero. MarketnameMinneapolisnotmunicipality. No numericITMW,currentmeteredloadoropeningday. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.lightedge.com/data-center-locations/minneapolis/",
          "host": "lightedge.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1708+West+Creek+Lane%2C+Chaska%2C+MN+55318&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Calculated Census street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-93.63919041307776%2C44.80299684660853%2C-93.63032752276425%2C44.809285024833464&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Aerial setting only, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -93.634758967921,
        "lat": 44.806140935721,
        "precision": "address",
        "basis": "Published Lightedge facility address 1708 West Creek Lane, Chaska, MN 55318 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round10-2026-10-14.json",
          "scope": "Lightedge Chaska named address",
          "fields": {
            "operator": "Lightedge",
            "market": "Minneapolis",
            "address": "1708 WestCreekLane, Chaska, Minnesota55318"
          },
          "notes": [
            "Capacity/areaheadingswithoutvaluesinthecapture;notzero. MarketnameMinneapolisnotmunicipality. No numericITMW,currentmeteredloadoropeningday.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.lightedge.com/data-center-locations/minneapolis/",
              "host": "lightedge.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "Lightedge lists current colocation and hybrid cloud services, with dedicated local support, at its Minneapolis-market facility in Chaska. The canonical redirect does not change the existing facility identity or provider field. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "Lightedge lists current colocation and hybrid cloud services, with dedicated local support, at its Minneapolis-market facility in Chaska. The canonical redirect does not change the existing facility identity or provider field. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "Lightedge lists current colocation and hybrid cloud services, with dedicated local support, at its Minneapolis-market facility in Chaska. The canonical redirect does not change the existing facility identity or provider field."
          ],
          "sources": [
            {
              "url": "https://www.lightedge.com/data-center-locations/minneapolis/",
              "host": "www.lightedge.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 16, October 23, 2026",
          "scope": "Current official facility street reference only. Native protected facts and canonical address remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -93.634758967921,
                "lat": 44.806140935721,
                "precision": "address",
                "basis": "Published Lightedge facility address 1708 West Creek Lane, Chaska, MN 55318 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "1708 West Creek Lane, Chaska, MN 55318",
              "county_fips": [
                "27019"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named official numeric facility section binds the service address to this existing research record. Corporate offices, related facility cards and embedded map coordinates are excluded.",
            "The unique Census calculated street range agrees with the retained state and county. Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. The reference does not locate a surveyed roof, parcel, full campus, legal owner, floor or suite.",
            "All canonical address, status, physical dates, quantity, role, identity and jurisdiction wrappers remain exact. The retained Census method source keeps its actual October 22 date; new captures are dated October 23.",
            "The old unreviewed inventory point is 2430.7 metres from the current calculated street reference. The official named Minneapolis Data Center section explicitly gives 1708 West Creek Lane, Chaska, Minnesota 55318. The unique Census street range agrees with the retained Carver County context. Actually viewed official imagery places the reference on that street beside large commercial forms. No earlier reviewed precise point, legal parcel, full campus or property title is overridden."
          ],
          "sources": [
            {
              "url": "https://www.lightedge.com/data-center-locations/minneapolis/",
              "host": "www.lightedge.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Official named Minneapolis Data Center numeric facility address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1708+West+Creek+Lane%2C+Chaska%2C+MN+55318&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Calculated Census street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-93.63919041307776%2C44.80299684660853%2C-93.63032752276425%2C44.809285024833464&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Aerial setting only, acquisition date unknown"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Chaska · Carver · Source context reviewed",
      "status_scope": "Lightedge lists current colocation and hybrid cloud services, with dedicated local support, at its Minneapolis-market facility in Chaska. The canonical redirect does not change the existing facility identity or provider field. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "meta-rosemount-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Meta Rosemount Data Center",
      "group": "proposed",
      "status": "Operator-listed development",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Dakota"
      ],
      "city": "Rosemount",
      "address": "",
      "who": "Meta",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Announcement forecasts once completed; no exact opening or measured load.19thUSand23rdglobal are historical company fleet rankings, not current national counts. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://datacenters.atmeta.com/2024/03/hello-rosemount/",
          "host": "datacenters.atmeta.com",
          "date": "2024-03-14",
          "published": "2024-03-14",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://datacenters.atmeta.com/asset/rosemount-data-center-info-sheet/",
          "host": "datacenters.atmeta.com",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Reviewed current operator evidence"
        }
      ],
      "loc": {
        "lat": 44.6401,
        "lng": -93.06238,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "remaining-operators-review-round5-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "planned_campus_area_sqft": 715000,
            "planned_investment_usd_min_exclusive": 800000000,
            "forecast_operational_jobs_approx": 100,
            "forecast_peak_construction_jobs_min_exclusive": 1000
          },
          "notes": [
            "Announcement forecasts once completed; no exact opening or measured load.19thUSand23rdglobal are historical company fleet rankings, not current national counts.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://datacenters.atmeta.com/2024/03/hello-rosemount/",
              "host": "datacenters.atmeta.com",
              "date": "2024-03-14",
              "published": "2024-03-14",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "overnight-status-2026-10-16",
          "scope": "Named project and operator-service status review; phase and source limits retained.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "supported_label",
              "label": "Operator-listed development",
              "basis": "The current named operator factsheet describes this campus in future terms and gives operational employment only once completed.",
              "checked_on": "2026-10-16"
            },
            "stage_review_limits": "This supports an operator-listed development, not current service. Historical groundbreaking years, shared fleet boilerplate and photographs do not establish current physical construction, completion, staffing or operation."
          },
          "notes": [
            "This supports an operator-listed development, not current service. Historical groundbreaking years, shared fleet boilerplate and photographs do not establish current physical construction, completion, staffing or operation.",
            "Current service and project labels are source-scoped research contexts. No entire record, physical site, technical quantity or exact parcel is certified."
          ],
          "sources": [
            {
              "url": "https://datacenters.atmeta.com/asset/rosemount-data-center-info-sheet/",
              "host": "datacenters.atmeta.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Reviewed current operator evidence"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check61, October24,2026",
          "scope": "Meta identifies the Rosemount project in its March14,2024 announcement and links Mortenson construction information. Its future service, floor area, investment, staffing, renewable matching and certification descriptions are not adopted as verified outcomes. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained.",
          "fields": {
            "company_association": {
              "name": "Meta",
              "role": "developer",
              "identity_scope": "provider_brand_only",
              "scope": "Meta identifies the Rosemount project in its March14,2024 announcement and links Mortenson construction information. Its future service, floor area, investment, staffing, renewable matching and certification descriptions are not adopted as verified outcomes. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained."
            },
            "provider_role": "developer"
          },
          "notes": [
            "Meta identifies the Rosemount project in its March14,2024 announcement and links Mortenson construction information. Its future service, floor area, investment, staffing, renewable matching and certification descriptions are not adopted as verified outcomes. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained."
