{ "schema_version": 1, "source_compilation_context": { "nc": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/nc.json", "updated": "2026-10-25" } }, "scope": "Source compiled state collection. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.", "collection": { "kind": "states", "key": "nc", "label": "North Carolina" }, "records": [ { "id": "advanced-internet-technologies-fayetteville-nc", "state": "nc", "kind": "facility", "name": "Advanced Internet Technologies (AIT) Fayetteville Data Center", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Cumberland" ], "city": "Fayetteville", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named original operator, government announcement or original reported project context.. Paul Woolverton, CityView, January27,2026 original report (updated May21) identifies AIT existing headquarters data center at Hay Street/Maiden Lane. Company founding in the1990s does not date that physical opening; present operating condition is not independently inspected. Separate Terra Nexus200MW/180acre Custer Avenue proposal and Energy Storage Solutions300MW/50acre/6.4B Dunn Road brochure are NOT AIT capacity/capex. Economic-development executive says Dunn Road was never under contract and surprised the landowner. No closed land deal, committed IT basis or completed new campus inferred. Plan C Crypto2022 Dedication Drive opening is another operator, not AIT. January29 informational seminar is historical, not an upcoming2026October hearing. Plans, historical dates, measurement basis and permit stage remain scoped; not current operation or all-field certification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.cityviewnc.com/stories/how-to-learn-more-about-data-centers-in-fayetteville/", "host": "cityviewnc.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.ait.com/colocation/", "host": "www.ait.com", "published": "", "date": "", "checked": "2026-10-18", "label": "Current operator service and facility identity" }, { "url": "https://www.ait.com/company/", "host": "www.ait.com", "published": "", "date": "", "checked": "2026-10-18", "label": "Current operator service and facility identity" } ], "loc": { "lat": 35.0486, "lng": -78.82766, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-original-proposals-and-pollutant-correction-round75-2026-10-15.json", "scope": "Named original operator, government announcement or original reported project context.", "fields": {}, "notes": [ "Paul Woolverton, CityView, January27,2026 original report (updated May21) identifies AIT existing headquarters data center at Hay Street/Maiden Lane. Company founding in the1990s does not date that physical opening; present operating condition is not independently inspected.", "Separate Terra Nexus200MW/180acre Custer Avenue proposal and Energy Storage Solutions300MW/50acre/6.4B Dunn Road brochure are NOT AIT capacity/capex. Economic-development executive says Dunn Road was never under contract and surprised the landowner. No closed land deal, committed IT basis or completed new campus inferred. Plan C Crypto2022 Dedication Drive opening is another operator, not AIT. January29 informational seminar is historical, not an upcoming2026October hearing.", "Plans, historical dates, measurement basis and permit stage remain scoped; not current operation or all-field certification." ], "sources": [ { "url": "https://www.cityviewnc.com/stories/how-to-learn-more-about-data-centers-in-fayetteville/", "host": "cityviewnc.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "current-service-2026-10-18", "scope": "AIT currently offers colocation and explicitly identifies its data-center service in Fayetteville, North Carolina. This supports qualified operator-listed service, not a commissioning date, actual IT load, independently audited uptime, ownership title or surveyed parcel.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_current_colocation_service", "scope": "AIT currently offers colocation and explicitly identifies its data-center service in Fayetteville, North Carolina. This supports qualified operator-listed service, not a commissioning date, actual IT load, independently audited uptime, ownership title or surveyed parcel." } }, "notes": [ "Both undated original operator main bodies read. Copyright and company founding year are not source publication or first operation dates. Quantities, certifications, customer testimonials, ownership title and parcel/entrance accuracy are not adopted. Separate Custer Avenue/Dunn Road proposals are not AIT facilities." ], "sources": [ { "url": "https://www.ait.com/colocation/", "host": "www.ait.com", "published": "", "date": "", "checked": "2026-10-18", "label": "Current operator service and facility identity" }, { "url": "https://www.ait.com/company/", "host": "www.ait.com", "published": "", "date": "", "checked": "2026-10-18", "label": "Current operator service and facility identity" } ], "checked": "2026-10-18", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Fayetteville · Cumberland · Source context reviewed", "status_scope": "AIT currently offers colocation and explicitly identifies its data-center service in Fayetteville, North Carolina. This supports qualified operator-listed service, not a commissioning date, actual IT load, independently audited uptime, ownership title or surveyed parcel.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37051" } }, { "id": "aws-richmond-county-nc", "state": "nc", "kind": "facility", "name": "Amazon Web Services Richmond County Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Richmond" ], "city": "Rockingham", "address": "", "who": "Amazon", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named government source. June26draft-permit hearing notice not final permit or operating proof as ofOctober14. Engine counts and backup versus bridge power are not campus IT MW and not normally concurrent. Hearing announcement not observed hearing outcome. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.deq.nc.gov/news/press-releases/2026/06/26/deq-announces-joint-public-hearing-amazon-data-center-and-duke-energy-air-quality-permits-richmond", "host": "deq.nc.gov", "date": "2026-06-26", "published": "2026-06-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.deq.nc.gov/news/events/public-hearing-preliminary-determination-air-quality-permit-applications-amazon-data-services-and", "host": "www.deq.nc.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Original notice expressly separates Amazon computing and Duke power streets" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=198+Energy+Way%2C+Hamlet%2C+NC+28345&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete unique literal 198 Energy Way street response" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-79.74228547430411%2C34.83131928853755%2C-79.73024652569589%2C34.841200711462456&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed source setting, acquisition date unknown" }, { "url": "https://www.aboutamazon.com/news/aws/aws-investment-north-carolina-ai-cloud-infrastructure", "host": "www.aboutamazon.com", "published": "2025-06-04", "date": "2025-06-04", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lng": -79.736266, "lat": 34.83626, "precision": "address", "basis": "The original North Carolina agency notice explicitly identifies the Amazon computing project at 198 Energy Way, Hamlet, NC 28345, separately from the Duke power facility at 1761 Airport Road. One complete unique literal Census street range gives a calculated reference inside Richmond County. The nearby energy complex is excluded as a computing building. Existing status group unknown remains unchanged. No surveyed roof, legal title or complete campus is selected. Imagery acquisition date is unknown and may predate construction." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "named government source", "fields": { "project_name": "Energy Way Tech Campus", "published_location": "Airport Road, Hamlet, Richmond County, North Carolina", "hearing_scheduled_date": "2026-07-30", "hearing_scheduled_local_time": "18:00", "comment_deadline": "2026-07-31", "proposed_duke_bridge_diesel_engines": 57, "proposed_amazon_emergency_diesel_engines": 588, "bridge_retirement_requirement_after_operation_years": 1 }, "notes": [ "June26draft-permit hearing notice not final permit or operating proof as ofOctober14. Engine counts and backup versus bridge power are not campus IT MW and not normally concurrent. Hearing announcement not observed hearing outcome.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.deq.nc.gov/news/press-releases/2026/06/26/deq-announces-joint-public-hearing-amazon-data-center-and-duke-energy-air-quality-permits-richmond", "host": "deq.nc.gov", "date": "2026-06-26", "published": "2026-06-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 60, 2026-10-24", "scope": "Explicit computing source identity and calculated Census street range only. Existing status group unknown remains unchanged. No current computing operation, surveyed roof, legal title, tenant, role, physical milestone, technical quantity or complete campus is certified.", "fields": { "location_review_decision": { "location": { "lng": -79.736266, "lat": 34.83626, "precision": "address", "basis": "The original North Carolina agency notice explicitly identifies the Amazon computing project at 198 Energy Way, Hamlet, NC 28345, separately from the Duke power facility at 1761 Airport Road. One complete unique literal Census street range gives a calculated reference inside Richmond County. The nearby energy complex is excluded as a computing building. Existing status group unknown remains unchanged. No surveyed roof, legal title or complete campus is selected. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "198 Energy Way, Hamlet, NC 28345", "county_fips": [ "37153" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "Original agency notice explicitly orders Amazon computing address 198 Energy Way before the separate Duke 1761 Airport Road power facility. The unique Census street endpoint inside Richmond is a calculated range only. Power plant, hearing venue and agency offices are excluded. No computing roof, current operation, legal title, complete campus or approval event is inferred.", "Explicit computing source identity and calculated Census street range only. Existing status group unknown remains unchanged. No current computing operation, surveyed roof, legal title, tenant, role, physical milestone, technical quantity or complete campus is certified.", "The actual source frame shows an existing industrial energy complex to the northwest, a road through the center and extensive wooded areas south and east. The literal Census endpoint is a calculated street range only. The nearby power complex is not selected as a computing building, and this image does not establish a current computing campus or construction date.", "The inherited general area coordinate was not a reviewed computing property destination. The independently named original government computing street and complete unique literal Census street response support this bounded reference inside the retained county. The measured inherited point offset is 12543.5 metres. All predecessor coordinates and source versions remain in history. This is a reference correction without physical relocation, a new computing event, selected roof, ownership, current operation or whole campus certification." ], "sources": [ { "url": "https://www.deq.nc.gov/news/events/public-hearing-preliminary-determination-air-quality-permit-applications-amazon-data-services-and", "host": "www.deq.nc.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Original notice expressly separates Amazon computing and Duke power streets" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=198+Energy+Way%2C+Hamlet%2C+NC+28345&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete unique literal 198 Energy Way street response" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-79.74228547430411%2C34.83131928853755%2C-79.73024652569589%2C34.841200711462456&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed source setting, acquisition date unknown" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Company role source check69, October24,2026", "scope": "The June 4, 2025 Amazon announcement identifies its planned AWS infrastructure investment in Richmond County. Developer per source means the named project proponent, not an identified construction contractor, property title or proof of all planned buildings being complete. Statewide investment, job and energy totals are not allocated to this record. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred.", "fields": { "company_association": { "name": "Amazon", "role": "developer", "identity_scope": "provider_brand_only", "scope": "The June 4, 2025 Amazon announcement identifies its planned AWS infrastructure investment in Richmond County. Developer per source means the named project proponent, not an identified construction contractor, property title or proof of all planned buildings being complete. Statewide investment, job and energy totals are not allocated to this record. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred." }, "provider_role": "developer" }, "notes": [ "The June 4, 2025 Amazon announcement identifies its planned AWS infrastructure investment in Richmond County. Developer per source means the named project proponent, not an identified construction contractor, property title or proof of all planned buildings being complete. Statewide investment, job and energy totals are not allocated to this record. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/aws-investment-north-carolina-ai-cloud-infrastructure", "host": "www.aboutamazon.com", "published": "2025-06-04", "date": "2025-06-04", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Calculated street reference, not a roof or complete campus", "summary": "Rockingham · Richmond · Source context reviewed" }, { "id": "american-tower-reedy-creek-charlotte-nc", "state": "nc", "kind": "facility", "name": "American Tower Reedy Creek Data Center (East Charlotte)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Mecklenburg" ], "city": "Charlotte", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Charlotte ReedyCreek deferred hearing and community concerns. April23report of postponement not current2026finaldecision.2percentofhyperscalepower lacks numeric reference/boundary, not usable IT MW.15protesters reported not total opposition count. Residents concerns not measured violations.10DCacres subset58parentland. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wfae.org/energy-environment/2026-04-23/east-charlotte-residents-protest-data-center-development-during-rezoning-hearing", "host": "wfae.org", "date": "2026-04-23", "published": "2026-04-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 35.24672, "lng": -80.83279, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round13-2026-10-14.json", "scope": "Charlotte ReedyCreek deferred hearing and community concerns", "fields": { "project_company": "American Tower", "location": "near ReedyCreek Nature Preserve, east Charlotte, North Carolina", "reported_data_center_acres": 10, "broader_owned_property_acres": 58, "reported_stage_asof": "rezoning hearing deferred to following month" }, "notes": [ "April23report of postponement not current2026finaldecision.2percentofhyperscalepower lacks numeric reference/boundary, not usable IT MW.15protesters reported not total opposition count. Residents concerns not measured violations.10DCacres subset58parentland.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.wfae.org/energy-environment/2026-04-23/east-charlotte-residents-protest-data-center-development-during-rezoning-hearing", "host": "wfae.org", "date": "2026-04-23", "published": "2026-04-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Charlotte · Mecklenburg · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37119" } }, { "id": "apple-maiden-nc", "state": "nc", "kind": "facility", "name": "Apple Maiden Data Center (iCloud)", "group": "operating", "status": "Company reported operation", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Catawba" ], "city": "Maiden", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. 20 MWsolar and 5 MWfuel-cell descriptions are GENERATION, not campuscriticalIT or added computing capacity.84 millionkWh is forecastANNUALENERGYfor two arrays, not MW. May 14 staffconference/May 17 certificate issuance are 2012 events; November/December 2012 construction/operation dates are forecasts, not 2026 availability. PrimaryNCUCcertificate linked but not separately examined in this pass. No current grid mix, fullrenewablesmatching or operating capacity certified. Automated unrelated-story selection corrected from retained main body. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://9to5mac.com/2012/05/17/apples-20-megawatt-solar-farm-near-nc-data-center-gets-ncuc-approval/", "host": "9to5mac.com", "date": "2012-05-17", "published": "2012-05-17", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.apple.com/environment/pdf/Apple_Environmental_Progress_Report_2026.pdf", "host": "www.apple.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://inspector.catawbacountync.gov/Tidemark/crreports/reportdump/CRReports_74.7.229.228_74.7.229.228_rtaxoccupancy.rpt20260413053515.pdf", "host": "inspector.catawbacountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Original explicit computing facility street" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=5977+Startown+Rd%2C+Maiden%2C+NC+28650&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete literal street response and exact county context" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-81.26276351799318%2C35.58366628853755%2C-81.25061248200682%2C35.593547711462456&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed source setting with unknown imagery acquisition date" } ], "loc": { "lng": -81.256688, "lat": 35.588607, "precision": "address", "basis": "The original Catawba County computing facility source explicitly identifies 5977 Startown Rd, Maiden, NC 28650. One unique complete literal Census street range supplies a calculated reference inside the retained county. It selects no surveyed roof, tenant floor, parcel or complete campus. Existing status group operating remains unchanged. Imagery acquisition date is unknown and may predate construction." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "9 to 5 Mac’s historical account quotes NCUC approval/certificate for Apple’s proposed 20 MWsolar generating facility near Maiden.", "independently_verified_current_operating_status": null }, "notes": [ "20 MWsolar and 5 MWfuel-cell descriptions are GENERATION, not campuscriticalIT or added computing capacity.84 millionkWh is forecastANNUALENERGYfor two arrays, not MW. May 14 staffconference/May 17 certificate issuance are 2012 events; November/December 2012 construction/operation dates are forecasts, not 2026 availability. PrimaryNCUCcertificate linked but not separately examined in this pass. No current grid mix, fullrenewablesmatching or operating capacity certified. Automated unrelated-story selection corrected from retained main body.