          ],
          "sources": [
            {
              "url": "https://datacenters.atmeta.com/2024/03/hello-rosemount/",
              "host": "datacenters.atmeta.com",
              "published": "2024-03-14",
              "date": "2024-03-14",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Rosemount · Dakota · Source context reviewed",
      "status_scope": "Primary source review checked 2026-10-16. The current named operator factsheet describes this campus in future terms and gives operational employment only once completed. This supports an operator-listed development, not current service. Historical groundbreaking years, shared fleet boilerplate and photographs do not establish current physical construction, completion, staffing or operation.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27037"
      }
    },
    {
      "id": "microsoft-becker-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Microsoft Becker Data Center",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Sherburne"
      ],
      "city": "Becker",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Land purchase is not data-center construction spending, secured utility service or commissioning. Microsoft declined to disclose project details. Google's canceled proposal and Elk River Technologies' separate land sale are not this site. No MW, specific design or final opening date is established. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.mprnews.org/story/2024/02/21/xcel-energy-sells-land-in-becker-to-microsoft-for-data-center",
          "host": "mprnews.org",
          "date": "2024-02-21",
          "published": "2024-02-21",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 45.42206,
        "lng": -93.77316,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round28-2026-10-14.json",
          "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.",
          "fields": {
            "reported_context": "MPR reports Microsoft's purchase of about 295 Becker acres from Xcel for about 17.7 million USD, confirmed by Xcel and state property data cited by the reporter.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Land purchase is not data-center construction spending, secured utility service or commissioning. Microsoft declined to disclose project details. Google's canceled proposal and Elk River Technologies' separate land sale are not this site. No MW, specific design or final opening date is established.",
            "Original approvals and later observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.mprnews.org/story/2024/02/21/xcel-energy-sells-land-in-becker-to-microsoft-for-data-center",
              "host": "mprnews.org",
              "date": "2024-02-21",
              "published": "2024-02-21",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Becker · Sherburne · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27141"
      }
    },
    {
      "id": "monticello-tech-park-frattalone-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Monticello Tech Park (Monticello Tech LLC / Frattalone)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Wright"
      ],
      "city": "Monticello",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Comprehensive-plan changes are not annexation, rezoning or construction approvals. Separate building areas, investment estimates and jobs cannot be combined into each project. The late-winter 2026 review target is not an observed completion. Nearby Meta Rosemount figures are comparisons, not Monticello facts; power-line proximity is not executed service. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.hometownsource.com/monticello_times/two-data-center-proposals-on-the-table-in-monticello/article_502daa86-6ea3-4728-a1f5-88ac70cbc7f7.html",
          "host": "hometownsource.com",
          "date": "2025-09-11",
          "published": "2025-09-11",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.monticellomn.gov/753/Monticello-Tech",
          "host": "www.monticellomn.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Reviewed government record"
        }
      ],
      "loc": {
        "lat": 45.17397,
        "lng": -93.96288,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round28-2026-10-14.json",
          "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.",
          "fields": {
            "reported_context": "The Monticello Times separates Frattalone/Monticello Tech's 550-acre concept from Scannell's roughly 106-acre concept near Bertram park, explicitly saying neither project was approved or had building permits.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Comprehensive-plan changes are not annexation, rezoning or construction approvals. Separate building areas, investment estimates and jobs cannot be combined into each project. The late-winter 2026 review target is not an observed completion. Nearby Meta Rosemount figures are comparisons, not Monticello facts; power-line proximity is not executed service.",
            "Original approvals and later observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.hometownsource.com/monticello_times/two-data-center-proposals-on-the-table-in-monticello/article_502daa86-6ea3-4728-a1f5-88ac70cbc7f7.html",
              "host": "hometownsource.com",
              "date": "2025-09-11",
              "published": "2025-09-11",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The current original City Monticello Tech page identifies a proposed Monticello Tech LLC development and complete land use applications, with an October 6, 2026 Planning Commission hearing and advisory recommendation by four votes to one. It says Council consideration is not yet scheduled. The selected body does not independently establish whether this inherited company labeled inventory point is a separate physical project or a partner reference to the same named proposal. No duplicate campus, provider role, exact parcel or status is promoted while that crosswalk is held. A statutory decision deadline and environmental review are not computing operation or final approval.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "named_city_proposal_inherited_company_crosswalk_and_distinctness_held",
              "scope": "The current original City Monticello Tech page identifies a proposed Monticello Tech LLC development and complete land use applications, with an October 6, 2026 Planning Commission hearing and advisory recommendation by four votes to one. It says Council consideration is not yet scheduled. The selected body does not independently establish whether this inherited company labeled inventory point is a separate physical project or a partner reference to the same named proposal. No duplicate campus, provider role, exact parcel or status is promoted while that crosswalk is held. A statutory decision deadline and environmental review are not computing operation or final approval."
            },
            "source_read_scope": {
              "original_city_current_status_and_selected_review_chronology_read": true,
              "planning_recommendation_not_final_council_approval": true,
              "company_labeled_inventory_not_independent_separate_campus": true,
              "no_project_merge_or_new_identity": true,
              "december8_decision_deadline_not_compute_schedule": true
            }
          },
          "notes": [
            "The current original City Monticello Tech page identifies a proposed Monticello Tech LLC development and complete land use applications, with an October 6, 2026 Planning Commission hearing and advisory recommendation by four votes to one. It says Council consideration is not yet scheduled. The selected body does not independently establish whether this inherited company labeled inventory point is a separate physical project or a partner reference to the same named proposal. No duplicate campus, provider role, exact parcel or status is promoted while that crosswalk is held. A statutory decision deadline and environmental review are not computing operation or final approval.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://www.monticellomn.gov/753/Monticello-Tech",
              "host": "www.monticellomn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Monticello · Wright · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27171"
      }
    },
    {
      "id": "geronimo-nobles-county-powered-data-park-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Nobles County Powered Data Park",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Nobles"
      ],
      "city": "Worthington",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Geronimo Nobles development context versus staff power portfolio. Generalpowered-data-parkandstaffbiographycontentnotapprovedNoblesDCplan.1600MW/550MWinbiographyisstaffpastprojectexperience,notNoblesITorcampuspower. Bloomingtonheadquartersnotprojectsite. Noexactparcel,opening,currentapprovalorITMW. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://geronimopower.com/in-development/nobles-county-powered-data-park/",
          "host": "geronimopower.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geronimopower.com/powered-data-parks/",
          "host": "geronimopower.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 43.6742,
        "lng": -95.75352,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round10-2026-10-14.json",
          "scope": "Geronimo Nobles development context versus staff power portfolio",
          "fields": {
            "developer": "Geronimo Power",
            "project_label": "Nobles County Data Center",
            "associated_wind_projects": [
              "Plum Creek1",
              "Plum Creek2",
              "Lime Creek"
            ]
          },
          "notes": [
            "Generalpowered-data-parkandstaffbiographycontentnotapprovedNoblesDCplan.1600MW/550MWinbiographyisstaffpastprojectexperience,notNoblesITorcampuspower. Bloomingtonheadquartersnotprojectsite. Noexactparcel,opening,currentapprovalorITMW.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://geronimopower.com/in-development/nobles-county-powered-data-park/",
              "host": "geronimopower.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The old original Nobles County project URL ordinarily redirects to the current powered data parks page. That original company body describes preparing land and power projects for future acquisition by a data center operator and includes named Nobles County promotional video descriptions. It does not independently verify a completed operator acquisition, a commissioned computing facility, current load or an exact first service day at this inventory point. General development process and community benefit accounts are not physical site status or measured impact.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "original_powered_park_marketing_current_compute_stage_held",
              "scope": "The old original Nobles County project URL ordinarily redirects to the current powered data parks page. That original company body describes preparing land and power projects for future acquisition by a data center operator and includes named Nobles County promotional video descriptions. It does not independently verify a completed operator acquisition, a commissioned computing facility, current load or an exact first service day at this inventory point. General development process and community benefit accounts are not physical site status or measured impact."
            },
            "source_read_scope": {
              "ordinary_observed_redirect_destination_main_body_read": true,
              "named_nobles_video_descriptions_read_not_video_transcripts": true,
              "land_and_power_preparation_not_compute_operation": true,
              "no_future_operator_or_quantity_export": true
            }
          },
          "notes": [
            "The old original Nobles County project URL ordinarily redirects to the current powered data parks page. That original company body describes preparing land and power projects for future acquisition by a data center operator and includes named Nobles County promotional video descriptions. It does not independently verify a completed operator acquisition, a commissioned computing facility, current load or an exact first service day at this inventory point. General development process and community benefit accounts are not physical site status or measured impact.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://geronimopower.com/powered-data-parks/",
              "host": "geronimopower.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Worthington · Nobles · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27105"
      }
    },
    {
      "id": "revolve-labs-glencoe-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Revolve Labs Glencoe",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "McLeod"
      ],
      "city": "Glencoe",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.. Maximum headline value is not fixed spent capex. Existing mining operations, proposed AI facilities and another Windom withdrawal are different. Utility net revenue is an attributed historical claim, not project investment or guaranteed bill savings. Noise/health descriptions from elsewhere are not measured Glencoe findings. No IT capacity or later approval established. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://crypto.news/bitcoin-miner-revolve-labs-proposes-60m-data-center-in-minnesota/",
          "host": "crypto.news",
          "date": "2024-10-21",
          "published": "2024-10-21",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 44.8236,
        "lng": -94.27246,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round32-2026-10-14.json",
          "scope": "Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.",
          "fields": {
            "reported_context": "Crypto.news summarizes a preliminary Revolve Labs Glencoe expansion concept, reporting a40-to60-million-USDrange and around ten planned jobs.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Maximum headline value is not fixed spent capex. Existing mining operations, proposed AI facilities and another Windom withdrawal are different. Utility net revenue is an attributed historical claim, not project investment or guaranteed bill savings. Noise/health descriptions from elsewhere are not measured Glencoe findings. No IT capacity or later approval established.",
            "Original approvals and later observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://crypto.news/bitcoin-miner-revolve-labs-proposes-60m-data-center-in-minnesota/",
              "host": "crypto.news",
              "date": "2024-10-21",
              "published": "2024-10-21",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Glencoe · McLeod · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27085"
      }
    },
    {
      "id": "revolve-labs-moose-lake-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Revolve Labs Moose Lake",
      "group": "stopped",
      "status": "Reported permit application withdrawn",
      "raw_status": "stopped",
      "status_field": "current_status",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "Carlton"
      ],
      "city": "Moose Lake",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.. Public opposition also described, but cannot replace stated company reason. Land lease agreement did not establish operating mine. Future discussions remained possible. Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.pinejournal.com/news/local/crypto-mining-company-withdraws-moose-lake-proposal",
          "host": "pinejournal.com",
          "date": "2026-03-12",
          "published": "2026-03-12",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 46.59228,
        "lng": -92.67662,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-outcomes-review-round20-2026-10-14.json",
          "scope": "Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.",
          "fields": {
            "reported_action_type": "conditional-use-application-withdrawn",
            "reported_finding": "Pine Journal reports March 11 council notification that Revolve withdrew Moose Lake permit application. Company cited power-availability timing.",
            "report_display_date": "2026-03-12",
            "independently_verified_current_status": null
          },
          "notes": [
            "Public opposition also described, but cannot replace stated company reason. Land lease agreement did not establish operating mine. Future discussions remained possible.",
            "Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.pinejournal.com/news/local/crypto-mining-company-withdraws-moose-lake-proposal",
              "host": "pinejournal.com",
              "date": "2026-03-12",
              "published": "2026-03-12",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-F1-label-review-2026-10-20",
          "scope": "The Pine Journal reports that Moose Lake's city administrator notified the council of Revolve Labs' conditional use application withdrawal in March 2026, and quotes the company's explanation about power availability timing. This applies to Moose Lake, not the company's other operating or proposed sites.",
          "fields": {
            "identity_label_context": {
              "previous_name": "Revolve Labs Moose Lake (withdrawn)",
              "plain_name": "Revolve Labs Moose Lake",
              "interpretation": "The Pine Journal reports that Moose Lake's city administrator notified the council of Revolve Labs' conditional use application withdrawal in March 2026, and quotes the company's explanation about power availability timing. This applies to Moose Lake, not the company's other operating or proposed sites.",
              "outcome_wording_is_not_identity": true
            },
            "current_stage_evidence": {
              "outcome": "reported_permit_application_withdrawn",
              "scope": "The Pine Journal reports that Moose Lake's city administrator notified the council of Revolve Labs' conditional use application withdrawal in March 2026, and quotes the company's explanation about power availability timing. This applies to Moose Lake, not the company's other operating or proposed sites."
            }
          },
          "notes": [
            "The Pine Journal reports that Moose Lake's city administrator notified the council of Revolve Labs' conditional use application withdrawal in March 2026, and quotes the company's explanation about power availability timing. This applies to Moose Lake, not the company's other operating or proposed sites.",
            "Inherited inventory name: Revolve Labs Moose Lake (withdrawn). The wording is retained as provenance, not as an independently verified outcome.",
            "An application decision is separate from a current physical stage. No coordinate, address, parcel, company role, technical figure or physical milestone date is changed."
          ],
          "sources": [
            {
              "url": "https://www.pinejournal.com/news/local/crypto-mining-company-withdraws-moose-lake-proposal",
              "host": "www.pinejournal.com",
              "published": "2026-03-12",
              "date": "2026-03-12",
              "checked": "2026-10-20",
              "label": "Cloquet Pine Journal"
            }
          ],
          "checked": "2026-10-20",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Moose Lake · Carlton · Source context reviewed",
      "status_scope": "The Pine Journal reports that Moose Lake's city administrator notified the council of Revolve Labs' conditional use application withdrawal in March 2026, and quotes the company's explanation about power availability timing. This applies to Moose Lake, not the company's other operating or proposed sites.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27017"
      }
    },
    {
      "id": "revolve-labs-windom-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Revolve Labs Windom",
      "group": "stopped",
      "status": "Reported application withdrawal",
      "raw_status": "stopped",
      "status_field": "current_status",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "Cottonwood"
      ],
      "city": "Windom",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.. Visible publication date September 26 differs from URL/metadata September 25. No exact withdrawal day adopted. Glencoe capacity is another site, not Windom. Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://theenergymag.com/news/2024-09-25/revolve-bitcoin-mining-windom",
          "host": "theenergymag.com",
          "date": "2024-09-26",
          "published": "2024-09-26",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.pinejournal.com/news/local/crypto-mining-company-withdraws-moose-lake-proposal",
          "host": "www.pinejournal.com",
          "published": "2026-03-12",
          "date": "2026-03-12",
          "checked": "2026-10-20",
          "label": "Cloquet Pine Journal"
        }
      ],
      "loc": {
        "lat": 44.01888,
        "lng": -95.19402,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-outcomes-review-round20-2026-10-14.json",
          "scope": "Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.",
          "fields": {
            "reported_action_type": "withdrawal-reported-secondhand",
            "reported_finding": "The EnergyMag reports Revolve withdrew Windom mining application, citing Minnesota Star Tribune reporting.",
            "report_display_date": "2024-09-26",
            "independently_verified_current_status": null
          },
          "notes": [
            "Visible publication date September 26 differs from URL/metadata September 25. No exact withdrawal day adopted. Glencoe capacity is another site, not Windom.",
            "Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://theenergymag.com/news/2024-09-25/revolve-bitcoin-mining-windom",
              "host": "theenergymag.com",
              "date": "2024-09-26",
              "published": "2024-09-26",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-F1-label-review-2026-10-20",
          "scope": "The EnergyMag reports withdrawal of Revolve Labs' Windom application, citing Minnesota Star Tribune reporting. The Pine Journal's March 2026 Moose Lake account also identifies Windom as a prior withdrawn application. These reported application outcomes do not establish a physical shutdown or current stage at Glencoe or another Revolve location.",
          "fields": {
            "identity_label_context": {
              "previous_name": "Revolve Labs Windom (withdrawn)",
              "plain_name": "Revolve Labs Windom",
              "interpretation": "The EnergyMag reports withdrawal of Revolve Labs' Windom application, citing Minnesota Star Tribune reporting. The Pine Journal's March 2026 Moose Lake account also identifies Windom as a prior withdrawn application. These reported application outcomes do not establish a physical shutdown or current stage at Glencoe or another Revolve location.",
              "outcome_wording_is_not_identity": true
            },
            "current_stage_evidence": {
              "outcome": "reported_application_withdrawal",
              "scope": "The EnergyMag reports withdrawal of Revolve Labs' Windom application, citing Minnesota Star Tribune reporting. The Pine Journal's March 2026 Moose Lake account also identifies Windom as a prior withdrawn application. These reported application outcomes do not establish a physical shutdown or current stage at Glencoe or another Revolve location."
            }
          },
          "notes": [
            "The EnergyMag reports withdrawal of Revolve Labs' Windom application, citing Minnesota Star Tribune reporting. The Pine Journal's March 2026 Moose Lake account also identifies Windom as a prior withdrawn application. These reported application outcomes do not establish a physical shutdown or current stage at Glencoe or another Revolve location.",
            "Inherited inventory name: Revolve Labs Windom (withdrawn). The wording is retained as provenance, not as an independently verified outcome.",
            "An application decision is separate from a current physical stage. No coordinate, address, parcel, company role, technical figure or physical milestone date is changed."
          ],
          "sources": [
            {
              "url": "https://theenergymag.com/news/2024-09-25/revolve-bitcoin-mining-windom",
              "host": "theenergymag.com",
              "published": "",
              "date": "",
              "checked": "2026-10-20",
              "label": "The EnergyMag"
            },
            {
              "url": "https://www.pinejournal.com/news/local/crypto-mining-company-withdraws-moose-lake-proposal",
              "host": "www.pinejournal.com",
              "published": "2026-03-12",
              "date": "2026-03-12",
              "checked": "2026-10-20",
              "label": "Cloquet Pine Journal"
            }
          ],
          "checked": "2026-10-20",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Windom · Cottonwood · Source context reviewed",
      "status_scope": "The EnergyMag reports withdrawal of Revolve Labs' Windom application, citing Minnesota Star Tribune reporting. The Pine Journal's March 2026 Moose Lake account also identifies Windom as a prior withdrawn application. These reported application outcomes do not establish a physical shutdown or current stage at Glencoe or another Revolve location.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27033"
      }
    },
    {
      "id": "scannell-monticello-tech-park-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Scannell Properties Monticello Tech Park",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Wright"
      ],
      "city": "Monticello",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Comprehensive-plan changes are not annexation, rezoning or construction approvals. Separate building areas, investment estimates and jobs cannot be combined into each project. The late-winter 2026 review target is not an observed completion. Nearby Meta Rosemount figures are comparisons, not Monticello facts; power-line proximity is not executed service. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.hometownsource.com/monticello_times/two-data-center-proposals-on-the-table-in-monticello/article_502daa86-6ea3-4728-a1f5-88ac70cbc7f7.html",
          "host": "hometownsource.com",
          "date": "2025-09-11",
          "published": "2025-09-11",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.monticellomn.gov/753/Monticello-Tech",
          "host": "www.monticellomn.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Reviewed government record"
        }
      ],
      "loc": {
        "lat": 45.18902,
        "lng": -93.97931,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round28-2026-10-14.json",
          "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.",
          "fields": {
            "reported_context": "The Monticello Times separates Frattalone/Monticello Tech's 550-acre concept from Scannell's roughly 106-acre concept near Bertram park, explicitly saying neither project was approved or had building permits.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Comprehensive-plan changes are not annexation, rezoning or construction approvals. Separate building areas, investment estimates and jobs cannot be combined into each project. The late-winter 2026 review target is not an observed completion. Nearby Meta Rosemount figures are comparisons, not Monticello facts; power-line proximity is not executed service.",
            "Original approvals and later observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.hometownsource.com/monticello_times/two-data-center-proposals-on-the-table-in-monticello/article_502daa86-6ea3-4728-a1f5-88ac70cbc7f7.html",
              "host": "hometownsource.com",
              "date": "2025-09-11",
              "published": "2025-09-11",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The current original City Monticello Tech page identifies a proposed Monticello Tech LLC development and complete land use applications, with an October 6, 2026 Planning Commission hearing and advisory recommendation by four votes to one. It says Council consideration is not yet scheduled. The selected body does not independently establish whether this inherited company labeled inventory point is a separate physical project or a partner reference to the same named proposal. No duplicate campus, provider role, exact parcel or status is promoted while that crosswalk is held. A statutory decision deadline and environmental review are not computing operation or final approval.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "named_city_proposal_inherited_company_crosswalk_and_distinctness_held",
              "scope": "The current original City Monticello Tech page identifies a proposed Monticello Tech LLC development and complete land use applications, with an October 6, 2026 Planning Commission hearing and advisory recommendation by four votes to one. It says Council consideration is not yet scheduled. The selected body does not independently establish whether this inherited company labeled inventory point is a separate physical project or a partner reference to the same named proposal. No duplicate campus, provider role, exact parcel or status is promoted while that crosswalk is held. A statutory decision deadline and environmental review are not computing operation or final approval."