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://9to5mac.com/2012/05/17/apples-20-megawatt-solar-farm-near-nc-data-center-gets-ncuc-approval/", "host": "9to5mac.com", "date": "2012-05-17", "published": "2012-05-17", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 39", "scope": "Apple 2026 Environmental Progress Report explicitly identifies Maiden among the data centers it owns and operates, and its named Maiden appendix reports 2025 electricity use and current building cooling context. Company reported operation is limited to that named campus account. It does not certify all future expansion phases, measured environmental benefits, an exact physical opening day or independent technical verification. The report gives only June 2010 for historic opening, so no day is invented. No energy, cooling, ownership or capacity field is promoted.", "fields": { "current_stage_evidence": { "outcome": "current_company_report_named_maiden_computing_campus", "scope": "Apple 2026 Environmental Progress Report explicitly identifies Maiden among the data centers it owns and operates, and its named Maiden appendix reports 2025 electricity use and current building cooling context. Company reported operation is limited to that named campus account. It does not certify all future expansion phases, measured environmental benefits, an exact physical opening day or independent technical verification. The report gives only June 2010 for historic opening, so no day is invented. No energy, cooling, ownership or capacity field is promoted." } }, "notes": [ "Apple 2026 Environmental Progress Report explicitly identifies Maiden among the data centers it owns and operates, and its named Maiden appendix reports 2025 electricity use and current building cooling context. Company reported operation is limited to that named campus account. It does not certify all future expansion phases, measured environmental benefits, an exact physical opening day or independent technical verification. The report gives only June 2010 for historic opening, so no day is invented. No energy, cooling, ownership or capacity field is promoted.", "Existing identities, roles, locations, jurisdictions, quantities and physical opening fields remain exact. Source publication, check dates, forecasts and physical milestones have distinct meanings." ], "sources": [ { "url": "https://www.apple.com/environment/pdf/Apple_Environmental_Progress_Report_2026.pdf", "host": "www.apple.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 58, October 23, 2026", "scope": "Explicit source bound calculated street reference only. Existing status group operating remains unchanged. No new computing operation, operator role, title, owner, tenant, physical milestone, quantity, certification, roof or complete campus is certified.", "fields": { "location_review_decision": { "location": { "lng": -81.256688, "lat": 35.588607, "precision": "address", "basis": "The original Catawba County computing facility source explicitly identifies 5977 Startown Rd, Maiden, NC 28650. One unique complete literal Census street range supplies a calculated reference inside the retained county. It selects no surveyed roof, tenant floor, parcel or complete campus. Existing status group operating remains unchanged. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "5977 Startown Rd, Maiden, NC 28650", "county_fips": [ "37035" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The original county tax occupancy report for BLDC-05-2022-171970 explicitly labels5977STARTOWNRD as the street for the computing building and property3627-11-76-0090. Apple owner mail6028StartownRoad, the architect, lien agent and contractor streets are excluded. Printed applied and issuedMay20,2022,C/OorfinalOctober5,2022andgeneratedApril13,2026are separate record clocks, without a new current service, opening, title or entire campus determination. A historical independent water auditor repeats5977but its July12,2026validity endpoint does not establish current certification. Source rounded coordinates and solar asset street reporting are not adopted.", "Explicit source bound calculated street reference only. Existing status group operating remains unchanged. No new computing operation, operator role, title, owner, tenant, physical milestone, quantity, certification, roof or complete campus is certified.", "Actually viewed unknown age official setting shows several large roofs west of the street and a broad solar array east of it, with multiple smaller utility structures. No solar field, roof, neighboring driveway or complete campus is selected. The Census street range is not a surveyed building point.", "The inherited area coordinate and county display were not reviewed physical facility destinations. The original explicitly named computing facility street and complete unique literal Census response now support only a calculated street range reference inside the retained county. Earlier coordinates and complete source history remain intact. This corrects the reference without physical relocation, a surveyed roof, new computing, title or complete campus certification." ], "sources": [ { "url": "https://inspector.catawbacountync.gov/Tidemark/crreports/reportdump/CRReports_74.7.229.228_74.7.229.228_rtaxoccupancy.rpt20260413053515.pdf", "host": "inspector.catawbacountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Original explicit computing facility street" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=5977+Startown+Rd%2C+Maiden%2C+NC+28650&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete literal street response and exact county context" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-81.26276351799318%2C35.58366628853755%2C-81.25061248200682%2C35.593547711462456&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed source setting with unknown imagery acquisition date" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Calculated official source street reference, not a surveyed roof or parcel", "summary": "Maiden · Catawba · Source context reviewed", "status_scope": "Apple 2026 Environmental Progress Report explicitly identifies Maiden among the data centers it owns and operates, and its named Maiden appendix reports 2025 electricity use and current building cooling context. Company reported operation is limited to that named campus account. It does not certify all future expansion phases, measured environmental benefits, an exact physical opening day or independent technical verification. The report gives only June 2010 for historic opening, so no day is invented. No energy, cooling, ownership or capacity field is promoted." }, { "id": "compass-statesville-nc", "state": "nc", "kind": "facility", "name": "Compass Statesville Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Iredell" ], "city": "Statesville", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Namedoriginalprojectparticipant,issuer,localreporterororiginalcourtcopy; transaction/stage/datescoped.. WBTV MaryCalkins September16,2025 reports StatesvilleCouncil unanimously ADVANCED Compass rezoning, with secondreading/finalvote still scheduledOctober1. Headlineapproved mustnotbecome finaladoption/allpermits. Laterfinalvote/closing/currentconstruction outcome unverified. 365acres/fivebuildings nearStameyFarmRd/I40/HickoryHighway are proposal figures; no siteMW or executedlandpurchase shown. Neighbor fears and developer mitigation assertions retain attribution, notobservedpollution or compliance. OnecampusnotfiveindependentfacilityIDs. Noallfield,currentoperatingbuilding,actualimpact,executedcontractorpaidfundscertification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wbtv.com/2025/09/16/statesville-city-council-approves-rezoning-request-new-data-center/", "host": "wbtv.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 35.80699, "lng": -80.87319, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-original-transactions-and-legal-stage-review-round73-2026-10-15.json", "scope": "Namedoriginalprojectparticipant,issuer,localreporterororiginalcourtcopy; transaction/stage/datescoped.", "fields": {}, "notes": [ "WBTV MaryCalkins September16,2025 reports StatesvilleCouncil unanimously ADVANCED Compass rezoning, with secondreading/finalvote still scheduledOctober1. Headlineapproved mustnotbecome finaladoption/allpermits. Laterfinalvote/closing/currentconstruction outcome unverified.", "365acres/fivebuildings nearStameyFarmRd/I40/HickoryHighway are proposal figures; no siteMW or executedlandpurchase shown. Neighbor fears and developer mitigation assertions retain attribution, notobservedpollution or compliance. OnecampusnotfiveindependentfacilityIDs.", "Noallfield,currentoperatingbuilding,actualimpact,executedcontractorpaidfundscertification." ], "sources": [ { "url": "https://www.wbtv.com/2025/09/16/statesville-city-council-approves-rezoning-request-new-data-center/", "host": "wbtv.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Statesville · Iredell · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37097" } }, { "id": "core-scientific-marble-cherokee-county-nc", "state": "nc", "kind": "facility", "name": "Core Scientific Marble Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Cherokee" ], "city": "Marble", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. WUNCApr10,2026originalreport/photosApr7namesCoreScientificMarbleAIconversiondistinctfromMurphyHarshawcrypto. FailedCoreSci/CoreWeavecorporatemergernotproofHPCleasecanceled.170+dieselgeneratorcountnotMW;250000feetversussevenacnotreconciledarea.268000USD2024taxreceiptreportednotannual2026forecast;oldfactory2015closingnotDCclosure. Andrewssewerhookupdenialmayorquote notwholecampuspermitdenial;proposedsepticnotapproved. Threewells/12hlimitstatementnotactualgallonsorindependentlyverifiedregulation. Januaryrenewaldiscussionresultednoaction,notAIban. PrimeBlocknameabsentcurrentarticle;HarshawregionalcontextonlyforselectedPrimeBlock. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wunc.org/2026-04-10/cherokee-county-residents-were-upset-about-crypto-mines-then-came-ai", "host": "wunc.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" } ], "loc": { "lat": 35.13372, "lng": -84.06375, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "WUNCApr10,2026originalreport/photosApr7namesCoreScientificMarbleAIconversiondistinctfromMurphyHarshawcrypto. FailedCoreSci/CoreWeavecorporatemergernotproofHPCleasecanceled.170+dieselgeneratorcountnotMW;250000feetversussevenacnotreconciledarea.268000USD2024taxreceiptreportednotannual2026forecast;oldfactory2015closingnotDCclosure. Andrewssewerhookupdenialmayorquote notwholecampuspermitdenial;proposedsepticnotapproved. Threewells/12hlimitstatementnotactualgallonsorindependentlyverifiedregulation. Januaryrenewaldiscussionresultednoaction,notAIban. PrimeBlocknameabsentcurrentarticle;HarshawregionalcontextonlyforselectedPrimeBlock." }, "notes": [ "WUNCApr10,2026originalreport/photosApr7namesCoreScientificMarbleAIconversiondistinctfromMurphyHarshawcrypto. FailedCoreSci/CoreWeavecorporatemergernotproofHPCleasecanceled.170+dieselgeneratorcountnotMW;250000feetversussevenacnotreconciledarea.268000USD2024taxreceiptreportednotannual2026forecast;oldfactory2015closingnotDCclosure. Andrewssewerhookupdenialmayorquote notwholecampuspermitdenial;proposedsepticnotapproved. Threewells/12hlimitstatementnotactualgallonsorindependentlyverifiedregulation. Januaryrenewaldiscussionresultednoaction,notAIban. PrimeBlocknameabsentcurrentarticle;HarshawregionalcontextonlyforselectedPrimeBlock.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.wunc.org/2026-04-10/cherokee-county-residents-were-upset-about-crypto-mines-then-came-ai", "host": "wunc.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "overnight-discovery-2026-10-17", "scope": "Source-scoped official discovery and annual-filing comparison; research-context associations do not certify distinct physical sites or current whole-campus activity.", "fields": { "issuer_annual_utility_context": { "issuer": "Core Scientific", "reporting_period": "2025-12-31", "source_rows": [ { "location": "Marble, North Carolina", "utility": "Murphy Electric Power Board", "gross_utility_capacity_mw": 35 }, { "location": "Marble, North Carolina", "utility": "Duke Energy", "gross_utility_capacity_mw": 82 } ], "scope": "Annual gross utility-capacity context only; not critical IT, current load, an opened phase or an unambiguous physical-site boundary. No typed MW fact or summed campus total added." } }, "notes": [ "No status, address, map point, jurisdiction, operating date or technical quantity is promoted in this review. Annual filings retain their reporting periods; a fresh retrieval is not a fresh physical-site certification." ], "sources": [ { "url": "https://www.sec.gov/Archives/edgar/data/1839341/000162828026013305/core-20251231.htm", "host": "www.sec.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Core Scientific reviewed source" } ], "checked": "2026-10-17", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Marble · Cherokee · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37039" } }, { "id": "dc-blox-high-point-nc", "state": "nc", "kind": "facility", "name": "DC BLOX High Point Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Guilford" ], "city": "High Point", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. redirected regional map, facility mismatch. HighPointpreferred URL redirects to regional location map. Its12campuses/470criticalMWinclude operating and development across multiple states, not a HighPointfacility. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.dcblox.com/data-centers/high-point/", "host": "dcblox.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.dcblox.com/wp-content/uploads/2026/03/DC-BLOX-Going-Vertical.pdf", "host": "www.dcblox.com", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed primary source" }, { "url": "https://www.dcblox.com/data-center-map/", "host": "www.dcblox.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "loc": { "lat": 36.07949, "lng": -79.7889, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "remaining-operators-review-round5-2026-10-14.json", "scope": "redirected regional map, facility mismatch", "fields": {}, "notes": [ "HighPointpreferred URL redirects to regional location map. Its12campuses/470criticalMWinclude operating and development across multiple states, not a HighPointfacility.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.dcblox.com/data-centers/high-point/", "host": "dcblox.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "encore-2026-10-17-batch1", "scope": "Limited source identity and stage review; not whole-record certification, parcel verification or a physical-site census.", "fields": { "current_stage_evidence": { "outcome": "unresolved", "scope": "The old High Point URL redirects to a combined operating/development map. The separate brochure lists Highpoint/Greensboro under land acquired. Neither proves construction or operating service at this inherited context." } }, "notes": [ "The old High Point URL redirects to a combined operating/development map. The separate brochure lists Highpoint/Greensboro under land acquired. Neither proves construction or operating service at this inherited context." ], "sources": [ { "url": "https://www.dcblox.com/wp-content/uploads/2026/03/DC-BLOX-Going-Vertical.pdf", "host": "www.dcblox.com", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed primary source" }, { "url": "https://www.dcblox.com/data-centers/high-point/", "host": "www.dcblox.com", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed primary source" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 1", "scope": "The previous High Point page returns a redirect. The separately published regional map combines operation and development and does not establish a High Point construction or service stage. The oversized brochure response was not retained or used as new evidence.", "fields": { "current_stage_evidence": { "outcome": "unresolved", "scope": "The previous High Point page returns a redirect. The separately published regional map combines operation and development and does not establish a High Point construction or service stage. The oversized brochure response was not retained or used as new evidence." } }, "notes": [ "The previous High Point page returns a redirect. The separately published regional map combines operation and development and does not establish a High Point construction or service stage. The oversized brochure response was not retained or used as new evidence." ], "sources": [ { "url": "https://www.dcblox.com/data-center-map/", "host": "www.dcblox.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "checked": "2026-10-22", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "High Point · Guilford · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37081" } }, { "id": "deep-river-data-cumnock-lee-county-nc", "state": "nc", "kind": "facility", "name": "Deep River Data AI Data Center (Cumnock, Lee County)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lee" ], "city": "Cumnock", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Preparingapplication/stategeologistcommunication is not filed/approveddrilling/fracking/generationpermit or operatingDC. LeeCountyproposal, Sanfordcityruleshearing andGrahamHMTech 11 MW/60,000 squarefeet/10 jobs are distinctscopes. Marchvote todraftmoratorium is not adoption; April 20/21 campaignschedule hasnoobservedoutcome or independentlyestablishedexactyear here. Geologicaldepth/fracture/health/noise claims are advocacyarguments, not project-specific measuredcontamination or medicalfindings. NoMWorwaterdemandforCumnockadopted. No petition/RSVP/email submitted. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://cwfnc.org/nofracklee/", "host": "cwfnc.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 35.4751, "lng": -79.17148, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "CleanWaterforNC’s undatedadvocacypage describes DeepRiverData pursuing anOil&GasCommissionapplication to reopenButlerWell 3 nearCumnock for proposedgas-poweredAI.", "independently_verified_current_operating_status": null }, "notes": [ "Preparingapplication/stategeologistcommunication is not filed/approveddrilling/fracking/generationpermit or operatingDC. LeeCountyproposal, Sanfordcityruleshearing andGrahamHMTech 11 MW/60,000 squarefeet/10 jobs are distinctscopes. Marchvote todraftmoratorium is not adoption; April 20/21 campaignschedule hasnoobservedoutcome or independentlyestablishedexactyear here. Geologicaldepth/fracture/health/noise claims are advocacyarguments, not project-specific measuredcontamination or medicalfindings. NoMWorwaterdemandforCumnockadopted. No petition/RSVP/email submitted.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cwfnc.org/nofracklee/", "host": "cwfnc.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Cumnock · Lee · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37105" } }, { "id": "energy-storage-solutions-fayetteville-cumberland-county-nc", "state": "nc", "kind": "facility", "name": "Energy Storage Solutions Fayetteville AI Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Cumberland" ], "city": "Fayetteville", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.. The combined headline investment is not per site. A zoning text change is not a site permit. Early 2026 groundbreaking was a forecast. The previously rejected Tarboro site is separate; its questionable printed investment figure is not silently corrected. Current original approvals, disclosures and later outcomes take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.datacenterknowledge.com/build-design/developer-forges-ahead-with-38b-in-nc-data-center-builds", "host": "datacenterknowledge.com", "date": "2025-11-05", "published": "2025-11-05", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 35.06318, "lng": -78.84357, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round26-2026-10-14.json", "scope": "Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.", "fields": { "reported_context": "Data Center Knowledge quotes ESS plans for Kingsboro and a Fayetteville twin, with phased construction and undisclosed investors.", "independently_verified_current_operating_status": null }, "notes": [ "The combined headline investment is not per site. A zoning text change is not a site permit. Early 2026 groundbreaking was a forecast. The previously rejected Tarboro site is separate; its questionable printed investment figure is not silently corrected.", "Current original approvals, disclosures and later outcomes take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.datacenterknowledge.com/build-design/developer-forges-ahead-with-38b-in-nc-data-center-builds", "host": "datacenterknowledge.com", "date": "2025-11-05", "published": "2025-11-05", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Fayetteville · Cumberland · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37051" } }, { "id": "flexential-charlotte-north-clt04-05-nc", "state": "nc", "kind": "facility", "name": "Flexential Charlotte - North (CLT04/05)", "group": "operating", "status": "Operator listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Mecklenburg" ], "city": "Charlotte", "address": "", "who": "Flexential", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.. Power conflict: page 52 quick facts 3.3 MW; page 53 specification 6.75 MW. No single value adopted. Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2020-03/2019-type-2-SOC-3-final-report.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=10105+David+Taylor+Drive%2C+Charlotte%2C+North+Carolina+28262&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-80.76960628795987%2C35.328653288537545%2C-80.75749371204012%2C35.33853471146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "loc": { "lng": -80.76355, "lat": 35.333594, "precision": "address", "basis": "Operator facility documents identify 10105 David Taylor Drive, Charlotte, North Carolina 28262. One complete unique Census street range supports this calculated reference inside Mecklenburg County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round14-2026-10-14.json", "scope": "Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.", "fields": { "operator_named_facility": "Flexential Charlotte - North (CLT04/05)", "publisher_reported_footprint_sqft": 62589, "publisher_reported_critical_power_mw": null, "power_basis": "operator critical load UPS capacity; Douglasville sections call it critical power", "current_measured_demand_mw": null, "commissioning_date": null, "exact_address_verified_by_this_document": false }, "notes": [ "Power conflict: page 52 quick facts 3.3 MW; page 53 specification 6.75 MW. No single value adopted.", "Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 64, 2026-10-24", "scope": "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "fields": { "location_review_decision": { "location": { "lng": -80.76355, "lat": 35.333594, "precision": "address", "basis": "Operator facility documents identify 10105 David Taylor Drive, Charlotte, North Carolina 28262. One complete unique Census street range supports this calculated reference inside Mecklenburg County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "10105 David Taylor Drive, Charlotte, North Carolina 28262", "county_fips": [ "37119" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "The inherited general area coordinate was not an independently reviewed computing street reference. The original operator published computing location documents and complete unique literal Census street evidence support this bounded reference inside the retained county. The measured correction is 469.8 metres. All original source wordings, dates, predecessor coordinates and versions remain retained. Existing status group unknown and every other fact stay unchanged. This is a reference correction without physical relocation, a new operation, selected roof, tenant floor, legal title or complete campus certification.", "Large office and commercial roofs with parking are separated by wooded strips and access roads. The setting does not establish particular halls, floors or a complete campus boundary." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2020-03/2019-type-2-SOC-3-final-report.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=10105+David+Taylor+Drive%2C+Charlotte%2C+North+Carolina+28262&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-80.76960628795987%2C35.328653288537545%2C-80.75749371204012%2C35.33853471146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Company role source check64, October24,2026", "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 52 and 53. The North Charlotte profile remains separate from South Charlotte. Its quick facts and specifications state different critical load figures; neither figure is adopted or reconciled. The combined inventory identity is not split into buildings. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted.", "fields": { "company_association": { "name": "Flexential", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 52 and 53. The North Charlotte profile remains separate from South Charlotte. Its quick facts and specifications state different critical load figures; neither figure is adopted or reconciled. The combined inventory identity is not split into buildings. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted." }, "provider_role": "operator" }, "notes": [ "Flexential identifies the named location in the original fleet guide, PDF pages 52 and 53. The North Charlotte profile remains separate from South Charlotte. Its quick facts and specifications state different critical load figures; neither figure is adopted or reconciled. The combined inventory identity is not split into buildings. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 80", "scope": "Selected original fleet guide physical page 52 names the Charlotte North center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "original_guide_named_charlotte_north_service", "scope": "Selected original fleet guide physical page 52 names the Charlotte North center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged." }, "source_read_scope": { "original_owned_raw_guide_and_retrieval_receipt_reused": true, "no_new_request_for_denied_market_body": true, "original_named_provider_service_text_selected_physical_page": 52, "not_entire_102_page_guide_or_maps_read": true, "named_center_scope_not_every_inherited_component_code": true, "no_capacity_audit_legal_or_uptime_certification": true, "no_planned_expansion_or_advertised_inventory_as_completed_phase": true } }, "notes": [ "Selected original fleet guide physical page 52 names the Charlotte North center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Calculated street reference, not a roof or tenant floor", "summary": "Charlotte · Mecklenburg · Source context reviewed", "status_scope": "Selected original fleet guide physical page 52 names the Charlotte North center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged." }, { "id": "flexential-charlotte-south-clt01-02-03-nc", "state": "nc", "kind": "facility", "name": "Flexential Charlotte - South (CLT01/02/03)", "group": "operating", "status": "Operator listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Mecklenburg" ], "city": "Charlotte", "address": "", "who": "Flexential", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.. Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2021-12/Flexential-2021-PCI-DSS-AOC-Cloud-Operations.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=8910+Lenox+Pointe+Drive%2C+Charlotte%2C+North+Carolina+28273&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-80.94263045495873%2C35.129733288537544%2C-80.93054754504126%2C35.13961471146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "loc": { "lng": -80.936589, "lat": 35.134674, "precision": "address", "basis": "Operator facility documents identify 8910 Lenox Pointe Drive, Charlotte, North Carolina 28273. One complete unique Census street range supports this calculated reference inside Mecklenburg County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round14-2026-10-14.json", "scope": "Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.", "fields": { "operator_named_facility": "Flexential Charlotte - South (CLT01/02/03)", "publisher_reported_footprint_sqft": 66666, "publisher_reported_critical_power_mw": 2.36, "power_basis": "operator critical load UPS capacity; Douglasville sections call it critical power", "current_measured_demand_mw": null, "commissioning_date": null, "exact_address_verified_by_this_document": false }, "notes": [ "Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 64, 2026-10-24", "scope": "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "fields": { "location_review_decision": { "location": { "lng": -80.936589, "lat": 35.134674, "precision": "address", "basis": "Operator facility documents identify 8910 Lenox Pointe Drive, Charlotte, North Carolina 28273. One complete unique Census street range supports this calculated reference inside Mecklenburg County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "8910 Lenox Pointe Drive, Charlotte, North Carolina 28273", "county_fips": [ "37119" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "The inherited general area coordinate was not an independently reviewed computing street reference. The original operator published computing location documents and complete unique literal Census street evidence support this bounded reference inside the retained county. The measured correction is 85.3 metres. All original source wordings, dates, predecessor coordinates and versions remain retained. Existing status group unknown and every other fact stay unchanged. This is a reference correction without physical relocation, a new operation, selected roof, tenant floor, legal title or complete campus certification.", "Commercial and industrial roofs, parking, wooded patches and residential blocks surround several intersecting roads. No specific tenant space, floor or complete campus is selected." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2021-12/Flexential-2021-PCI-DSS-AOC-Cloud-Operations.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=8910+Lenox+Pointe+Drive%2C+Charlotte%2C+North+Carolina+28273&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-80.94263045495873%2C35.129733288537544%2C-80.93054754504126%2C35.13961471146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Company role source check64, October24,2026", "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 54 and 55. The South Charlotte profile identifies a retained service context distinct from Charlotte North. Its cloud node and floor area claims do not establish additional physical buildings, tenants, a property boundary or current certification. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted.", "fields": { "company_association": { "name": "Flexential", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 54 and 55. The South Charlotte profile identifies a retained service context distinct from Charlotte North. Its cloud node and floor area claims do not establish additional physical buildings, tenants, a property boundary or current certification. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted." }, "provider_role": "operator" }, "notes": [ "Flexential identifies the named location in the original fleet guide, PDF pages 54 and 55. The South Charlotte profile identifies a retained service context distinct from Charlotte North. Its cloud node and floor area claims do not establish additional physical buildings, tenants, a property boundary or current certification. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 80", "scope": "Selected original fleet guide physical page 54 names the Charlotte South center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "original_guide_named_charlotte_south_service", "scope": "Selected original fleet guide physical page 54 names the Charlotte South center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged." }, "source_read_scope": { "original_owned_raw_guide_and_retrieval_receipt_reused": true, "no_new_request_for_denied_market_body": true, "original_named_provider_service_text_selected_physical_page": 54, "not_entire_102_page_guide_or_maps_read": true, "named_center_scope_not_every_inherited_component_code": true, "no_capacity_audit_legal_or_uptime_certification": true, "no_planned_expansion_or_advertised_inventory_as_completed_phase": true } }, "notes": [ "Selected original fleet guide physical page 54 names the Charlotte South center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Calculated street reference, not a roof or tenant floor", "summary": "Charlotte · Mecklenburg · Source context reviewed", "status_scope": "Selected original fleet guide physical page 54 names the Charlotte South center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged." }, { "id": "flexential-raleigh-ral02-ral03-nc", "state": "nc", "kind": "facility", "name": "Flexential Raleigh (RAL02/RAL03)", "group": "operating", "status": "Operator listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wake" ], "city": "Morrisville", "address": "", "who": "Flexential", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.. Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2020-03/2019-type-2-SOC-3-final-report.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=5150+McCrimmon+Parkway%2C+Morrisville%2C+North+Carolina+27560&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-78.8348454058331%2C35.84406828853755%2C-78.8226545941669%2C35.853949711462455&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "loc": { "lng": -78.82875, "lat": 35.849009, "precision": "address", "basis": "Operator facility documents identify 5150 McCrimmon Parkway, Morrisville, North Carolina 27560. One complete unique Census street range supports this calculated reference inside Wake County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round14-2026-10-14.json", "scope": "Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.", "fields": { "operator_named_facility": "Flexential Raleigh (RAL02/RAL03)", "publisher_reported_footprint_sqft": 99976, "publisher_reported_critical_power_mw": 4.31, "power_basis": "operator critical load UPS capacity; Douglasville sections call it critical power", "current_measured_demand_mw": null, "commissioning_date": null, "exact_address_verified_by_this_document": false }, "notes": [ "Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 64, 2026-10-24", "scope": "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "fields": { "location_review_decision": { "location": { "lng": -78.82875, "lat": 35.849009, "precision": "address", "basis": "Operator facility documents identify 5150 McCrimmon Parkway, Morrisville, North Carolina 27560. One complete unique Census street range supports this calculated reference inside Wake County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "5150 McCrimmon Parkway, Morrisville, North Carolina 27560", "county_fips": [ "37183" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "The inherited general area coordinate was not an independently reviewed computing street reference. The original operator published computing location documents and complete unique literal Census street evidence support this bounded reference inside the retained county. The measured correction is 172.6 metres. All original source wordings, dates, predecessor coordinates and versions remain retained. Existing status group unknown and every other fact stay unchanged. This is a reference correction without physical relocation, a new operation, selected roof, tenant floor, legal title or complete campus certification.", "Office and commercial roofs and parking sit among trees and intersecting roads, with an open graded area toward the southeast. Image age is unknown, so this does not establish a construction milestone or present operation." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2020-03/2019-type-2-SOC-3-final-report.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=5150+McCrimmon+Parkway%2C+Morrisville%2C+North+Carolina+27560&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-78.8348454058331%2C35.84406828853755%2C-78.8226545941669%2C35.853949711462455&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Company role source check64, October24,2026", "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 56 and 57. The Raleigh profile identifies the retained combined computing service context. It does not assign source capacity to individual record components or split the inventory into additional buildings. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted.", "fields": { "company_association": { "name": "Flexential", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 56 and 57. The Raleigh profile identifies the retained combined computing service context. It does not assign source capacity to individual record components or split the inventory into additional buildings. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted." }, "provider_role": "operator" }, "notes": [ "Flexential identifies the named location in the original fleet guide, PDF pages 56 and 57. The Raleigh profile identifies the retained combined computing service context. It does not assign source capacity to individual record components or split the inventory into additional buildings. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 80", "scope": "Selected original fleet guide physical page 56 names the Raleigh center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "original_guide_named_raleigh_service", "scope": "Selected original fleet guide physical page 56 names the Raleigh center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged." }, "source_read_scope": { "original_owned_raw_guide_and_retrieval_receipt_reused": true, "no_new_request_for_denied_market_body": true, "original_named_provider_service_text_selected_physical_page": 56, "not_entire_102_page_guide_or_maps_read": true, "named_center_scope_not_every_inherited_component_code": true, "no_capacity_audit_legal_or_uptime_certification": true, "no_planned_expansion_or_advertised_inventory_as_completed_phase": true } }, "notes": [ "Selected original fleet guide physical page 56 names the Raleigh center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Calculated street reference, not a roof or tenant floor", "summary": "Morrisville · Wake · Source context reviewed", "status_scope": "Selected original fleet guide physical page 56 names the Raleigh center or complex and describes provider computing services and customer support in the present tense. This supports operator listed colocation service at that named center or complex scope. The original guide was captured October 23, 2026 and is reused with its exact original receipt and hash. The current Atlanta market page returned 403 during this review, so its body and a later roster were not read, replaced or adopted from indexed text. The guide service account does not certify present uptime, legal eligibility, audits, installed capacity, exact first commissioning or every component implied by inherited center codes. Planned expansion and advertised availability are not independently completed phases. Provider branding, company roles, component identity and location remain unchanged." }, { "id": "flexential-salisbury-henderson-grove-nc", "state": "nc", "kind": "facility", "name": "Flexential Salisbury (Henderson Grove Church Road)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Rowan" ], "city": "Salisbury", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.. A recommendation is not council approval. The reported meeting weekday and date conflict. Average and peak water figures are not additive, nor are water and sewage. A will-serve letter is not an executed service agreement or critical IT certification. Current original approvals, disclosures and later outcomes take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.salisburypost.com/2026/08/12/salisbury-planning-recommends-henderson-grove-church-data-center-approval/", "host": "salisburypost.com", "date": "2026-08-12", "published": "2026-08-12", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://salisburync.gov/Government/Administration/Public-Meeting", "host": "salisburync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Current named Flexential project address and reference context" }, { "url": "https://gis.rowancountync.gov/arcgis/rest/services/public/CurrentMapping/MapServer/2/query?where=PARCEL_ID+IN+%28%27407+115%27%2C%27407+014%27%2C%27407+015%27%2C%27407115%27%2C%27407014%27%2C%27407015%27%29&outFields=OBJECTID%2CPARCEL_ID%2CPIN%2CPARENT_PIN%2CFTR_CODE%2CRW_CODE&returnGeometry=true&outSR=4326&resultRecordCount=25&f=json", "host": "gis.rowancountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "All three exact filed parcel identities, complete query result" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-80.51289799528857%2C35.62180591088753%2C-80.50516200471142%2C35.628094089112466&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed reference set setting only, acquisition date unknown" }, { "url": "https://gis.rowancountync.gov/arcgis/rest/services/public/CurrentMapping/MapServer/2?f=pjson", "host": "gis.rowancountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Official current parcel field definitions and reference purpose" }, { "url": "https://salisburync.gov/Portals/0/8-Henderson Data Storage Facility.pdf", "host": "salisburync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed October 6, 2026 packet pages 3 and 39, exact address and three parcel set" }, { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lng": -80.50903, "lat": 35.62495, "precision": "approximate", "basis": "Approximate calculated reference center for the city filed Flexential Salisbury project at 1477 Henderson Grove Church Road. All three named county reference parcels 407 014, 407 015 and 407 115 are included. Not a surveyed merged parcel, roof, title or completed full campus. Aerial acquisition date is unknown and may predate construction. Existing native status remains unknown." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round26-2026-10-14.json", "scope": "Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.", "fields": { "reported_context": "Salisbury Post reports a planning recommendation for Flexential and Trammell Crow, a peak demand estimate and a reported Duke will-serve letter.", "independently_verified_current_operating_status": null }, "notes": [ "A recommendation is not council approval. The reported meeting weekday and date conflict. Average and peak water figures are not additive, nor are water and sewage. A will-serve letter is not an executed service agreement or critical IT certification.", "Current original approvals, disclosures and later outcomes take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.salisburypost.com/2026/08/12/salisbury-planning-recommends-henderson-grove-church-data-center-approval/", "host": "salisburypost.com", "date": "2026-08-12", "published": "2026-08-12", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 30, October 23, 2026", "scope": "Approximate remains approximate. One bounded reference for the complete three parcel filed set. Existing native status remains unknown.", "fields": { "location_review_decision": { "location": { "lng": -80.50903, "lat": 35.62495, "precision": "approximate", "basis": "Approximate calculated reference center for the city filed Flexential Salisbury project at 1477 Henderson Grove Church Road. All three named county reference parcels 407 014, 407 015 and 407 115 are included. Not a surveyed merged parcel, roof, title or completed full campus. Aerial acquisition date is unknown and may predate construction. Existing native status remains unknown." }, "reference_method": "Approximate county reference parcel center", "reference_parcel": { "identifiers": [ "407 014", "407 015", "407 115" ], "identifier_field": "PARCEL_ID", "pins": [ "5658-01-15-9477", "5658-01-15-0383", "5658-01-16-5137" ], "objectids": [ 37038, 37437, 64023 ], "agency": "Rowan County Environmental Services GIS", "reference_method": "calculated_reference_set_centroid", "reference_set_is_synthetic_legal_parcel": false, "not_survey_quality": true, "legal_title_verified": false, "independent_building_identity": false, "full_campus_verified": false, "operator_ownership_verified": false }, "operator_coordinates_adopted": false, "census_range_adopted": false } }, "notes": [ "The current city project page expressly names Flexential and 1477 Henderson Grove Church Road. Actually viewed October 6, 2026 city packet pages 3 and 39 name that exact project address and the complete filed set 407 115, 407 014 and 407 015. The current county query returns exactly these three parcel IDs and no others. All three source polygons are used together, with no arbitrary single lot selected. A translated Web Mercator area weighted calculation provides one approximate reference set center, which lies inside the exact source set and retained Rowan County. This does not certify a legal merged parcel, surveyed boundary, building roof, title, present ownership, full campus completion or physical milestone. Raw county parent PIN, right of way code and feature code values remain exact without undocumented meaning inference. The current city page combines introductory proposed project text and later rezoning context; no approval, construction, opening, quantity, role or status is adopted. The native unknown status and blank canonical address remain exact. City Hall and airport notification recipient addresses are excluded.", "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact.", "The complete parcel reference set is a mathematical display reference only. No raw geometry is exported, no legal parcel merger is inferred and no building or independent physical site is counted.", "Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. No residential roof is selected." ], "sources": [ { "url": "https://salisburync.gov/Government/Administration/Public-Meeting", "host": "salisburync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Current named Flexential project address and reference context" }, { "url": "https://gis.rowancountync.gov/arcgis/rest/services/public/CurrentMapping/MapServer/2/query?where=PARCEL_ID+IN+%28%27407+115%27%2C%27407+014%27%2C%27407+015%27%2C%27407115%27%2C%27407014%27%2C%27407015%27%29&outFields=OBJECTID%2CPARCEL_ID%2CPIN%2CPARENT_PIN%2CFTR_CODE%2CRW_CODE&returnGeometry=true&outSR=4326&resultRecordCount=25&f=json", "host": "gis.rowancountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "All three exact filed parcel identities, complete query result" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-80.51289799528857%2C35.62180591088753%2C-80.50516200471142%2C35.628094089112466&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed reference set setting only, acquisition date unknown" }, { "url": "https://gis.rowancountync.gov/arcgis/rest/services/public/CurrentMapping/MapServer/2?f=pjson", "host": "gis.rowancountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Official current parcel field definitions and reference purpose" }, { "url": "https://salisburync.gov/Portals/0/8-Henderson Data Storage Facility.pdf", "host": "salisburync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed October 6, 2026 packet pages 3 and 39, exact address and three parcel set" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 80", "scope": "Bounded review of the original fleet guide found named Charlotte and Raleigh computing service sections but no independently established Salisbury Henderson Grove facility crosswalk. Selected physical page 58 is an Ohio section divider rather than Salisbury computing evidence. Omission from a service guide is not proof of cancellation, closure or absence of a project. The denied current provider market body and the subsequent skipped roster were not replaced with indexed text, an alternate copy or another same host request. Exact present stage remains unknown.", "fields": { "current_stage_evidence": { "outcome": "original_guide_exact_salisbury_crosswalk_held", "scope": "Bounded review of the original fleet guide found named Charlotte and Raleigh computing service sections but no independently established Salisbury Henderson Grove facility crosswalk. Selected physical page 58 is an Ohio section divider rather than Salisbury computing evidence. Omission from a service guide is not proof of cancellation, closure or absence of a project. The denied current provider market body and the subsequent skipped roster were not replaced with indexed text, an alternate copy or another same host request. Exact present stage remains unknown." }, "source_read_scope": { "original_owned_guide_and_receipt_reused": true, "guide_text_location_discovery_and_selected_physical_page58_heading_read": true, "not_entire_102_page_guide_or_provider_history_read": true, "guide_omission_not_closure_or_project_absence": true, "denied_body_and_skipped_roster_not_substituted": true } }, "notes": [ "Bounded review of the original fleet guide found named Charlotte and Raleigh computing service sections but no independently established Salisbury Henderson Grove facility crosswalk. Selected physical page 58 is an Ohio section divider rather than Salisbury computing evidence. Omission from a service guide is not proof of cancellation, closure or absence of a project. The denied current provider market body and the subsequent skipped roster were not replaced with indexed text, an alternate copy or another same host request. Exact present stage remains unknown.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Approximate filed parcel reference set, not a surveyed building or full campus", "summary": "Salisbury · Rowan · Source context reviewed" }, { "id": "google-lenoir-nc", "state": "nc", "kind": "facility", "name": "Google Lenoir Data Center", "group": "operating", "status": "Operating phase", "raw_status": "partly operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Caldwell" ], "city": "Lenoir", "address": "", "who": "Google", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "Calendar-year 2025 operator-reported location totals. Withdrawal, discharge and consumption are separate quantities; methodology permits estimates and does not establish today’s use.", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Intro says building since2007; milestone explicitly says opens2008.4B+region/state is not site-onlyspend. Historic1.2Bplan is not additive to updated4B. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Google 2026 quarterly performance table; named regional campus scope. Operator-reported period metrics, not an October operating inspection, current MW load or building-specific measurement. Regional values are not assigned to a separate expansion or street-address record. Blank TTM remains unknown. No status, location precision or whole-campus completion upgrade; publication date unknown.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://datacenters.google/locations/lenoir-north-carolina/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://datacenters.google/efficiency/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://datacenters.google/locations/north-carolina/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.datacenters.google/locations/north-carolina/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google official location source" }, { "url": "https://www.datacenters.google/locations/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google official location source" }, { "url": "https://sustainability.google/files/google-2026-environmental-report.pdf", "host": "sustainability.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google 2026 Environmental Report" } ], "loc": { "lat": 35.95306, "lng": -81.54678, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "remaining-operators-review-round5-2026-10-14.json", "scope": "named operator source", "fields": { "first_data_center_opening_year": 2008, "initial_announcement_year": 2007, "initial_planned_investment_usd": 1200000000, "regional_investment_usd_min_exclusive": 4000000000, "regional_investment_scope": "region and North Carolina state" }, "notes": [ "Intro says building since2007; milestone explicitly says opens2008.4B+region/state is not site-onlyspend. Historic1.2Bplan is not additive to updated4B.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://datacenters.google/locations/lenoir-north-carolina/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Atlas targeted primary-source follow-up", "scope": "Google 2026 quarterly performance table; named regional campus scope", "fields": { "operator_reported_pue_period": "2026-Q2", "operator_reported_campus_pue": [ { "source_campus_label": "Lenoir, North Carolina", "quarterly_pue": 1.1, "trailing_twelve_month_pue": 1.1 } ] }, "notes": [ "Operator-reported period metrics, not an October operating inspection, current MW load or building-specific measurement. Regional values are not assigned to a separate expansion or street-address record. Blank TTM remains unknown. No status, location precision or whole-campus completion upgrade; publication date unknown." ], "sources": [ { "url": "https://datacenters.google/efficiency/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://datacenters.google/locations/north-carolina/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "checked": "2026-10-15", "capture_sha256": "398f42d55ca9e2ebecd3b24e2dede307ad2d9d3b653469d1efebd135488f9c17", "events": [], "whole_record_certified": false }, { "overlay": "S4-Google-Locations-20261016", "scope": "Named Google location research context; regional campus and individual building identity remain separate.", "fields": { "operator_location_scope": "Lenoir, North Carolina is named in Google’s current directory and linked location page. Regional entries can include several facilities; directory development flags alone do not establish an operating stage.", "record_association_scope": "The named operator location is associated with this existing research context by provider and named city/county. This is an explicit research association, not proof of a distinct physical site or an exact parcel.", "annual_water_reporting": { "source_location": "Lenoir, NC", "report_year": 2026, "reporting_year": 2025, "source_page": 97, "unit": "Million gallons", "withdrawal": 378.3, "discharge": 34.0, "consumption": 344.3 }, "water_method_scope": "Annual calendar-year 2025 figures for the reported location, not instantaneous use, a daily rate, an approved limit or one building. Google uses metered or invoiced values when available and can estimate missing data; the table does not identify each row’s metering completeness. Consumption is calculated as withdrawal minus discharge; values are rounded. Seawater and brackish water over 1,000 mg/L total dissolved solids are excluded. Unless otherwise specified, withdrawals are potable; Douglas County includes reclaimed wastewater. No litres or daily averages are calculated.", "water_location_association": "Lenoir, NC is associated with this regional campus research context only; no allocation to separate expansion/street-address records or individual buildings.", "current_status_basis": "An operating component is supported at Google’s named Lenoir, North Carolina location by its current operator listing and 2025 operational reporting. This is regional campus scope, not verification that every expansion/building is complete, fully commissioned or operating at a stated MW. Annual reporting is historical, not an October operating inspection." }, "notes": [ "A partial operator/field review does not certify every fact or a whole state. No precise address, map point, current IT load or per-campus investment is inferred." ], "sources": [ { "url": "https://www.datacenters.google/locations/north-carolina/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google official location source" }, { "url": "https://www.datacenters.google/locations/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google official location source" }, { "url": "https://sustainability.google/files/google-2026-environmental-report.pdf", "host": "sustainability.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google 2026 Environmental Report" } ], "checked": "2026-10-16", "whole_record_certified": false }, { "overlay": "Company role source check 35, October 23, 2026", "scope": "Google identifies its own Lenoir, North Carolina data center community in the body of its regional location page, separately from the global location menu. The operator per source relationship records its named provider brand, not independent proof that every building or expansion is operating. The named campus is retained at its existing record scope without assigning individual buildings, lots or street destinations. Regional investment and economic impact figures, targets and community programs are not site quantities. Legal title, sole control and a distinct legal entity are not established. Existing status, location, address, county, quantities, dates and component identity remain exact. The source publication date is unknown.", "fields": { "company_association": { "name": "Google", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Google identifies its own Lenoir, North Carolina data center community in the body of its regional location page, separately from the global location menu. The operator per source relationship records its named provider brand, not independent proof that every building or expansion is operating. The named campus is retained at its existing record scope without assigning individual buildings, lots or street destinations. Regional investment and economic impact figures, targets and community programs are not site quantities. Legal title, sole control and a distinct legal entity are not established. Existing status, location, address, county, quantities, dates and component identity remain exact. The source publication date is unknown." }, "provider_role": "operator" }, "notes": [ "Google identifies its own Lenoir, North Carolina data center community in the body of its regional location page, separately from the global location menu. The operator per source relationship records its named provider brand, not independent proof that every building or expansion is operating. The named campus is retained at its existing record scope without assigning individual buildings, lots or street destinations. Regional investment and economic impact figures, targets and community programs are not site quantities. Legal title, sole control and a distinct legal entity are not established. Existing status, location, address, county, quantities, dates and component identity remain exact. The source publication date is unknown." ], "sources": [ { "url": "https://www.datacenters.google/locations/north-carolina/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lenoir · Caldwell · Source context reviewed", "status_scope": "An operating component is supported at Google’s named Lenoir, North Carolina location by its current operator listing and 2025 operational reporting. This is regional campus scope, not verification that every expansion/building is complete, fully commissioned or operating at a stated MW. Annual reporting is historical, not an October operating inspection.", "typed_water_facts": [ { "measure": "withdrawal", "value": 378.3, "unit": "million gallons", "as_of": null, "as_of_basis": "reporting_period", "reporting_period": { "label": "2025", "start": "2025-01-01", "end": "2025-12-31" }, "observed_on": "2026-10-16", "basis": "operator_reported_total", "scope": "Google 2026 Environmental Report p.97: Lenoir, NC, calendar year 2025 withdrawal; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.", "sources": [ "https://sustainability.google/files/google-2026-environmental-report.pdf" ] }, { "measure": "discharge", "value": 34.0, "unit": "million gallons", "as_of": null, "as_of_basis": "reporting_period", "reporting_period": { "label": "2025", "start": "2025-01-01", "end": "2025-12-31" }, "observed_on": "2026-10-16", "basis": "operator_reported_total", "scope": "Google 2026 Environmental Report p.97: Lenoir, NC, calendar year 2025 discharge; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.", "sources": [ "https://sustainability.google/files/google-2026-environmental-report.pdf" ] }, { "measure": "consumption", "value": 344.3, "unit": "million gallons", "as_of": null, "as_of_basis": "reporting_period", "reporting_period": { "label": "2025", "start": "2025-01-01", "end": "2025-12-31" }, "observed_on": "2026-10-16", "basis": "operator_reported_total", "scope": "Google 2026 Environmental Report p.97: Lenoir, NC, calendar year 2025 consumption; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.", "sources": [ "https://sustainability.google/files/google-2026-environmental-report.pdf" ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37027" } }, { "id": "energy-storage-solutions-kingsboro-edgecombe-county-nc", "state": "nc", "kind": "facility", "name": "Kingsboro AI Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Edgecombe" ], "city": "Rocky Mount", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.. Calling a hearing does not enact a pause. The bills discussed were explicitly unfinished. Proposed demand is not present usage, and statewide tax-exemption scenarios are not site awards. Opposition to a land sale does not establish a closing. Current original approvals, disclosures and later outcomes take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.northcarolinahealthnews.org/2026/07/14/rural-nc-data-centers/", "host": "northcarolinahealthnews.org", "date": "2026-07-14", "published": "2026-07-14", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://energystoragesolutionsllc.com/", "host": "energystoragesolutionsllc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 35.91327, "lng": -77.59633, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round26-2026-10-14.json", "scope": "Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.", "fields": { "reported_context": "NC Health News describes the Kingsboro ESS proposal and a proposed 24-month moratorium hearing.", "independently_verified_current_operating_status": null }, "notes": [ "Calling a hearing does not enact a pause. The bills discussed were explicitly unfinished. Proposed demand is