            },
            "source_read_scope": {
              "original_city_current_status_and_selected_review_chronology_read": true,
              "planning_recommendation_not_final_council_approval": true,
              "company_labeled_inventory_not_independent_separate_campus": true,
              "no_project_merge_or_new_identity": true,
              "december8_decision_deadline_not_compute_schedule": true
            }
          },
          "notes": [
            "The current original City Monticello Tech page identifies a proposed Monticello Tech LLC development and complete land use applications, with an October 6, 2026 Planning Commission hearing and advisory recommendation by four votes to one. It says Council consideration is not yet scheduled. The selected body does not independently establish whether this inherited company labeled inventory point is a separate physical project or a partner reference to the same named proposal. No duplicate campus, provider role, exact parcel or status is promoted while that crosswalk is held. A statutory decision deadline and environmental review are not computing operation or final approval.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://www.monticellomn.gov/753/Monticello-Tech",
              "host": "www.monticellomn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Monticello · Wright · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27171"
      }
    },
    {
      "id": "t5-minneapolis-1001-third-avenue-mn",
      "state": "mn",
      "kind": "facility",
      "name": "T5@Minneapolis (1001 Third Avenue South)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Hennepin"
      ],
      "city": "Minneapolis",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Cloud Capital Minneapolis acquisition context with exact-site gap. 21currentplus10potential=31not52. ExactT5/1001ThirdAvenuepropertycrosswalknotstatedbyrelease;capacitynotcanonicaluntilmatched. Corporate26globalassets/5.5BAUMnotthiscampuscapex/count. No saleprice,originalopeningdayorcompletedexpansion. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://cloudcapital.com/cloud-capital-and-arcapita-acquire-a-21-megawatt-data-center-in-the-us-with-planned-expansion/",
          "host": "cloudcapital.com",
          "date": "2026-01-13",
          "published": "2026-01-13",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 44.99659,
        "lng": -93.52204,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round10-2026-10-14.json",
          "scope": "Cloud Capital Minneapolis acquisition context with exact-site gap",
          "fields": {
            "buyers": [
              "Cloud Capital",
              "Arcapita"
            ],
            "acquisition_announcement_date": "2026-01-13",
            "reported_market": "Minneapolis, Minnesota",
            "reported_stabilized_capacity_mw": 21,
            "planned_expansion_mw": 10,
            "planned_total_capacity_mw": 31,
            "power_basis": "data-center capacity, not explicitly critical IT",
            "tenant_description": "unnamed sovereign AI/cloud inference provider, primarily longterm leased"
          },
          "notes": [
            "21currentplus10potential=31not52. ExactT5/1001ThirdAvenuepropertycrosswalknotstatedbyrelease;capacitynotcanonicaluntilmatched. Corporate26globalassets/5.5BAUMnotthiscampuscapex/count. No saleprice,originalopeningdayorcompletedexpansion.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://cloudcapital.com/cloud-capital-and-arcapita-acquire-a-21-megawatt-data-center-in-the-us-with-planned-expansion/",
              "host": "cloudcapital.com",
              "date": "2026-01-13",
              "published": "2026-01-13",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The original January 13, 2026 Cloud Capital issuer release reports a Minneapolis acquisition, existing leased capacity and a planned expansion. The selected body does not independently name the exact inherited street address or T5 relationship. A leased asset and projected income are not proof of present computing deployment at that precise record. No exact site crosswalk, computing operation, current provider role, expansion completion or technical quantity is promoted.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "original_city_level_acquisition_exact_site_and_compute_held",
              "scope": "The original January 13, 2026 Cloud Capital issuer release reports a Minneapolis acquisition, existing leased capacity and a planned expansion. The selected body does not independently name the exact inherited street address or T5 relationship. A leased asset and projected income are not proof of present computing deployment at that precise record. No exact site crosswalk, computing operation, current provider role, expansion completion or technical quantity is promoted."
            },
            "source_read_scope": {
              "complete_dated_original_issuer_release_body_read": true,
              "exact_street_and_t5_not_named_in_selected_body": true,
              "lease_and_income_not_compute": true,
              "no_financial_quantity_or_role_export": true
            }
          },
          "notes": [
            "The original January 13, 2026 Cloud Capital issuer release reports a Minneapolis acquisition, existing leased capacity and a planned expansion. The selected body does not independently name the exact inherited street address or T5 relationship. A leased asset and projected income are not proof of present computing deployment at that precise record. No exact site crosswalk, computing operation, current provider role, expansion completion or technical quantity is promoted.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://cloudcapital.com/cloud-capital-and-arcapita-acquire-a-21-megawatt-data-center-in-the-us-with-planned-expansion/",
              "host": "cloudcapital.com",
              "published": "2026-01-13",
              "date": "2026-01-13",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Minneapolis · Hennepin · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27053"
      }
    },
    {
      "id": "tract-rosemount-technology-park-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Tract Rosemount Technology Park",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Dakota"
      ],
      "city": "Rosemount",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Tract Rosemount secondary institutional withdrawal report. Regional article compiles media/public sources; not direct signed Tract withdrawal or current2026 status. Second Rosemount tract not automatically all Tract holdings and not Meta Rosemount. No precise parcel/name match from reviewed narrative; exact preferred record unresolved. Regional facility counts have explicit hyperscale definition and date, not all current data centers. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.minneapolisfed.org/article/2025/massive-data-centers-lay-roots-in-the-ninth-district",
          "host": "minneapolisfed.org",
          "date": "2025-10-07",
          "published": "2025-10-07",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 44.64482,
        "lng": -93.02251,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "public-institution-review-round11-2026-10-14.json",
          "scope": "Tract Rosemount secondary institutional withdrawal report",
          "fields": {
            "publisher_role": "Federal Reserve Bank of Minneapolis regional analysis",
            "publication_date": "2025-10-07",
            "inventory_asof": "2025-10-01",
            "reported_tract_stage": "pulled out of a second Rosemount site, attributed to city planning officials"
          },
          "notes": [
            "Regional article compiles media/public sources; not direct signed Tract withdrawal or current2026 status. Second Rosemount tract not automatically all Tract holdings and not Meta Rosemount. No precise parcel/name match from reviewed narrative; exact preferred record unresolved. Regional facility counts have explicit hyperscale definition and date, not all current data centers.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.minneapolisfed.org/article/2025/massive-data-centers-lay-roots-in-the-ninth-district",
              "host": "minneapolisfed.org",
              "date": "2025-10-07",
              "published": "2025-10-07",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-F1-label-review-2026-10-20",
          "scope": "The Minneapolis Fed's October 2025 regional analysis attributes Tract's withdrawal from a second Rosemount site to city planning officials. The exact second-site relationship to this inherited record is not independently established. No current stage or connection to Meta's separate Rosemount site is adopted.",
          "fields": {
            "identity_label_context": {
              "previous_name": "Tract Rosemount Technology Park (withdrawn)",
              "plain_name": "Tract Rosemount Technology Park",
              "interpretation": "The Minneapolis Fed's October 2025 regional analysis attributes Tract's withdrawal from a second Rosemount site to city planning officials. The exact second-site relationship to this inherited record is not independently established. No current stage or connection to Meta's separate Rosemount site is adopted.",
              "outcome_wording_is_not_identity": true
            }
          },
          "notes": [
            "The Minneapolis Fed's October 2025 regional analysis attributes Tract's withdrawal from a second Rosemount site to city planning officials. The exact second-site relationship to this inherited record is not independently established. No current stage or connection to Meta's separate Rosemount site is adopted.",
            "Inherited inventory name: Tract Rosemount Technology Park (withdrawn). The wording is retained as provenance, not as an independently verified outcome.",
            "An application decision is separate from a current physical stage. No coordinate, address, parcel, company role, technical figure or physical milestone date is changed."