not present usage, and statewide tax-exemption scenarios are not site awards. Opposition to a land sale does not establish a closing.", "Current original approvals, disclosures and later outcomes take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.northcarolinahealthnews.org/2026/07/14/rural-nc-data-centers/", "host": "northcarolinahealthnews.org", "date": "2026-07-14", "published": "2026-07-14", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 39", "scope": "The current original company home page advertises a wider development pipeline and separately labels Kingsboro and Tarboro project downloads. This does not by itself identify the accepted exact Kingsboro Business Park application, final local disposition or current physical phase. Later secondary withdrawal and County moratorium pointers conflict with inherited permitted wording and were not replaced by an original decision here. Portfolio development, company resource claims and the separate Tarboro proposal are not transferred into this record.", "fields": { "current_stage_evidence": { "outcome": "company_kingsboro_marketing_with_unresolved_exact_later_disposition", "scope": "The current original company home page advertises a wider development pipeline and separately labels Kingsboro and Tarboro project downloads. This does not by itself identify the accepted exact Kingsboro Business Park application, final local disposition or current physical phase. Later secondary withdrawal and County moratorium pointers conflict with inherited permitted wording and were not replaced by an original decision here. Portfolio development, company resource claims and the separate Tarboro proposal are not transferred into this record." } }, "notes": [ "The current original company home page advertises a wider development pipeline and separately labels Kingsboro and Tarboro project downloads. This does not by itself identify the accepted exact Kingsboro Business Park application, final local disposition or current physical phase. Later secondary withdrawal and County moratorium pointers conflict with inherited permitted wording and were not replaced by an original decision here. Portfolio development, company resource claims and the separate Tarboro proposal are not transferred into this record.", "Existing identities, roles, locations, jurisdictions, quantities and physical opening fields remain exact. Source publication, check dates, forecasts and physical milestones have distinct meanings." ], "sources": [ { "url": "https://energystoragesolutionsllc.com/", "host": "energystoragesolutionsllc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Rocky Mount · Edgecombe · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37065" } }, { "id": "long-ferry-road-rowan-county-nc", "state": "nc", "kind": "facility", "name": "Long Ferry Road Data Center Campus (Rowan County)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Rowan" ], "city": "", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.. Chair community protection requests were proposed, not enacted conditions. Later county-published May 4 ordinance is separately reviewed and supersedes this initial procedural stage. Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Signed ordinance supersedes initial April vote; county law includes explicit exemptions.. Two printed parcel strings omit hyphens. Preserve printed forms; assessor crosswalk not independently performed. Do not equate all county geography with county zoning jurisdiction. Subsequent early termination not observed. County position as stated on March 26, not universal permit/utility clearance or a court ruling.. Statement no offers/paid incentives is dated, not proof no later award or no historical incentive discussions. Does not establish project energization or exemption eligibility for every parcel.", "date": "", "events": [ [ "2026-05-04", "The signed original County instrument records May 4, 2026 adoption and commencement of the data center development moratorium. Its separate April 20 hearing is not the adoption day. This is County policy context, not a finding that this individual project is denied, exempt or operating." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.salisburypost.com/2026/04/21/roco-passes-data-center-moratorium-over-100-residents-express-data-center-opposition/", "host": "salisburypost.com", "date": "2026-04-21", "published": "2026-04-21", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.rowancountync.gov/DocumentCenter/View/57271", "host": "rowancountync.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.rowancountync.gov/2073/Long-Ferry-Development", "host": "rowancountync.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.rowancountync.gov/DocumentCenter/View/56772", "host": "rowancountync.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.rowancountync.gov/DocumentCenter/View/57271/Ordinance-Imposing-One-Year-Moratorium-on-the-Development-of-Data-Centers-in-Rowan-County-PDF?bidId=", "host": "www.rowancountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 35.63935, "lng": -80.5248, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcomes-review-round20-2026-10-14.json", "scope": "Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.", "fields": { "reported_action_type": "initial-moratorium-vote-needs-readoption", "reported_finding": "Salisbury Post says April 20 moratorium vote needed another approval after one commissioner left, and Long Ferry was excluded.", "report_display_date": "2026-04-21", "independently_verified_current_status": null }, "notes": [ "Chair community protection requests were proposed, not enacted conditions. Later county-published May 4 ordinance is separately reviewed and supersedes this initial procedural stage.", "Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.salisburypost.com/2026/04/21/roco-passes-data-center-moratorium-over-100-residents-express-data-center-opposition/", "host": "salisburypost.com", "date": "2026-04-21", "published": "2026-04-21", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-outcomes-review-round20-2026-10-14.json", "scope": "Signed ordinance supersedes initial April vote; county law includes explicit exemptions.", "fields": { "adopted": "2026-05-04", "effective": "2026-05-04", "expiry_no_later_than": "2027-05-04", "early_termination_allowed": true, "jurisdiction": "County zoning jurisdiction", "exempt_parcel_ids_as_printed": [ "603-112", "603-113", "603114", "603-116", "603118", "603-045", "603-061" ], "exemptions": "State statutory and common-law exemptions plus explicitly listed ongoing-project parcels." }, "notes": [ "Two printed parcel strings omit hyphens. Preserve printed forms; assessor crosswalk not independently performed. Do not equate all county geography with county zoning jurisdiction. Subsequent early termination not observed.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.rowancountync.gov/DocumentCenter/View/57271", "host": "rowancountync.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.rowancountync.gov/2073/Long-Ferry-Development", "host": "rowancountync.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-outcomes-review-round20-2026-10-14.json", "scope": "County position as stated on March 26, not universal permit/utility clearance or a court ruling.", "fields": { "statement_date": "2026-03-26", "end_user_identified_in_statement": false, "county_statement_no_offers_or_paid_incentives": true, "county_statement_no_further_board_use_approvals": true }, "notes": [ "Statement no offers/paid incentives is dated, not proof no later award or no historical incentive discussions. Does not establish project energization or exemption eligibility for every parcel.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.rowancountync.gov/DocumentCenter/View/56772", "host": "rowancountync.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 39", "scope": "The original four page signed Rowan County ordinance prints an April 20, 2026 hearing and May 4, 2026 adoption and commencement. Its term expires no later than May 4, 2027 and permits early termination by majority resolution. It restricts specified development approvals within County zoning jurisdiction and expressly exempts legally qualifying and listed ongoing projects. No exact Long Ferry component exemption, cancellation, permit or current construction is established. Later amendments and early termination were not verified. Its passed September planning deadline is not evidence that revisions were completed.", "fields": { "current_stage_evidence": { "outcome": "signed_county_moratorium_with_exact_dates_and_unverified_individual_exemption", "scope": "The original four page signed Rowan County ordinance prints an April 20, 2026 hearing and May 4, 2026 adoption and commencement. Its term expires no later than May 4, 2027 and permits early termination by majority resolution. It restricts specified development approvals within County zoning jurisdiction and expressly exempts legally qualifying and listed ongoing projects. No exact Long Ferry component exemption, cancellation, permit or current construction is established. Later amendments and early termination were not verified. Its passed September planning deadline is not evidence that revisions were completed." }, "local_rule_context": { "jurisdiction": "Rowan County zoning jurisdiction", "adopted_on": "2026-05-04", "effective_on": "2026-05-04", "expires_on": "2027-05-04", "source_scope": "Original signed ordinance pages 1 through 4 visually read. Expiry is no later than the printed day and can occur earlier by majority resolution. Statutory and listed ongoing project exemptions remain exact. Individual applicability, later amendment and early termination are unknown." } }, "notes": [ "The original four page signed Rowan County ordinance prints an April 20, 2026 hearing and May 4, 2026 adoption and commencement. Its term expires no later than May 4, 2027 and permits early termination by majority resolution. It restricts specified development approvals within County zoning jurisdiction and expressly exempts legally qualifying and listed ongoing projects. No exact Long Ferry component exemption, cancellation, permit or current construction is established. Later amendments and early termination were not verified. Its passed September planning deadline is not evidence that revisions were completed.", "Existing identities, roles, locations, jurisdictions, quantities and physical opening fields remain exact. Source publication, check dates, forecasts and physical milestones have distinct meanings." ], "sources": [ { "url": "https://www.rowancountync.gov/DocumentCenter/View/57271/Ordinance-Imposing-One-Year-Moratorium-on-the-Development-of-Data-Centers-in-Rowan-County-PDF?bidId=", "host": "www.rowancountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Rowan · Source context reviewed", "event_evidence": [ { "date": "2026-05-04", "text": "The signed original County instrument records May 4, 2026 adoption and commencement of the data center development moratorium. Its separate April 20 hearing is not the adoption day. This is County policy context, not a finding that this individual project is denied, exempt or operating.", "kind": "approved", "sources": [ { "url": "https://www.rowancountync.gov/DocumentCenter/View/57271/Ordinance-Imposing-One-Year-Moratorium-on-the-Development-of-Data-Centers-in-Rowan-County-PDF?bidId=", "host": "www.rowancountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37159" } }, { "id": "meta-forest-city-nc", "state": "nc", "kind": "facility", "name": "Meta Forest City Data Center", "group": "operating", "status": "Operator-listed service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Rutherford" ], "city": "Forest City", "address": "", "who": "Meta", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Undated operator info sheet. Investment label retains its city/state scope and does not independently establish expenditures at one building. Jobs/funding are operator figures with no separately established observation end-date. Renewables MW concern separate electricity-generation projects, not site IT demand. Water-positive/restoration statements are goals, not measured site water use. No exact construction count inferred. Source layout clips some labels; extracted text and visual columns were both reviewed. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://datacenters.atmeta.com/asset/forest-city-data-center-info-sheet/", "host": "datacenters.atmeta.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 35.40256, "lng": -81.92042, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "direct-pdf-review-round5-2026-10-14.json", "scope": "Field or source context only", "fields": { "operator_labeled_data_center_investment_usd": 750000000, "investment_is_lower_bound": true, "investment_geographic_label": "North Carolina", "historic_groundbreaking_year": 2010, "peak_construction_workers": null, "operator_reported_operational_jobs_lower_bound": 275, "local_school_nonprofit_direct_funding_usd_lower_bound": 6400000, "direct_funding_county_scope": "Rutherford", "peak_construction_workers_source_wording": "hundreds" }, "notes": [ "Undated operator info sheet. Investment label retains its city/state scope and does not independently establish expenditures at one building. Jobs/funding are operator figures with no separately established observation end-date. Renewables MW concern separate electricity-generation projects, not site IT demand. Water-positive/restoration statements are goals, not measured site water use.", "No exact construction count inferred. Source layout clips some labels; extracted text and visual columns were both reviewed.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://datacenters.atmeta.com/asset/forest-city-data-center-info-sheet/", "host": "datacenters.atmeta.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "overnight-status-2026-10-16", "scope": "Named project and operator-service status review; phase and source limits retained.", "fields": { "current_stage_evidence": { "outcome": "supported_label", "label": "Operator-listed service", "basis": "The current named operator factsheet identifies this campus as part of Meta’s infrastructure providing its technologies and reports its existing operational role.", "checked_on": "2026-10-16" }, "stage_review_limits": "This is a current operator-listed service context, not independent certification of every building, all planned jobs, occupancy or technical capacity. Offsite renewable procurement and future restoration goals are not site IT load or measured water outcomes." }, "notes": [ "This is a current operator-listed service context, not independent certification of every building, all planned jobs, occupancy or technical capacity. Offsite renewable procurement and future restoration goals are not site IT load or measured water outcomes.", "Current service and project labels are source-scoped research contexts. No entire record, physical site, technical quantity or exact parcel is certified." ], "sources": [ { "url": "https://datacenters.atmeta.com/asset/forest-city-data-center-info-sheet/", "host": "datacenters.atmeta.com", "published": "", "date": "", "checked": "2026-10-16", "label": "Reviewed current operator evidence" } ], "checked": "2026-10-16", "whole_record_certified": false }, { "overlay": "Company role source check 07, October 23, 2026", "scope": "Meta presents its named data center as part of its own infrastructure and service network in this first party source. Operator is an attributed provider brand role, not an independently established legal entity, property owner or finding about completion of every building or phase. Company resource, rate payer, community and certification claims are not adopted as measured effects or independent findings. No physical date, technical figure, photograph, status or location is promoted.", "fields": { "company_association": { "name": "Meta", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Meta presents its named data center as part of its own infrastructure and service network in this first party source. Operator is an attributed provider brand role, not an independently established legal entity, property owner or finding about completion of every building or phase. Company resource, rate payer, community and certification claims are not adopted as measured effects or independent findings. No physical date, technical figure, photograph, status or location is promoted." }, "provider_role": "operator" }, "notes": [ "Meta presents its named data center as part of its own infrastructure and service network in this first party source. Operator is an attributed provider brand role, not an independently established legal entity, property owner or finding about completion of every building or phase. Company resource, rate payer, community and certification claims are not adopted as measured effects or independent findings. No physical date, technical figure, photograph, status or location is promoted.", "Source dates remain separate from physical milestones and the retained status field." ], "sources": [ { "url": "https://datacenters.atmeta.com/asset/forest-city-data-center-info-sheet/", "host": "datacenters.atmeta.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party named facility source, PDF first page visually reviewed where supplied" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Forest City · Rutherford · Source context reviewed", "status_scope": "Primary source review checked 2026-10-16. The current named operator factsheet identifies this campus as part of Meta’s infrastructure providing its technologies and reports its existing operational role. This is a current operator-listed service context, not independent certification of every building, all planned jobs, occupancy or technical capacity. Offsite renewable procurement and future restoration goals are not site IT load or measured water outcomes.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37161" } }, { "id": "microsoft-conover-catawba-county-nc", "state": "nc", "kind": "facility", "name": "Microsoft Conover Data Center", "group": "building", "status": "Company reported construction", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Catawba" ], "city": "Conover", "address": "", "who": "Microsoft", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Catawba multi-site joint statement. Same joint statement on county and municipal websites, not two independent confirmations.1B/fourcenters/10years regional across Conover,Hickory,Maiden, not each. Amendments in progress not executed removal of every incentive.1percentwater-production claim has regional scope and forecast basis, not measured per-site gallons. No individual site operating milestone. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-06-23", "Catawba County published its joint Microsoft programme statement on June 23, 2026, with a City of Conover copy. The statement covers the programme across three municipalities. This is the source publication date, not an individual Conover opening, an executed incentive amendment or three independent project announcements." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.catawbacountync.gov/news/joint-statement-on-microsoft-data-center-development-in-catawba-county/", "host": "catawbacountync.gov", "date": "2026-06-23", "published": "2026-06-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.conovernc.gov/m/newsflash/Home/Detail/41", "host": "www.conovernc.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" }, { "url": "https://local.microsoft.com/blog/lyle-creek-datacenter-construction-update/", "host": "local.microsoft.com", "published": "2024-05-15", "date": "2024-05-15", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lat": 35.66222, "lng": -81.21492, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "Catawba multi-site joint statement", "fields": { "joint_statement_publication_date": "2026-06-23", "historical_project_announcement_month": "2022-11", "regional_planned_investment_usd_min": 1000000000, "regional_planned_data_centers": 4, "regional_development_period_years": 10, "announced_local_property_tax_commitment": "pay based on full value; local agreements being amended" }, "notes": [ "Same joint statement on county and municipal websites, not two independent confirmations.1B/fourcenters/10years regional across Conover,Hickory,Maiden, not each. Amendments in progress not executed removal of every incentive.1percentwater-production claim has regional scope and forecast basis, not measured per-site gallons. No individual site operating milestone.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.catawbacountync.gov/news/joint-statement-on-microsoft-data-center-development-in-catawba-county/", "host": "catawbacountync.gov", "date": "2026-06-23", "published": "2026-06-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 13", "scope": "The June 23 joint local government statement discusses the Microsoft programme across Conover, Hickory and Maiden and addresses water, infrastructure and incentive questions. It does not assign an explicit current physical stage to this individual Conover record. References to existing and under construction data centers in the county also include other companies. Projected county water capacity shares, amended agreement intentions and general economic statements are not measured site demand, executed amendments or proof of this site opening. Physical stage remains unclear.", "fields": { "current_stage_evidence": { "outcome": "joint_county_programme_individual_stage_held", "scope": "The June 23 joint local government statement discusses the Microsoft programme across Conover, Hickory and Maiden and addresses water, infrastructure and incentive questions. It does not assign an explicit current physical stage to this individual Conover record. References to existing and under construction data centers in the county also include other companies. Projected county water capacity shares, amended agreement intentions and general economic statements are not measured site demand, executed amendments or proof of this site opening. Physical stage remains unclear." }, "programme_scope": { "joint_statement_on": "2026-06-23", "programme_municipalities": [ "Conover", "Hickory", "Maiden" ], "individual_site_stage_verified": false, "projected_water_share_not_actual_withdrawal_or_site_allocation": true, "amendments_in_progress_not_executed_agreements": true } }, "notes": [ "The June 23 joint local government statement discusses the Microsoft programme across Conover, Hickory and Maiden and addresses water, infrastructure and incentive questions. It does not assign an explicit current physical stage to this individual Conover record. References to existing and under construction data centers in the county also include other companies. Projected county water capacity shares, amended agreement intentions and general economic statements are not measured site demand, executed amendments or proof of this site opening. Physical stage remains unclear.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones." ], "sources": [ { "url": "https://www.catawbacountync.gov/news/joint-statement-on-microsoft-data-center-development-in-catawba-county/", "host": "www.catawbacountync.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" }, { "url": "https://www.conovernc.gov/m/newsflash/Home/Detail/41", "host": "www.conovernc.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check60, October24,2026", "scope": "Microsoft identifies Lyle Creek near Highway16 in Catawba County. Its September2026 report concerns the first building and additional phases. Earlier Morgan Corp and later Whiting Turner descriptions are dated contractor context. Blasting descriptions, schedules and additional buildings do not create an observed nuisance outcome, opening or new site count. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained.", "fields": { "company_association": { "name": "Microsoft", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Microsoft identifies Lyle Creek near Highway16 in Catawba County. Its September2026 report concerns the first building and additional phases. Earlier Morgan Corp and later Whiting Turner descriptions are dated contractor context. Blasting descriptions, schedules and additional buildings do not create an observed nuisance outcome, opening or new site count. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained." }, "provider_role": "developer" }, "notes": [ "Microsoft identifies Lyle Creek near Highway16 in Catawba County. Its September2026 report concerns the first building and additional phases. Earlier Morgan Corp and later Whiting Turner descriptions are dated contractor context. Blasting descriptions, schedules and additional buildings do not create an observed nuisance outcome, opening or new site count. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained." ], "sources": [ { "url": "https://local.microsoft.com/blog/lyle-creek-datacenter-construction-update/", "host": "local.microsoft.com", "published": "2024-05-15", "date": "2024-05-15", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Codex 3 research followup 1", "scope": "The original named Lyle Creek update contains a September 2026 section that explicitly reports work on the first building exterior, framing, drywall, underground infrastructure and mechanical and electrical installation. This supports company reported construction at the first building and associated campus work scope. The earlier February forecast and May construction account remain separately dated sections. The original page publication day is not the September update day or a first commissioning day. Contractor changes do not establish a legal operator role, and conditional or historical rock work statements are not measured harm, a public complaint or computing operation.", "fields": { "current_stage_evidence": { "outcome": "named_lyle_creek_september2026_first_building_construction", "scope": "The original named Lyle Creek update contains a September 2026 section that explicitly reports work on the first building exterior, framing, drywall, underground infrastructure and mechanical and electrical installation. This supports company reported construction at the first building and associated campus work scope. The earlier February forecast and May construction account remain separately dated sections. The original page publication day is not the September update day or a first commissioning day. Contractor changes do not establish a legal operator role, and conditional or historical rock work statements are not measured harm, a public complaint or computing operation." }, "source_read_scope": { "original_named_project_and_complete_september_may_february2026_and_may2024_sections_read": true, "source_publication_day_distinct_from_month_only_update": true, "actual_exterior_interior_and_mechanical_work_not_forecast_alone": true, "no_independent_uptime_harm_or_contractor_operator_role_finding": true, "original_exact_capture_and_retrieval_receipt_reused": true, "no_new_network_request": true } }, "notes": [ "The original named Lyle Creek update contains a September 2026 section that explicitly reports work on the first building exterior, framing, drywall, underground infrastructure and mechanical and electrical installation. This supports company reported construction at the first building and associated campus work scope. The earlier February forecast and May construction account remain separately dated sections. The original page publication day is not the September update day or a first commissioning day. Contractor changes do not establish a legal operator role, and conditional or historical rock work statements are not measured harm, a public complaint or computing operation.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://local.microsoft.com/blog/lyle-creek-datacenter-construction-update/", "host": "local.microsoft.com", "published": "2024-05-15", "date": "2024-05-15", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Conover · Catawba · Source context reviewed", "event_evidence": [ { "date": "2026-06-23", "text": "Catawba County published its joint Microsoft programme statement on June 23, 2026, with a City of Conover copy. The statement covers the programme across three municipalities. This is the source publication date, not an individual Conover opening, an executed incentive amendment or three independent project announcements.", "kind": "announced", "sources": [ { "url": "https://www.catawbacountync.gov/news/joint-statement-on-microsoft-data-center-development-in-catawba-county/", "host": "www.catawbacountync.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" }, { "url": "https://www.conovernc.gov/m/newsflash/Home/Detail/41", "host": "www.conovernc.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" } ] } ], "status_scope": "The original named Lyle Creek update contains a September 2026 section that explicitly reports work on the first building exterior, framing, drywall, underground infrastructure and mechanical and electrical installation. This supports company reported construction at the first building and associated campus work scope. The earlier February forecast and May construction account remain separately dated sections. The original page publication day is not the September update day or a first commissioning day. Contractor changes do not establish a legal operator role, and conditional or historical rock work statements are not measured harm, a public complaint or computing operation.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37035" } }, { "id": "microsoft-hickory-catawba-county-nc", "state": "nc", "kind": "facility", "name": "Microsoft Hickory Data Center", "group": "building", "status": "Company reported construction", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Catawba" ], "city": "Hickory", "address": "", "who": "Microsoft", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Catawba multi-site joint statement. Same joint statement on county and municipal websites, not two independent confirmations.1B/fourcenters/10years regional across Conover,Hickory,Maiden, not each. Amendments in progress not executed removal of every incentive.1percentwater-production claim has regional scope and forecast basis, not measured per-site gallons. No individual site operating milestone. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-06-23", "Catawba County published its joint Microsoft programme statement on June 23, 2026, with a City of Conover copy. The statement covers the programme across three municipalities. This is the source publication date, not an individual Hickory opening, an executed incentive amendment or three independent project announcements." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.conovernc.gov/m/newsflash/Home/Detail/41", "host": "conovernc.gov", "date": "2026-06-23", "published": "2026-06-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.catawbacountync.gov/news/joint-statement-on-microsoft-data-center-development-in-catawba-county/", "host": "www.catawbacountync.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" }, { "url": "https://local.microsoft.com/blog/stover-datacenter-construction-update/", "host": "local.microsoft.com", "published": "2024-09-19", "date": "2024-09-19", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lat": 35.67175, "lng": -81.22532, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "Catawba multi-site joint statement", "fields": { "joint_statement_publication_date": "2026-06-23", "historical_project_announcement_month": "2022-11", "regional_planned_investment_usd_min": 1000000000, "regional_planned_data_centers": 4, "regional_development_period_years": 10, "announced_local_property_tax_commitment": "pay based on full value; local agreements being amended" }, "notes": [ "Same joint statement on county and municipal websites, not two independent confirmations.1B/fourcenters/10years regional across Conover,Hickory,Maiden, not each. Amendments in progress not executed removal of every incentive.1percentwater-production claim has regional scope and forecast basis, not measured per-site gallons. No individual site operating milestone.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.conovernc.gov/m/newsflash/Home/Detail/41", "host": "conovernc.gov", "date": "2026-06-23", "published": "2026-06-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 13", "scope": "The June 23 joint local government statement discusses the Microsoft programme across Conover, Hickory and Maiden and addresses water, infrastructure and incentive questions. It does not assign an explicit current physical stage to this individual Hickory record. References to existing and under construction data centers in the county also include other companies. Projected county water capacity shares, amended agreement intentions and general economic statements are not measured site demand, executed amendments or proof of this site opening. Physical stage remains unclear.", "fields": { "current_stage_evidence": { "outcome": "joint_county_programme_individual_stage_held", "scope": "The June 23 joint local government statement discusses the Microsoft programme across Conover, Hickory and Maiden and addresses water, infrastructure and incentive questions. It does not assign an explicit current physical stage to this individual Hickory record. References to existing and under construction data centers in the county also include other companies. Projected county water capacity shares, amended agreement intentions and general economic statements are not measured site demand, executed amendments or proof of this site opening. Physical stage remains unclear." }, "programme_scope": { "joint_statement_on": "2026-06-23", "programme_municipalities": [ "Conover", "Hickory", "Maiden" ], "individual_site_stage_verified": false, "projected_water_share_not_actual_withdrawal_or_site_allocation": true, "amendments_in_progress_not_executed_agreements": true } }, "notes": [ "The June 23 joint local government statement discusses the Microsoft programme across Conover, Hickory and Maiden and addresses water, infrastructure and incentive questions. It does not assign an explicit current physical stage to this individual Hickory record. References to existing and under construction data centers in the county also include other companies. Projected county water capacity shares, amended agreement intentions and general economic statements are not measured site demand, executed amendments or proof of this site opening. Physical stage remains unclear.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones." ], "sources": [ { "url": "https://www.catawbacountync.gov/news/joint-statement-on-microsoft-data-center-development-in-catawba-county/", "host": "www.catawbacountync.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" }, { "url": "https://www.conovernc.gov/m/newsflash/Home/Detail/41", "host": "www.conovernc.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check60, October24,2026", "scope": "Microsoft identifies the Hickory and Stover project in Catawba County. The May2026 account distinguishes utility and foundation work from a forecast steel milestone. Dated Ames and Clayco contractor accounts remain separate. The postponed church information session and later site meeting are not a facility street or future hearing. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained.", "fields": { "company_association": { "name": "Microsoft", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Microsoft identifies the Hickory and Stover project in Catawba County. The May2026 account distinguishes utility and foundation work from a forecast steel milestone. Dated Ames and Clayco contractor accounts remain separate. The postponed church information session and later site meeting are not a facility street or future hearing. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained." }, "provider_role": "developer" }, "notes": [ "Microsoft identifies the Hickory and Stover project in Catawba County. The May2026 account distinguishes utility and foundation work from a forecast steel milestone. Dated Ames and Clayco contractor accounts remain separate. The postponed church information session and later site meeting are not a facility street or future hearing. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained." ], "sources": [ { "url": "https://local.microsoft.com/blog/stover-datacenter-construction-update/", "host": "local.microsoft.com", "published": "2024-09-19", "date": "2024-09-19", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Codex 3 research followup 1", "scope": "The original named Hickory and Stover update contains a May 2026 section explicitly reporting underground utility installation and foundation work in progress. This supports company reported construction scoped to foundations and associated infrastructure. End of June steel work remains a forecast rather than verified installation. The February section explicitly distinguished early earthwork from vertical building. The earlier postponed community session and separately rescheduled October 21, 2024 session are past schedules rather than verified attendance or a new hearing. Meeting venue text does not move the computing site into another municipality. No exact current completion, operation, legal role or measured rock work impact is inferred.", "fields": { "current_stage_evidence": { "outcome": "named_hickory_may2026_foundations_and_utilities", "scope": "The original named Hickory and Stover update contains a May 2026 section explicitly reporting underground utility installation and foundation work in progress. This supports company reported construction scoped to foundations and associated infrastructure. End of June steel work remains a forecast rather than verified installation. The February section explicitly distinguished early earthwork from vertical building. The earlier postponed community session and separately rescheduled October 21, 2024 session are past schedules rather than verified attendance or a new hearing. Meeting venue text does not move the computing site into another municipality. No exact current completion, operation, legal role or measured rock work impact is inferred." }, "source_read_scope": { "original_named_project_complete_may_and_february2026_and_earlier_construction_session_sections_read": true, "month_only_update_not_invented_exact_day": true, "june_steel_target_not_actual_installation": true, "meeting_venue_not_site_location_change": true, "past_rescheduled_session_not_completed_meeting": true, "original_exact_capture_and_retrieval_receipt_reused": true, "no_new_network_request": true } }, "notes": [ "The original named Hickory and Stover update contains a May 2026 section explicitly reporting underground utility installation and foundation work in progress. This supports company reported construction scoped to foundations and associated infrastructure. End of June steel work remains a forecast rather than verified installation. The February section explicitly distinguished early earthwork from vertical building. The earlier postponed community session and separately rescheduled October 21, 2024 session are past schedules rather than verified attendance or a new hearing. Meeting venue text does not move the computing site into another municipality. No exact current completion, operation, legal role or measured rock work impact is inferred.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://local.microsoft.com/blog/stover-datacenter-construction-update/", "host": "local.microsoft.com", "published": "2024-09-19", "date": "2024-09-19", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hickory · Catawba · Source context reviewed", "event_evidence": [ { "date": "2026-06-23", "text": "Catawba County published its joint Microsoft programme statement on June 23, 2026, with a City of Conover copy. The statement covers the programme across three municipalities. This is the source publication date, not an individual Hickory opening, an executed incentive amendment or three independent project announcements.", "kind": "announced", "sources": [ { "url": "https://www.catawbacountync.gov/news/joint-statement-on-microsoft-data-center-development-in-catawba-county/", "host": "www.catawbacountync.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" }, { "url": "https://www.conovernc.gov/m/newsflash/Home/Detail/41", "host": "www.conovernc.