          ],
          "sources": [
            {
              "url": "https://www.minneapolisfed.org/article/2025/massive-data-centers-lay-roots-in-the-ninth-district",
              "host": "www.minneapolisfed.org",
              "published": "2025-10-07",
              "date": "2025-10-07",
              "checked": "2026-10-20",
              "label": "Federal Reserve Bank of Minneapolis"
            }
          ],
          "checked": "2026-10-20",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Rosemount · Dakota · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27037"
      }
    },
    {
      "id": "us-signal-mn01-eden-prairie-mn",
      "state": "mn",
      "kind": "facility",
      "name": "US Signal MN01 Minneapolis (Eden Prairie)",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Hennepin"
      ],
      "city": "Eden Prairie",
      "address": "",
      "who": "US Signal",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. operator location index only. Network hub supplies no exact addresses or facility MW for the three bound records. 17 is operator network count, not three building capacities or independently reconciled census. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://ussignal.com/data-centers",
          "host": "ussignal.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://ussignal.com/data-centers/mn01-minneapolis/",
          "host": "ussignal.com",
          "published": "",
          "date": "",
          "checked": "2026-10-19",
          "label": "Operator source for the qualified stage"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=10290+West+70th+Street%2C+Eden+Prairie%2C+MN+55344&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street method and limits"
        }
      ],
      "loc": {
        "lat": 44.876710109541,
        "lng": -93.407170163301,
        "precision": "address",
        "basis": "Published US Signal facility address 10290 West 70th Street, Eden Prairie, MN 55344 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "operator location index only",
          "fields": {
            "named_locations": [
              "MI01 Grand Rapids",
              "MN01 Minneapolis",
              "WI02 Madison"
            ],
            "operator_network_data_center_count": 17
          },
          "notes": [
            "Network hub supplies no exact addresses or facility MW for the three bound records. 17 is operator network count, not three building capacities or independently reconciled census.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://ussignal.com/data-centers",
              "host": "ussignal.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "US Signal lists its specifically named MN01 facility in the Eden Prairie area as part of its current colocation infrastructure offering. Design certification is not independently audited. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "US Signal lists its specifically named MN01 facility in the Eden Prairie area as part of its current colocation infrastructure offering. Design certification is not independently audited. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "US Signal lists its specifically named MN01 facility in the Eden Prairie area as part of its current colocation infrastructure offering. Design certification is not independently audited."
          ],
          "sources": [
            {
              "url": "https://ussignal.com/data-centers/mn01-minneapolis/",
              "host": "ussignal.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 8, October 22, 2026",
          "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 44.876710109541,
                "lng": -93.407170163301,
                "precision": "address",
                "basis": "Published US Signal facility address 10290 West 70th Street, Eden Prairie, MN 55344 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "10290 West 70th Street, Eden Prairie, MN 55344",
              "county_fips": [
                "27053"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named official facility source publishes this service address. Corporate headquarters, related locations and maps are excluded. The blank native address wrapper remains exact, with the facility address retained only in reviewed location evidence.",
            "The unique Census street match and retained county boundary agree with the existing county. A calculated street reference does not establish a roof, floor, suite, full campus boundary, parcel, title or independent physical building. Status, dates, capacity and jurisdiction remain exact."
          ],
          "sources": [
            {
              "url": "https://ussignal.com/data-centers/mn01-minneapolis/",
              "host": "ussignal.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Official named facility street address block"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=10290+West+70th+Street%2C+Eden+Prairie%2C+MN+55344&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street method and limits"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 27, October 23, 2026",
          "scope": "US Signal identifies the retained MN01 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts.",
          "fields": {
            "company_association": {
              "name": "US Signal",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "US Signal identifies the retained MN01 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts."
            },
            "provider_role": "operator"
          },
          "notes": [
            "US Signal identifies the retained MN01 facility on its current provider page. Operator per source records that provider relationship. It does not establish legal property ownership, sole operation of a shared building or a separate legal operating entity. Existing identity, stage, street, county, coordinates and quantities stay unchanged. Publication date is unknown; the source check is not an opening date. Marketing service levels, certification claims and animated zero counters are not adopted as measured facility facts."
          ],
          "sources": [
            {
              "url": "https://ussignal.com/data-centers/mn01-minneapolis/",
              "host": "ussignal.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current named MN01 provider relationship"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Eden Prairie · Hennepin · Source context reviewed",
      "status_scope": "US Signal lists its specifically named MN01 facility in the Eden Prairie area as part of its current colocation infrastructure offering. Design certification is not independently audited. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "vaultas-alexandria-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Vaultas Alexandria (ALX1)",
      "group": "operating",
      "status": "Reported service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Douglas"
      ],
      "city": "Alexandria",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Vaultas Alexandria exact site versus global partner network. 1600plusglobaldata-centerlocationsarepartner/consultingaccessnotVaultasownedbuildings.500vendors/40yearsindustryexperienceothercontexts. No numericITMW,areaororiginalopening. Operatorphysicalsecuritycomplianceclaimsnotindependentrestrictedreport. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://vaultas.com/data-centers/minnesota/",
          "host": "vaultas.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=720+Hawthorne+Street%2C+Alexandria%2C+MN+56308&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Complete original literal street response and county context"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-95.38327363061849%2C45.879550288537544%2C-95.36907836938151%2C45.88943171146245&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Actually viewed source setting with unknown imagery acquisition date"
        }
      ],
      "loc": {
        "lng": -95.376176,
        "lat": 45.884491,
        "precision": "address",
        "basis": "The original Vaultas facility body explicitly identifies 720 Hawthorne Street, Alexandria, MN 56308. One unique complete literal Census street range supplies a calculated reference inside the retained county. It selects no surveyed roof, tenant floor, parcel or complete campus. Existing status group operating remains unchanged. Imagery acquisition date is unknown and may predate construction."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round10-2026-10-14.json",
          "scope": "Vaultas Alexandria exact site versus global partner network",
          "fields": {
            "operator": "Vaultas",
            "code": "ALX1",
            "address": "720 Hawthorne Street, Alexandria, Minnesota56308"
          },
          "notes": [
            "1600plusglobaldata-centerlocationsarepartner/consultingaccessnotVaultasownedbuildings.500vendors/40yearsindustryexperienceothercontexts. No numericITMW,areaororiginalopening. Operatorphysicalsecuritycomplianceclaimsnotindependentrestrictedreport.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://vaultas.com/data-centers/minnesota/",
              "host": "vaultas.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The current original Vaultas Minnesota page explicitly lists Alexandria ALX1 and describes current colocation, managed services and support. This supports reported service at the named Alexandria facility within the provider account. Broader supplier and edge location counts are not operated facility totals or proof of each deployment. No original opening day, independent security certification, full advertised capacity or measured operating performance is verified.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "original_named_current_alexandria_services",
              "scope": "The current original Vaultas Minnesota page explicitly lists Alexandria ALX1 and describes current colocation, managed services and support. This supports reported service at the named Alexandria facility within the provider account. Broader supplier and edge location counts are not operated facility totals or proof of each deployment. No original opening day, independent security certification, full advertised capacity or measured operating performance is verified."
            },
            "source_read_scope": {
              "original_named_alexandria_listing_and_current_service_sections_read": true,
              "broader_supplier_network_not_operated_site_count": true,
              "no_address_or_role_edit": true,
              "no_quantity_export": true
            }
          },
          "notes": [
            "The current original Vaultas Minnesota page explicitly lists Alexandria ALX1 and describes current colocation, managed services and support. This supports reported service at the named Alexandria facility within the provider account. Broader supplier and edge location counts are not operated facility totals or proof of each deployment. No original opening day, independent security certification, full advertised capacity or measured operating performance is verified.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://vaultas.com/data-centers/minnesota/",
              "host": "vaultas.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 57, October 23, 2026",
          "scope": "Explicit source bound calculated street reference only. Existing status group operating remains unchanged. No new computing operation, operator role, title, owner, tenant, physical milestone, quantity, certification, roof or complete campus is certified.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -95.376176,
                "lat": 45.884491,
                "precision": "address",
                "basis": "The original Vaultas facility body explicitly identifies 720 Hawthorne Street, Alexandria, MN 56308. One unique complete literal Census street range supplies a calculated reference inside the retained county. It selects no surveyed roof, tenant floor, parcel or complete campus. Existing status group operating remains unchanged. Imagery acquisition date is unknown and may predate construction."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "720 Hawthorne Street, Alexandria, MN 56308",
              "county_fips": [
                "27041"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The original provider Minnesota body explicitly labels AlexandriaALX1at720HawthorneStreet. Broad global partner and location counts do not identify additional owned buildings. Only the named facility street supplies a calculated reference, without operator ownership, title, physical stage, current availability, certification or full campus verification.",
            "Explicit source bound calculated street reference only. Existing status group operating remains unchanged. No new computing operation, operator role, title, owner, tenant, physical milestone, quantity, certification, roof or complete campus is certified.",
            "The frame shows an urban street grid, mixed commercial forms, parking and surrounding residential blocks. Only the published facility street is considered. No residential roof, tenant unit, parcel or full campus is selected.",
            "The inherited area coordinate and county display were not reviewed physical facility destinations. The original named operator facility body and complete unique literal Census street response now support only a calculated street range reference within the retained county. Earlier coordinates and complete source history remain intact. This is a reference correction, without physical relocation, a surveyed roof, new computing, title or a complete campus claim."
          ],
          "sources": [
            {
              "url": "https://vaultas.com/data-centers/minnesota/",
              "host": "vaultas.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Original named computing facility street in the operator body"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=720+Hawthorne+Street%2C+Alexandria%2C+MN+56308&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Complete original literal street response and county context"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-95.38327363061849%2C45.879550288537544%2C-95.36907836938151%2C45.88943171146245&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Actually viewed source setting with unknown imagery acquisition date"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Calculated official source street reference, not a surveyed roof or parcel",
      "summary": "Alexandria · Douglas · Source context reviewed",
      "status_scope": "The current original Vaultas Minnesota page explicitly lists Alexandria ALX1 and describes current colocation, managed services and support. This supports reported service at the named Alexandria facility within the provider account. Broader supplier and edge location counts are not operated facility totals or proof of each deployment. No original opening day, independent security certification, full advertised capacity or measured operating performance is verified."
    },
    {
      "id": "vaultas-st-cloud-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Vaultas St. Cloud",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Stearns"
      ],
      "city": "St. Cloud",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.. Preserve internal construction-status conflict and dated statements; no current operation certified.0.5 to 0.6 MW is PERMODULARNODE starting capacity, not necessarily full-site IT or current load; node count unknown. Planned opening during 2026 is unobserved. Related 100,000 dollarpartnership headline is not an examined award instrument. St.Joseph policy research, hypothetical other cities and statewide tax rules are separate contexts. Economist/utility bill-saving statements are opinions, not site-specific guaranteed tariffs or measured household savings. Later original decisions and observed outcomes take precedence; future events have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.stcloudlive.com/news/local/to-plug-in-or-not-to-plug-in-that-is-the-question-for-area-cities-about-data-centers-1",
          "host": "stcloudlive.com",
          "date": "2026-02-13",
          "published": "2026-02-13",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://vaultas.com/data-centers/minnesota/",
          "host": "vaultas.com",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 45.55216,
        "lng": -94.6134,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round33-2026-10-14.json",
          "scope": "Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.",
          "fields": {
            "reported_context": "St.CloudLive identifies Vaultas’s planned 3701 18 thStreetSouth modular-edge site and says in the developer-attributed body that construction had not yet begun, despite an introductory under-construction statement.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Preserve internal construction-status conflict and dated statements; no current operation certified.0.5 to 0.6 MW is PERMODULARNODE starting capacity, not necessarily full-site IT or current load; node count unknown. Planned opening during 2026 is unobserved. Related 100,000 dollarpartnership headline is not an examined award instrument. St.Joseph policy research, hypothetical other cities and statewide tax rules are separate contexts. Economist/utility bill-saving statements are opinions, not site-specific guaranteed tariffs or measured household savings.",
            "Later original decisions and observed outcomes take precedence; future events have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.stcloudlive.com/news/local/to-plug-in-or-not-to-plug-in-that-is-the-question-for-area-cities-about-data-centers-1",
              "host": "stcloudlive.com",
              "date": "2026-02-13",
              "published": "2026-02-13",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 58",
          "scope": "The selected current original Minnesota service page explicitly lists Alexandria but does not substantively identify St Cloud in the named facility section. Generic Minnesota service marketing and broader partner network claims do not certify current computing operation at the separate inherited St Cloud inventory point. Omission from this bounded page does not prove physical closure, a terminated lease or a provider identity change.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "state_service_page_not_exact_st_cloud_stage",
              "scope": "The selected current original Minnesota service page explicitly lists Alexandria but does not substantively identify St Cloud in the named facility section. Generic Minnesota service marketing and broader partner network claims do not certify current computing operation at the separate inherited St Cloud inventory point. Omission from this bounded page does not prove physical closure, a terminated lease or a provider identity change."
            },
            "source_read_scope": {
              "selected_current_minnesota_named_facility_section_read": true,
              "alexandria_service_not_transferred_to_st_cloud": true,
              "omission_not_physical_closure": true
            }
          },
          "notes": [
            "The selected current original Minnesota service page explicitly lists Alexandria but does not substantively identify St Cloud in the named facility section. Generic Minnesota service marketing and broader partner network claims do not certify current computing operation at the separate inherited St Cloud inventory point. Omission from this bounded page does not prove physical closure, a terminated lease or a provider identity change.",
            "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation."
          ],
          "sources": [
            {
              "url": "https://vaultas.com/data-centers/minnesota/",
              "host": "vaultas.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "St. Cloud · Stearns · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "27145"
      }
    },
    {
      "id": "ch-robinson-oronoco-mn",
      "state": "mn",
      "kind": "facility",
      "name": "C.H. Robinson Oronoco Data Center",
      "group": "unknown",
      "status": "Status unclear",
      "crypto": false,
      "type": "Data center research context",
      "counties": [
        "Olmsted"
      ],
      "city": "Oronoco",
      "address": "",
      "who": "C.H. Robinson",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "The issuer 2025 report describes separate Oronoco and Eden Prairie data centers. The report publication day and facility observation day are unknown. Current computing operation, exact street, present property ownership and opening date remain unverified.",
      "date": "",
      "events": [
        [
          "2026-10-24",
          "Added to the atlas. Admission date only, not opening or construction."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.chrobinson.com/-/media/chrglobal/documents/esg-report/chr-esg-report-english.pdf",
          "host": "www.chrobinson.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://mn.gov/deed/assets/data-center-project-list_tcm1045-531119.pdf",
          "host": "mn.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://www.raedi.com/wp-content/uploads/2015-RAEDI-Report.pdf",
          "host": "www.raedi.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://www.oronoco.com/notices-newsletters",
          "host": "www.oronoco.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        }
      ],
      "loc": {
        "lat": 44.00383,
        "lng": -92.40191,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": false,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Oronoco sourced data center research context. County level only.",
      "reviewed_evidence": [
        {
          "overlay": "Codex 5 discovery cohort 3",
          "scope": "The issuer 2025 report describes separate Oronoco and Eden Prairie data centers. The report publication day and facility observation day are unknown. Current computing operation, exact street, present property ownership and opening date remain unverified.",
          "fields": {
            "source_context": {
              "name": "C.H. Robinson Oronoco Data Center",
              "operator": "C.H. Robinson",
              "scope": "The issuer 2025 report describes separate Oronoco and Eden Prairie data centers. The report publication day and facility observation day are unknown. Current computing operation, exact street, present property ownership and opening date remain unverified.",
              "address": null,
              "exact_street_unpublished": true,
              "certification_list_date": "2026-07-15",
              "certification_source_row": 12,
              "individual_certification_date": null
            },
            "county_association": {
              "county": "Olmsted",
              "county_fips": "27109",
              "scope": "DEED and the issuer report identify Oronoco. An original City of Oronoco notice explicitly associates the city with Olmsted County. This is county context only. No point, parcel, roof, legal municipality or address correction is admitted."
            },
            "atlas_added_event": {
              "kind": "atlas_added",
              "date": "2026-10-24",
              "scope": "Actual atlas admission day only, never a physical milestone or source publication date."
            }
          },
          "notes": [
            "DEED and the issuer report identify Oronoco. An original City of Oronoco notice explicitly associates the city with Olmsted County. This is county context only. No point, parcel, roof, legal municipality or address correction is admitted.",
            "Unknown publication dates remain unknown. Certification and contractor work are not current physical stage. No quantity or site point promoted."