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" } ] } ], "status_scope": "The original named Hickory and Stover update contains a May 2026 section explicitly reporting underground utility installation and foundation work in progress. This supports company reported construction scoped to foundations and associated infrastructure. End of June steel work remains a forecast rather than verified installation. The February section explicitly distinguished early earthwork from vertical building. The earlier postponed community session and separately rescheduled October 21, 2024 session are past schedules rather than verified attendance or a new hearing. Meeting venue text does not move the computing site into another municipality. No exact current completion, operation, legal role or measured rock work impact is inferred.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37035" } }, { "id": "microsoft-maiden-catawba-county-nc", "state": "nc", "kind": "facility", "name": "Microsoft Maiden Data Center", "group": "building", "status": "Company reported construction", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Catawba" ], "city": "Maiden", "address": "", "who": "Microsoft", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Catawba multi-site joint statement. Same joint statement on county and municipal websites, not two independent confirmations.1B/fourcenters/10years regional across Conover,Hickory,Maiden, not each. Amendments in progress not executed removal of every incentive.1percentwater-production claim has regional scope and forecast basis, not measured per-site gallons. No individual site operating milestone. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-06-23", "Catawba County published its joint Microsoft programme statement on June 23, 2026, with a City of Conover copy. The statement covers the programme across three municipalities. This is the source publication date, not an individual Maiden opening, an executed incentive amendment or three independent project announcements." ], [ "2024-04-01", "Microsoft reports that Boyd Farm construction began April 1, 2024 with clearing and grading. This is the issuer reported preliminary site construction day, rather than first vertical building, computing commissioning or a completed later forecast." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.catawbacountync.gov/news/joint-statement-on-microsoft-data-center-development-in-catawba-county/", "host": "catawbacountync.gov", "date": "2026-06-23", "published": "2026-06-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.conovernc.gov/m/newsflash/Home/Detail/41", "host": "www.conovernc.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" }, { "url": "https://local.microsoft.com/blog/boyd-farms-datacenter-construction-update/", "host": "local.microsoft.com", "published": "2024-04-30", "date": "2024-04-30", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lat": 35.64236, "lng": -81.21318, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "Catawba multi-site joint statement", "fields": { "joint_statement_publication_date": "2026-06-23", "historical_project_announcement_month": "2022-11", "regional_planned_investment_usd_min": 1000000000, "regional_planned_data_centers": 4, "regional_development_period_years": 10, "announced_local_property_tax_commitment": "pay based on full value; local agreements being amended" }, "notes": [ "Same joint statement on county and municipal websites, not two independent confirmations.1B/fourcenters/10years regional across Conover,Hickory,Maiden, not each. Amendments in progress not executed removal of every incentive.1percentwater-production claim has regional scope and forecast basis, not measured per-site gallons. No individual site operating milestone.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.catawbacountync.gov/news/joint-statement-on-microsoft-data-center-development-in-catawba-county/", "host": "catawbacountync.gov", "date": "2026-06-23", "published": "2026-06-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 13", "scope": "The June 23 joint local government statement discusses the Microsoft programme across Conover, Hickory and Maiden and addresses water, infrastructure and incentive questions. It does not assign an explicit current physical stage to this individual Maiden record. References to existing and under construction data centers in the county also include other companies. Projected county water capacity shares, amended agreement intentions and general economic statements are not measured site demand, executed amendments or proof of this site opening. Physical stage remains unclear.", "fields": { "current_stage_evidence": { "outcome": "joint_county_programme_individual_stage_held", "scope": "The June 23 joint local government statement discusses the Microsoft programme across Conover, Hickory and Maiden and addresses water, infrastructure and incentive questions. It does not assign an explicit current physical stage to this individual Maiden record. References to existing and under construction data centers in the county also include other companies. Projected county water capacity shares, amended agreement intentions and general economic statements are not measured site demand, executed amendments or proof of this site opening. Physical stage remains unclear." }, "programme_scope": { "joint_statement_on": "2026-06-23", "programme_municipalities": [ "Conover", "Hickory", "Maiden" ], "individual_site_stage_verified": false, "projected_water_share_not_actual_withdrawal_or_site_allocation": true, "amendments_in_progress_not_executed_agreements": true } }, "notes": [ "The June 23 joint local government statement discusses the Microsoft programme across Conover, Hickory and Maiden and addresses water, infrastructure and incentive questions. It does not assign an explicit current physical stage to this individual Maiden record. References to existing and under construction data centers in the county also include other companies. Projected county water capacity shares, amended agreement intentions and general economic statements are not measured site demand, executed amendments or proof of this site opening. Physical stage remains unclear.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones." ], "sources": [ { "url": "https://www.catawbacountync.gov/news/joint-statement-on-microsoft-data-center-development-in-catawba-county/", "host": "www.catawbacountync.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" }, { "url": "https://www.conovernc.gov/m/newsflash/Home/Detail/41", "host": "www.conovernc.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check60, October24,2026", "scope": "Microsoft identifies Boyd Farms off Zeb Haynes Road in Maiden. Its May2026 update names Clark Construction, separate from the earlier Morgan account. Possible controlled blasting remains conditional on approval. Neither an elapsed construction forecast nor a conditional rock removal request is a verified outcome. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained.", "fields": { "company_association": { "name": "Microsoft", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Microsoft identifies Boyd Farms off Zeb Haynes Road in Maiden. Its May2026 update names Clark Construction, separate from the earlier Morgan account. Possible controlled blasting remains conditional on approval. Neither an elapsed construction forecast nor a conditional rock removal request is a verified outcome. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained." }, "provider_role": "developer" }, "notes": [ "Microsoft identifies Boyd Farms off Zeb Haynes Road in Maiden. Its May2026 update names Clark Construction, separate from the earlier Morgan account. Possible controlled blasting remains conditional on approval. Neither an elapsed construction forecast nor a conditional rock removal request is a verified outcome. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained." ], "sources": [ { "url": "https://local.microsoft.com/blog/boyd-farms-datacenter-construction-update/", "host": "local.microsoft.com", "published": "2024-04-30", "date": "2024-04-30", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Codex 3 research followup 1", "scope": "The original named Boyd Farm update contains a May 2026 section explicitly reporting continuing foundations, utilities and infrastructure construction. This supports company reported construction at that scope. Early June slab and later utility milestones remain prospective rather than completed work. The older timeline explicitly reports an April 1, 2024 construction start involving clearing and grading; that exact reported site preparation start is separate from vertical construction or computing commissioning. Its earlier spring 2025 forecast is not treated as accomplished completion in light of the later construction account. Potential controlled blasting remains subject to approval and notice, without proof that it occurred or caused harm.", "fields": { "current_stage_evidence": { "outcome": "named_boyd_farm_may2026_construction", "scope": "The original named Boyd Farm update contains a May 2026 section explicitly reporting continuing foundations, utilities and infrastructure construction. This supports company reported construction at that scope. Early June slab and later utility milestones remain prospective rather than completed work. The older timeline explicitly reports an April 1, 2024 construction start involving clearing and grading; that exact reported site preparation start is separate from vertical construction or computing commissioning. Its earlier spring 2025 forecast is not treated as accomplished completion in light of the later construction account. Potential controlled blasting remains subject to approval and notice, without proof that it occurred or caused harm." }, "source_read_scope": { "original_named_project_complete_may2026_and_earlier_construction_timeline_and_rock_sections_read": true, "explicit_april1_2024_start_not_announcement_or_computing_commissioning": true, "potential_blasting_not_actual_harm": true, "month_only_update_not_invented_exact_day": true, "original_exact_capture_and_retrieval_receipt_reused": true, "no_new_network_request": true } }, "notes": [ "The original named Boyd Farm update contains a May 2026 section explicitly reporting continuing foundations, utilities and infrastructure construction. This supports company reported construction at that scope. Early June slab and later utility milestones remain prospective rather than completed work. The older timeline explicitly reports an April 1, 2024 construction start involving clearing and grading; that exact reported site preparation start is separate from vertical construction or computing commissioning. Its earlier spring 2025 forecast is not treated as accomplished completion in light of the later construction account. Potential controlled blasting remains subject to approval and notice, without proof that it occurred or caused harm.", "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning." ], "sources": [ { "url": "https://local.microsoft.com/blog/boyd-farms-datacenter-construction-update/", "host": "local.microsoft.com", "published": "2024-04-30", "date": "2024-04-30", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Maiden · Catawba · Source context reviewed", "event_evidence": [ { "date": "2026-06-23", "text": "Catawba County published its joint Microsoft programme statement on June 23, 2026, with a City of Conover copy. The statement covers the programme across three municipalities. This is the source publication date, not an individual Maiden opening, an executed incentive amendment or three independent project announcements.", "kind": "announced", "sources": [ { "url": "https://www.catawbacountync.gov/news/joint-statement-on-microsoft-data-center-development-in-catawba-county/", "host": "www.catawbacountync.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" }, { "url": "https://www.conovernc.gov/m/newsflash/Home/Detail/41", "host": "www.conovernc.gov", "published": "2026-06-23", "date": "2026-06-23", "checked": "2026-10-22", "label": "Reviewed government record" } ] }, { "date": "2024-04-01", "text": "Microsoft reports that Boyd Farm construction began April 1, 2024 with clearing and grading. This is the issuer reported preliminary site construction day, rather than first vertical building, computing commissioning or a completed later forecast.", "kind": "construction_start", "sources": [ { "url": "https://local.microsoft.com/blog/boyd-farms-datacenter-construction-update/", "host": "local.microsoft.com", "published": "2024-04-30", "date": "2024-04-30", "checked": "2026-10-24", "label": "Reviewed operator source" } ] } ], "status_scope": "The original named Boyd Farm update contains a May 2026 section explicitly reporting continuing foundations, utilities and infrastructure construction. This supports company reported construction at that scope. Early June slab and later utility milestones remain prospective rather than completed work. The older timeline explicitly reports an April 1, 2024 construction start involving clearing and grading; that exact reported site preparation start is separate from vertical construction or computing commissioning. Its earlier spring 2025 forecast is not treated as accomplished completion in light of the later construction account. Potential controlled blasting remains subject to approval and notice, without proof that it occurred or caused harm.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37035" } }, { "id": "microsoft-person-county-roxboro-nc", "state": "nc", "kind": "facility", "name": "Microsoft Person County Mega Park", "group": "proposed", "status": "Operator-listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Person" ], "city": "Roxboro", "address": "", "who": "Microsoft", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named original reporter/issuer context with current versus historical stage explicit.. EricMiller WRAL June30,2026 originalcommunitymeetingreport (updatedJuly1) identifies MicrosoftPersonCountyWoodsdale/Virginiaborder mega-site;1385acres and28.85M2024landpurchase reported, notcurrentconstructionspending. Pay-own-way/lowwater promises remainvoluntary assertions inarticle, notexecutedtariff/PPA/abatement/currentmeasuredwater. No ITMW or building approval/operatingdeadline. LaterSeptemberparagraph lacks independenteventdate and doesnotmoveJune30meetingtoSeptember. Localconcerns/poll notmeasuredcampusharm. Not everyfield/currentphysicaloperation/paidfunds/issuedpermit/exactITcertified.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wral.com/news/local/person-county-microsoft-data-center-discussion-june-2026/", "host": "wral.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://local.microsoft.com/blog/person-county-datacenter-project/", "host": "local.microsoft.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "loc": { "lat": 36.39002, "lng": -78.97174, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-opening-land-and-approval-stage-review-round77-2026-10-15.json", "scope": "Named original reporter/issuer context with current versus historical stage explicit.", "fields": {}, "notes": [ "EricMiller WRAL June30,2026 originalcommunitymeetingreport (updatedJuly1) identifies MicrosoftPersonCountyWoodsdale/Virginiaborder mega-site;1385acres and28.85M2024landpurchase reported, notcurrentconstructionspending.", "Pay-own-way/lowwater promises remainvoluntary assertions inarticle, notexecutedtariff/PPA/abatement/currentmeasuredwater. No ITMW or building approval/operatingdeadline. LaterSeptemberparagraph lacks independenteventdate and doesnotmoveJune30meetingtoSeptember. Localconcerns/poll notmeasuredcampusharm.", "Not everyfield/currentphysicaloperation/paidfunds/issuedpermit/exactITcertified." ], "sources": [ { "url": "https://www.wral.com/news/local/person-county-microsoft-data-center-discussion-june-2026/", "host": "wral.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 13", "scope": "Microsoft expressly places the Person County programme in planning and describes early soil sampling, surveying and road related preparation in its April 2026 update. Operator listed development describes this proposal. These limited preparations are not a verified start of vertical data center construction, completion of the forecast road work or operation.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_planning_with_preliminary_preparation", "scope": "Microsoft expressly places the Person County programme in planning and describes early soil sampling, surveying and road related preparation in its April 2026 update. Operator listed development describes this proposal. These limited preparations are not a verified start of vertical data center construction, completion of the forecast road work or operation." }, "phase_scope": { "source_update_period": "April 2026", "operator_explicit_phase": "planning", "road_work_forecast_is_not_completed_occurrence": true, "vertical_datacenter_construction_verified": false } }, "notes": [ "Microsoft expressly places the Person County programme in planning and describes early soil sampling, surveying and road related preparation in its April 2026 update. Operator listed development describes this proposal. These limited preparations are not a verified start of vertical data center construction, completion of the forecast road work or operation.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones." ], "sources": [ { "url": "https://local.microsoft.com/blog/person-county-datacenter-project/", "host": "local.microsoft.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check59, October24,2026", "scope": "Microsoft identifies its own Person County data center project in the main body of the official community update. Developer per source identifies the Microsoft provider brand for this retained project only. The previously empty company field is filled from that explicit source, without assigning a legal subsidiary, landowner, contractor or current operator. Existing status, location, address, county, quantities, dates and component identity remain exact. Any separately retained street is identity context only and does not newly admit a location, parcel or roof. Proposed designs, forecast schedules, contractor descriptions and community measures do not certify current physical completion, operation, permits, impacts or site ownership. Declared publication and modification dates are separate from construction milestones. No personal contact or resident names are retained in the review. The page describes planning and early site preparation and road work. An expected reduction in water use from the described cooling design is not a measured quantity or a zero water finding; no actual road closure outcome is newly established.", "fields": { "company_association": { "name": "Microsoft", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Microsoft identifies its own Person County data center project in the main body of the official community update. Developer per source identifies the Microsoft provider brand for this retained project only. The previously empty company field is filled from that explicit source, without assigning a legal subsidiary, landowner, contractor or current operator. Existing status, location, address, county, quantities, dates and component identity remain exact. Any separately retained street is identity context only and does not newly admit a location, parcel or roof. Proposed designs, forecast schedules, contractor descriptions and community measures do not certify current physical completion, operation, permits, impacts or site ownership. Declared publication and modification dates are separate from construction milestones. No personal contact or resident names are retained in the review. The page describes planning and early site preparation and road work. An expected reduction in water use from the described cooling design is not a measured quantity or a zero water finding; no actual road closure outcome is newly established." }, "provider_role": "developer" }, "notes": [ "Microsoft identifies its own Person County data center project in the main body of the official community update. Developer per source identifies the Microsoft provider brand for this retained project only. The previously empty company field is filled from that explicit source, without assigning a legal subsidiary, landowner, contractor or current operator. Existing status, location, address, county, quantities, dates and component identity remain exact. Any separately retained street is identity context only and does not newly admit a location, parcel or roof. Proposed designs, forecast schedules, contractor descriptions and community measures do not certify current physical completion, operation, permits, impacts or site ownership. Declared publication and modification dates are separate from construction milestones. No personal contact or resident names are retained in the review. The page describes planning and early site preparation and road work. An expected reduction in water use from the described cooling design is not a measured quantity or a zero water finding; no actual road closure outcome is newly established." ], "sources": [ { "url": "https://local.microsoft.com/blog/person-county-datacenter-project/", "host": "local.microsoft.com", "published": "2026-05-01", "date": "2026-05-01", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Roxboro · Person · Source context reviewed", "status_scope": "Microsoft expressly places the Person County programme in planning and describes early soil sampling, surveying and road related preparation in its April 2026 update. Operator listed development describes this proposal. These limited preparations are not a verified start of vertical data center construction, completion of the forecast road work or operation.