          ],
          "sources": [
            {
              "url": "https://www.chrobinson.com/-/media/chrglobal/documents/esg-report/chr-esg-report-english.pdf",
              "host": "www.chrobinson.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://mn.gov/deed/assets/data-center-project-list_tcm1045-531119.pdf",
              "host": "mn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://www.raedi.com/wp-content/uploads/2015-RAEDI-Report.pdf",
              "host": "www.raedi.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://www.oronoco.com/notices-newsletters",
              "host": "www.oronoco.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "no_site_point",
        "county_display": "27109"
      }
    },
    {
      "id": "epic-hosting-rochester-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Epic Hosting Rochester Data Center",
      "group": "unknown",
      "status": "Status unclear",
      "crypto": false,
      "type": "Data center research context",
      "counties": [
        "Olmsted"
      ],
      "city": "Rochester",
      "address": "",
      "who": "Epic Hosting, LLC",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "State certification and a City of Rochester map support the named data center context in Olmsted County. The city authorized a stormwater agreement on October 21, 2024; the attached draft has blank execution dates. This does not establish computing operation, generator delivery or facility opening.",
      "date": "",
      "events": [
        [
          "2026-10-24",
          "Added to the atlas. Admission date only, not opening or construction."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://mn.gov/deed/assets/data-center-project-list_tcm1045-531119.pdf",
          "host": "mn.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://mbrweb.ferc.gov/SearchlkpEIA/Index?page=525",
          "host": "mbrweb.ferc.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://rochestermn.granicus.com/MinutesViewer.php?clip_id=4417&doc_id=2c1c3f8d-90aa-11ef-ab4b-005056a89546&view_id=1",
          "host": "rochestermn.granicus.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://rochestermn.granicus.com/MetaViewer.php?view_id=1&clip_id=4417&meta_id=105009",
          "host": "rochestermn.granicus.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://rochestermn.granicus.com/MetaViewer.php?view_id=1&clip_id=4417&meta_id=105008",
          "host": "rochestermn.granicus.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        }
      ],
      "loc": {
        "lat": 44.01604,
        "lng": -92.41525,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": false,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Rochester sourced data center research context. County level only.",
      "reviewed_evidence": [
        {
          "overlay": "Codex 5 discovery cohort 3",
          "scope": "State certification and a City of Rochester map support the named data center context in Olmsted County. The city authorized a stormwater agreement on October 21, 2024; the attached draft has blank execution dates. This does not establish computing operation, generator delivery or facility opening.",
          "fields": {
            "source_context": {
              "name": "Epic Hosting Rochester Data Center",
              "operator": "Epic Hosting, LLC",
              "scope": "State certification and a City of Rochester map support the named data center context in Olmsted County. The city authorized a stormwater agreement on October 21, 2024; the attached draft has blank execution dates. This does not establish computing operation, generator delivery or facility opening.",
              "address": null,
              "exact_street_unpublished": true,
              "certification_list_date": "2026-07-15",
              "certification_source_row": 14,
              "individual_certification_date": null
            },
            "county_association": {
              "county": "Olmsted",
              "county_fips": "27109",
              "scope": "The original city agreement identifies Epic Hosting property at Lot 2, Block 1, 4710 Technology Park in Olmsted County. The city map labels Epic Data Center beside West Circle Drive Northwest. Exact street number and property geometry are not adopted. This is county context only. No point, parcel, roof, legal municipality or address correction is admitted."
            },
            "atlas_added_event": {
              "kind": "atlas_added",
              "date": "2026-10-24",
              "scope": "Actual atlas admission day only, never a physical milestone or source publication date."
            }
          },
          "notes": [
            "The original city agreement identifies Epic Hosting property at Lot 2, Block 1, 4710 Technology Park in Olmsted County. The city map labels Epic Data Center beside West Circle Drive Northwest. Exact street number and property geometry are not adopted. This is county context only. No point, parcel, roof, legal municipality or address correction is admitted.",
            "Unknown publication dates remain unknown. Certification and contractor work are not current physical stage. No quantity or site point promoted."
          ],
          "sources": [
            {
              "url": "https://mn.gov/deed/assets/data-center-project-list_tcm1045-531119.pdf",
              "host": "mn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://mbrweb.ferc.gov/SearchlkpEIA/Index?page=525",
              "host": "mbrweb.ferc.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://rochestermn.granicus.com/MinutesViewer.php?clip_id=4417&doc_id=2c1c3f8d-90aa-11ef-ab4b-005056a89546&view_id=1",
              "host": "rochestermn.granicus.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://rochestermn.granicus.com/MetaViewer.php?view_id=1&clip_id=4417&meta_id=105009",
              "host": "rochestermn.granicus.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://rochestermn.granicus.com/MetaViewer.php?view_id=1&clip_id=4417&meta_id=105008",
              "host": "rochestermn.granicus.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "no_site_point",
        "county_display": "27109"
      }
    },
    {
      "id": "best-buy-bloomington-data-center-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Best Buy Bloomington Data Center",
      "group": "unknown",
      "status": "Status unclear",
      "crypto": false,
      "type": "Data center research context",
      "counties": [
        "Hennepin"
      ],
      "city": "Bloomington",
      "address": "",
      "who": "Best Buy Company, Inc.",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "State certification, a historical contractor project and a historical county water permit identify the named Bloomington data center. The contractor completion month covers its work scope. Current computing operation, first opening, street and water use remain unverified; adjacent distribution warehouses are not additional data centers.",
      "date": "",
      "events": [
        [
          "2026-10-24",
          "Added to the atlas. Admission date only, not opening or construction."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://mn.gov/deed/assets/data-center-project-list_tcm1045-531119.pdf",
          "host": "mn.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://www.mortenson.com/projects/best-buy-data-center",
          "host": "www.mortenson.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://files.dnr.state.mn.us/waters/watermgmt_section/appropriations/index-county-location-active.pdf",
          "host": "files.dnr.state.mn.us",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        }
      ],
      "loc": {
        "lat": 45.02021,
        "lng": -93.49362,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": false,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Bloomington sourced data center research context. County level only.",
      "reviewed_evidence": [
        {
          "overlay": "Codex 5 discovery cohort 3",
          "scope": "State certification, a historical contractor project and a historical county water permit identify the named Bloomington data center. The contractor completion month covers its work scope. Current computing operation, first opening, street and water use remain unverified; adjacent distribution warehouses are not additional data centers.",
          "fields": {
            "source_context": {
              "name": "Best Buy Bloomington Data Center",
              "operator": "Best Buy Company, Inc.",
              "scope": "State certification, a historical contractor project and a historical county water permit identify the named Bloomington data center. The contractor completion month covers its work scope. Current computing operation, first opening, street and water use remain unverified; adjacent distribution warehouses are not additional data centers.",
              "address": null,
              "exact_street_unpublished": true,
              "certification_list_date": "2026-07-15",
              "certification_source_row": 18,
              "individual_certification_date": null
            },
            "county_association": {
              "county": "Hennepin",
              "county_fips": "27053",
              "scope": "DEED and the contractor name the data center in Bloomington. The historical DNR index lists its named permit under Hennepin County. This does not verify a current permit or resource outcome. This is county context only. No point, parcel, roof, legal municipality or address correction is admitted."
            },
            "atlas_added_event": {
              "kind": "atlas_added",
              "date": "2026-10-24",
              "scope": "Actual atlas admission day only, never a physical milestone or source publication date."
            }
          },
          "notes": [
            "DEED and the contractor name the data center in Bloomington. The historical DNR index lists its named permit under Hennepin County. This does not verify a current permit or resource outcome. This is county context only. No point, parcel, roof, legal municipality or address correction is admitted.",
            "Unknown publication dates remain unknown. Certification and contractor work are not current physical stage. No quantity or site point promoted."
          ],
          "sources": [
            {
              "url": "https://mn.gov/deed/assets/data-center-project-list_tcm1045-531119.pdf",
              "host": "mn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://www.mortenson.com/projects/best-buy-data-center",
              "host": "www.mortenson.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://files.dnr.state.mn.us/waters/watermgmt_section/appropriations/index-county-location-active.pdf",
              "host": "files.dnr.state.mn.us",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "no_site_point",
        "county_display": "27053"
      }
    },
    {
      "id": "fastenal-winona-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Fastenal Winona Data Center",
      "group": "unknown",
      "status": "Status unclear",
      "crypto": false,
      "type": "Data center research context",
      "counties": [
        "Winona"
      ],
      "city": "Winona",
      "address": "",
      "who": "Fastenal Co.",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "The state register identifies a certified Winona refurbishment project. An issuer hosted information security certificate associates data center services with its Theurer Boulevard activity location. That association is not certification of a separate physical building, current computing operation or an opening date.",
      "date": "",
      "events": [
        [
          "2026-10-24",
          "Added to the atlas. Admission date only, not opening or construction."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://mn.gov/deed/assets/data-center-project-list_tcm1045-531119.pdf",
          "host": "mn.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://crafter.fastenal.com/static-assets/pdfs/fcom/2025/q2/21-fastenal-2025-iso-27001_2022-2025-certificate-anab.pdf",
          "host": "crafter.fastenal.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2001+Theurer+Boulevard%2C+Winona%2C+MN+55987&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        }
      ],
      "loc": {
        "lat": 43.98682,
        "lng": -91.77923,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": false,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Winona sourced data center research context. County level only.",
      "reviewed_evidence": [
        {
          "overlay": "Codex 5 discovery cohort 3",
          "scope": "The state register identifies a certified Winona refurbishment project. An issuer hosted information security certificate associates data center services with its Theurer Boulevard activity location. That association is not certification of a separate physical building, current computing operation or an opening date.",
          "fields": {
            "source_context": {
              "name": "Fastenal Winona Data Center",
              "operator": "Fastenal Co.",
              "scope": "The state register identifies a certified Winona refurbishment project. An issuer hosted information security certificate associates data center services with its Theurer Boulevard activity location. That association is not certification of a separate physical building, current computing operation or an opening date.",
              "address": null,
              "exact_street_unpublished": true,
              "certification_list_date": "2026-07-15",
              "certification_source_row": 40,
              "individual_certification_date": null
            },
            "county_association": {
              "county": "Winona",
              "county_fips": "27169",
              "scope": "DEED names the Winona project. The issuer hosted certificate explicitly associates data center services with 2001 Theurer Boulevard. A unique literal Census match places that activity address in Winona County; this does not certify the computing building footprint. This is county context only. No point, parcel, roof, legal municipality or address correction is admitted."
            },
            "atlas_added_event": {
              "kind": "atlas_added",
              "date": "2026-10-24",
              "scope": "Actual atlas admission day only, never a physical milestone or source publication date."
            }
          },
          "notes": [
            "DEED names the Winona project. The issuer hosted certificate explicitly associates data center services with 2001 Theurer Boulevard. A unique literal Census match places that activity address in Winona County; this does not certify the computing building footprint. This is county context only. No point, parcel, roof, legal municipality or address correction is admitted.",
            "Unknown publication dates remain unknown. Certification and contractor work are not current physical stage. No quantity or site point promoted."
          ],
          "sources": [
            {
              "url": "https://mn.gov/deed/assets/data-center-project-list_tcm1045-531119.pdf",
              "host": "mn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://crafter.fastenal.com/static-assets/pdfs/fcom/2025/q2/21-fastenal-2025-iso-27001_2022-2025-certificate-anab.pdf",
              "host": "crafter.fastenal.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2001+Theurer+Boulevard%2C+Winona%2C+MN+55987&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "no_site_point",
        "county_display": "27169"
      }
    },
    {
      "id": "prudential-plymouth-data-center-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Prudential Plymouth Data Center",
      "group": "unknown",
      "status": "Status unclear",
      "crypto": false,
      "type": "Data center research context",
      "counties": [
        "Hennepin"
      ],
      "city": "Plymouth",
      "address": "",
      "who": "Prudential Financial",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "The state register and electrical contractor identify a Prudential data center in Plymouth. Publication dates, exact street, current computing stage and opening date are unknown. The former Prudential office redevelopment is not equated to this facility.",
      "date": "",
      "events": [
        [
          "2026-10-24",
          "Added to the atlas. Admission date only, not opening or construction."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://mn.gov/deed/assets/data-center-project-list_tcm1045-531119.pdf",
          "host": "mn.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://collinsmn.com/portfolio-item/prudential-data-center/",
          "host": "collinsmn.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://www.hennepin.us/-/media/hennepinus/business/work-with-hennepin-county/federal-housing-programs/Consolidated-Pool-Cities-2025.pdf",
          "host": "www.hennepin.us",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        }
      ],
      "loc": {
        "lat": 45.03634,
        "lng": -93.45229,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": false,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Plymouth sourced data center research context. County level only.",
      "reviewed_evidence": [
        {
          "overlay": "Codex 5 discovery cohort 3",
          "scope": "The state register and electrical contractor identify a Prudential data center in Plymouth. Publication dates, exact street, current computing stage and opening date are unknown. The former Prudential office redevelopment is not equated to this facility.",
          "fields": {
            "source_context": {
              "name": "Prudential Plymouth Data Center",
              "operator": "Prudential Financial",
              "scope": "The state register and electrical contractor identify a Prudential data center in Plymouth. Publication dates, exact street, current computing stage and opening date are unknown. The former Prudential office redevelopment is not equated to this facility.",
              "address": null,
              "exact_street_unpublished": true,
              "certification_list_date": "2026-07-15",
              "certification_source_row": 13,
              "individual_certification_date": null
            },
            "county_association": {
              "county": "Hennepin",
              "county_fips": "27053",
              "scope": "DEED and the contractor identify the named data center in Plymouth, Minnesota. The official Hennepin County map places Plymouth within the county. Exact street and phase remain unknown. This is county context only. No point, parcel, roof, legal municipality or address correction is admitted."
            },
            "atlas_added_event": {
              "kind": "atlas_added",
              "date": "2026-10-24",
              "scope": "Actual atlas admission day only, never a physical milestone or source publication date."
            }
          },
          "notes": [
            "DEED and the contractor identify the named data center in Plymouth, Minnesota. The official Hennepin County map places Plymouth within the county. Exact street and phase remain unknown. This is county context only. No point, parcel, roof, legal municipality or address correction is admitted.",
            "Unknown publication dates remain unknown. Certification and contractor work are not current physical stage. No quantity or site point promoted."
          ],
          "sources": [
            {
              "url": "https://mn.gov/deed/assets/data-center-project-list_tcm1045-531119.pdf",
              "host": "mn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://collinsmn.com/portfolio-item/prudential-data-center/",
              "host": "collinsmn.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://www.hennepin.us/-/media/hennepinus/business/work-with-hennepin-county/federal-housing-programs/Consolidated-Pool-Cities-2025.pdf",
              "host": "www.hennepin.us",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "no_site_point",
        "county_display": "27053"
      }
    },
    {
      "id": "toro-bloomington-data-center-mn",
      "state": "mn",
      "kind": "facility",
      "name": "Toro Company Bloomington Data Center",
      "group": "unknown",
      "status": "Status unclear",
      "crypto": false,
      "type": "Data center research context",
      "counties": [
        "Hennepin"
      ],
      "city": "Bloomington",
      "address": "",
      "who": "Toro Company",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "The state register names a certified data center refurbishment project in Bloomington. Individual certification date, exact street, current computing stage and opening date are unknown. No headquarters location, equipment sale or realized tax benefit is inferred.",
      "date": "",
      "events": [
        [
          "2026-10-24",
          "Added to the atlas. Admission date only, not opening or construction."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://mn.gov/deed/assets/data-center-project-list_tcm1045-531119.pdf",
          "host": "mn.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        },
        {
          "url": "https://www.hennepin.us/-/media/hennepinus/business/work-with-hennepin-county/federal-housing-programs/Consolidated-Pool-Cities-2025.pdf",
          "host": "www.hennepin.us",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed primary project or county context"
        }
      ],
      "loc": {
        "lat": 44.97694,
        "lng": -93.43308,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": false,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Bloomington sourced data center research context. County level only.",
      "reviewed_evidence": [
        {
          "overlay": "Codex 5 discovery cohort 3",
          "scope": "The state register names a certified data center refurbishment project in Bloomington. Individual certification date, exact street, current computing stage and opening date are unknown. No headquarters location, equipment sale or realized tax benefit is inferred.",
          "fields": {
            "source_context": {
              "name": "Toro Company Bloomington Data Center",
              "operator": "Toro Company",
              "scope": "The state register names a certified data center refurbishment project in Bloomington. Individual certification date, exact street, current computing stage and opening date are unknown. No headquarters location, equipment sale or realized tax benefit is inferred.",
              "address": null,
              "exact_street_unpublished": true,
              "certification_list_date": "2026-07-15",
              "certification_source_row": 19,
              "individual_certification_date": null
            },
            "county_association": {
              "county": "Hennepin",
              "county_fips": "27053",
              "scope": "DEED names the data center refurbishment project in Bloomington. The official Hennepin County map places Bloomington within the county. Exact street remains unknown. This is county context only. No point, parcel, roof, legal municipality or address correction is admitted."
            },
            "atlas_added_event": {
              "kind": "atlas_added",
              "date": "2026-10-24",
              "scope": "Actual atlas admission day only, never a physical milestone or source publication date."
            }
          },
          "notes": [
            "DEED names the data center refurbishment project in Bloomington. The official Hennepin County map places Bloomington within the county. Exact street remains unknown. This is county context only. No point, parcel, roof, legal municipality or address correction is admitted.",
            "Unknown publication dates remain unknown. Certification and contractor work are not current physical stage. No quantity or site point promoted."
          ],
          "sources": [
            {
              "url": "https://mn.gov/deed/assets/data-center-project-list_tcm1045-531119.pdf",
              "host": "mn.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            },
            {
              "url": "https://www.hennepin.us/-/media/hennepinus/business/work-with-hennepin-county/federal-housing-programs/Consolidated-Pool-Cities-2025.pdf",
              "host": "www.hennepin.us",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed primary project or county context"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "no_site_point",
        "county_display": "27053"
      }
    }
  ],
  "compilation_license": "withheld_pending_owner_decision"
}