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37145" } }, { "id": "tract-mooresville-nc", "state": "nc", "kind": "facility", "name": "Mooresville Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Iredell" ], "city": "Mooresville", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.. April 16,2025 binding power agreement was ISSUED; source says Tract would EXECUTE it tentatively inSeptember AFTER zoning, so this does not verify a signed ESA.230 kV is line voltage, not MW. Town capacity up-to 500,000 gallons/day is developer-attributed possible supply, not measured demand or issued water allocation.1000 construction/195 or 200 permanent jobs are forecasts with rounding discrepancy. Developer claim of 400 data centers is not adopted as Tract’s owned/operating fleet. Public-hearing scheduling language still conditions August 4 action despite August 5 publication; no hearing result inferred. Later original decisions and observed outcomes take precedence; future events have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.govtech.com/products/n-c-data-center-awaits-approval-to-build-on-earnhardt-land", "host": "govtech.com", "date": "2025-08-05", "published": "2025-08-05", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 35.82106, "lng": -80.88854, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round33-2026-10-14.json", "scope": "Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.", "fields": { "reported_context": "Statesville Record & Landmark reporting republished by Government Technology describes Tract’s conditional 399.25-acre Mooresville annexation/rezoning proposal and developer utility-study timeline.", "independently_verified_current_operating_status": null, "developer_reports_power_agreement_issued": "2025-04-16", "executed_utility_agreement_verified": false }, "notes": [ "April 16,2025 binding power agreement was ISSUED; source says Tract would EXECUTE it tentatively inSeptember AFTER zoning, so this does not verify a signed ESA.230 kV is line voltage, not MW. Town capacity up-to 500,000 gallons/day is developer-attributed possible supply, not measured demand or issued water allocation.1000 construction/195 or 200 permanent jobs are forecasts with rounding discrepancy. Developer claim of 400 data centers is not adopted as Tract’s owned/operating fleet. Public-hearing scheduling language still conditions August 4 action despite August 5 publication; no hearing result inferred.", "Later original decisions and observed outcomes take precedence; future events have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.govtech.com/products/n-c-data-center-awaits-approval-to-build-on-earnhardt-land", "host": "govtech.com", "date": "2025-08-05", "published": "2025-08-05", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Mooresville · Iredell · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37097" } }, { "id": "natelli-new-hill-nc", "state": "nc", "kind": "facility", "name": "Natelli New Hill Digital Campus", "group": "stopped", "status": "Reported withdrawal", "raw_status": "stopped", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wake" ], "city": "New Hill", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Withdrawal is not final denial or permanent cancellation of every future proposal. The mentioned one-year moratorium was a proposed future motion in this report, not an adopted result. Generator MW is backup capacity, not critical IT. Nuclear-plant proximity does not establish direct reactor supply; planned wastewater cooling is not executed service. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wral.com/news/local/natelli-withdraws-apex-data-center-project-shearon-harris-march-2026/", "host": "wral.com", "date": "2026-03-05", "published": "2026-03-05", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.apexnc.org/DocumentCenter/View/54779/PB-2026---20260309---Planning-Board-Minutes-Approved", "host": "www.apexnc.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 35.79006, "lng": -78.65035, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round28-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "WRAL reports Natelli's withdrawal of its New Hill Digital Campus annexation and rezoning applications in Apex, with any future action contingent on later zoning changes.", "independently_verified_current_operating_status": null, "reported_application_status": "withdrawn", "reported_withdrawal_date": "2026-03-05" }, "notes": [ "Withdrawal is not final denial or permanent cancellation of every future proposal. The mentioned one-year moratorium was a proposed future motion in this report, not an adopted result. Generator MW is backup capacity, not critical IT. Nuclear-plant proximity does not establish direct reactor supply; planned wastewater cooling is not executed service.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.wral.com/news/local/natelli-withdraws-apex-data-center-project-shearon-harris-march-2026/", "host": "wral.com", "date": "2026-03-05", "published": "2026-03-05", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 39", "scope": "The original approved March 9, 2026 Planning Board minutes explicitly state that Natelli Investments annexation, rezoning and UDO amendment applications for the New Hill Data Center have been withdrawn. Reported withdrawal describes those named local applications. It is not a physical shutdown, demolition completion, prohibition on every later proposal or withdrawal of the separate Vance County project. The report date is the meeting day; the actual earlier application withdrawal day and first online publication day remain unknown.", "fields": { "current_stage_evidence": { "outcome": "approved_minutes_report_exact_new_hill_application_withdrawal", "scope": "The original approved March 9, 2026 Planning Board minutes explicitly state that Natelli Investments annexation, rezoning and UDO amendment applications for the New Hill Data Center have been withdrawn. Reported withdrawal describes those named local applications. It is not a physical shutdown, demolition completion, prohibition on every later proposal or withdrawal of the separate Vance County project. The report date is the meeting day; the actual earlier application withdrawal day and first online publication day remain unknown." } }, "notes": [ "The original approved March 9, 2026 Planning Board minutes explicitly state that Natelli Investments annexation, rezoning and UDO amendment applications for the New Hill Data Center have been withdrawn. Reported withdrawal describes those named local applications. It is not a physical shutdown, demolition completion, prohibition on every later proposal or withdrawal of the separate Vance County project. The report date is the meeting day; the actual earlier application withdrawal day and first online publication day remain unknown.", "Existing identities, roles, locations, jurisdictions, quantities and physical opening fields remain exact. Source publication, check dates, forecasts and physical milestones have distinct meanings." ], "sources": [ { "url": "https://www.apexnc.org/DocumentCenter/View/54779/PB-2026---20260309---Planning-Board-Minutes-Approved", "host": "www.apexnc.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Hill · Wake · Source context reviewed", "status_scope": "The original approved March 9, 2026 Planning Board minutes explicitly state that Natelli Investments annexation, rezoning and UDO amendment applications for the New Hill Data Center have been withdrawn. Reported withdrawal describes those named local applications. It is not a physical shutdown, demolition completion, prohibition on every later proposal or withdrawal of the separate Vance County project. The report date is the meeting day; the actual earlier application withdrawal day and first online publication day remain unknown.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37183" } }, { "id": "natelli-vance-county-henderson-nc", "state": "nc", "kind": "facility", "name": "Natelli Vance County Campus (proposed)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Vance" ], "city": "Henderson", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. The report explicitly says Natelli has not confirmed that the rezoning is for a data center. This supports a rezoning event, not a confirmed DC project approval, tenant, power allocation or construction start. The withdrawn Apex proposal and other counties' moratoriums are separate. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wral.com/news/local/vance-county-board-approves-rezoning-potential-data-center-development-april-2026/", "host": "wral.com", "date": "2026-04-21", "published": "2026-04-21", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 36.36511, "lng": -78.40796, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round28-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "WRAL reports a six-one April 20 Vance County rezoning near Henderson associated with Natelli Investments.", "independently_verified_current_operating_status": null, "reported_rezoning_date": "2026-04-20", "specific_data_center_use_confirmed": false }, "notes": [ "The report explicitly says Natelli has not confirmed that the rezoning is for a data center. This supports a rezoning event, not a confirmed DC project approval, tenant, power allocation or construction start. The withdrawn Apex proposal and other counties' moratoriums are separate.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.wral.com/news/local/vance-county-board-approves-rezoning-potential-data-center-development-april-2026/", "host": "wral.com", "date": "2026-04-21", "published": "2026-04-21", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Henderson · Vance · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37181" } }, { "id": "plan-c-crypto-fayetteville-cumberland-county-nc", "state": "nc", "kind": "facility", "name": "Plan C Crypto Fayetteville (Dedication Drive)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Cumberland" ], "city": "Fayetteville", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Plan C historical mining announcement without presumed completion. Historical forecast does not prove eventual opening or current 2026 activity. Fourth North Carolina facility is company-level ordinal, not four buildings here. Cryptocurrency mining stays distinct from general AI/cloud data-center totals. No exact site, IT MW or current contract independently established. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://fcedc.com/fayetteville-welcomes-new-data-mining-operation-first-of-its-kind-for-cumberland-county/", "host": "fcedc.com", "date": "2022-02-08", "published": "2022-02-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 35.07827, "lng": -78.80492, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Plan C historical mining announcement without presumed completion", "fields": { "publisher": "Fayetteville Cumberland Economic Development Corporation", "announcement_date": "2022-02-08", "company": "Plan C Crypto", "location": "Fayetteville, Cumberland County, North Carolina", "proposal": "regional headquarters and mining in existing industrial facility", "operations_target_quarter": "2022-Q3", "expected_new_jobs_2022": 19 }, "notes": [ "Historical forecast does not prove eventual opening or current 2026 activity. Fourth North Carolina facility is company-level ordinal, not four buildings here. Cryptocurrency mining stays distinct from general AI/cloud data-center totals. No exact site, IT MW or current contract independently established.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://fcedc.com/fayetteville-welcomes-new-data-mining-operation-first-of-its-kind-for-cumberland-county/", "host": "fcedc.com", "date": "2022-02-08", "published": "2022-02-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Fayetteville · Cumberland · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37051" } }, { "id": "pointone-lower-moncure-road-lee-county-nc", "state": "nc", "kind": "facility", "name": "PointOne Lower Moncure Road Data Center (Lee County)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lee" ], "city": "Sanford", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. SAGA's infrastructure-payment, low water/sewer, no-local-incentive and compliant-design claims are attributed, not executed contracts or independent permit review. Building investment and installed technology multiples are different scopes. Later-2026 construction and early-2028 customer acceptance are forecasts. Household equivalents are not actual gallons; public utility service does not establish capacity secured. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://sandhills.news/2026/06/08/lee-county-pointone-data-center/", "host": "sandhills.news", "date": "2026-06-08", "published": "2026-06-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 35.48594, "lng": -79.18332, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round30-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "Sandhills News quotes SAGA on PointOne/Helix's proposed Lower Moncure technology park, with a stated 90 MW IT load and an application under initial technical review.", "independently_verified_current_operating_status": null, "attributed_planned_it_mw": 90, "executed_utility_agreement_verified": false }, "notes": [ "SAGA's infrastructure-payment, low water/sewer, no-local-incentive and compliant-design claims are attributed, not executed contracts or independent permit review. Building investment and installed technology multiples are different scopes. Later-2026 construction and early-2028 customer acceptance are forecasts. Household equivalents are not actual gallons; public utility service does not establish capacity secured.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://sandhills.news/2026/06/08/lee-county-pointone-data-center/", "host": "sandhills.news", "date": "2026-06-08", "published": "2026-06-08", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Sanford · Lee · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37105" } }, { "id": "primeblock-murphy-cherokee-county-nc", "state": "nc", "kind": "facility", "name": "PrimeBlock Murphy Bitcoin Mine (Harshaw Road)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Cherokee" ], "city": "Murphy", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. WUNCJan19,2024reportwithJan11photosdirectlyidentifiesPrimeBlockHarshawRoadcryptomineoutsideMurphy. Thenobservedoperatingnotcurrent2026certificate. Commissionerinterviewallegestwoyearsunpaidtax/possiblefutureforeclosure;notverifiedtaxledgeroractualforeclosure. EstimatedMarble10-15jobsbelongtoOTHERsiteandolderyear. Countyland-usecontrolsnotblanketno-permitjurisdiction;current2026noaction/expiredmoranotcontradictionwithoutdates. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wunc.org/politics/2024-01-19/murphy-noise-cryptomining-north-carolina-western-regulations", "host": "wunc.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 35.14402, "lng": -84.07499, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "WUNCJan19,2024reportwithJan11photosdirectlyidentifiesPrimeBlockHarshawRoadcryptomineoutsideMurphy. Thenobservedoperatingnotcurrent2026certificate. Commissionerinterviewallegestwoyearsunpaidtax/possiblefutureforeclosure;notverifiedtaxledgeroractualforeclosure. EstimatedMarble10-15jobsbelongtoOTHERsiteandolderyear. Countyland-usecontrolsnotblanketno-permitjurisdiction;current2026noaction/expiredmoranotcontradictionwithoutdates." }, "notes": [ "WUNCJan19,2024reportwithJan11photosdirectlyidentifiesPrimeBlockHarshawRoadcryptomineoutsideMurphy. Thenobservedoperatingnotcurrent2026certificate. Commissionerinterviewallegestwoyearsunpaidtax/possiblefutureforeclosure;notverifiedtaxledgeroractualforeclosure. EstimatedMarble10-15jobsbelongtoOTHERsiteandolderyear. Countyland-usecontrolsnotblanketno-permitjurisdiction;current2026noaction/expiredmoranotcontradictionwithoutdates.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.wunc.org/politics/2024-01-19/murphy-noise-cryptomining-north-carolina-western-regulations", "host": "wunc.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Murphy · Cherokee · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37039" } }, { "id": "crosland-southeast-matthews-project-accelerate-nc", "state": "nc", "kind": "facility", "name": "Project Accelerate - Matthews (East John Street)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Mecklenburg" ], "city": "Matthews", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.. Developer says additional time to explore options, not irrevocable permanent cancellation.600MW proposal not current load; date not independently adopted from supplied excerpt. Subsequent original decisions and current operator disclosures take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.yahoo.com/news/articles/matthews-data-center-project-withdrawn-132947026.html", "host": "yahoo.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 35.26386, "lng": -80.85151, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round24-2026-10-14.json", "scope": "Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.", "fields": { "reported_context": "Charlotte Observer report via Yahoo reproduces Project Accelerate withdrawal and Matthews mayor confirmation; future hearings cancelled.", "independently_verified_current_operating_status": null }, "notes": [ "Developer says additional time to explore options, not irrevocable permanent cancellation.600MW proposal not current load; date not independently adopted from supplied excerpt.", "Subsequent original decisions and current operator disclosures take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.yahoo.com/news/articles/matthews-data-center-project-withdrawn-132947026.html", "host": "yahoo.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Matthews · Mecklenburg · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37119" } }, { "id": "project-delta-walnut-cove-nc", "state": "nc", "kind": "facility", "name": "Project Delta Data Center - Stokes County", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Stokes" ], "city": "Walnut Cove", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Requested court relief and allegations of procedural/ownership errors are not judicial findings. The prior solar case and other county parcels are separate. Developer jobs, tax, cooling, gas-generator and noise claims are not measured operation or enforceable commitments. No exact hearing date, current tenant or later judgment inferred; sensitive burial details and private family history are excluded from map content. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.theassemblync.com/news/environment/data-center-rezoning-stokes-county/", "host": "theassemblync.com", "date": "2026-03-19", "published": "2026-03-19", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 36.40191, "lng": -80.23963, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round30-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "The Assembly republishes Inside Climate News reporting on Stokes County's January three-two rezoning and a subsequent lawsuit seeking to invalidate it.", "independently_verified_current_operating_status": null }, "notes": [ "Requested court relief and allegations of procedural/ownership errors are not judicial findings. The prior solar case and other county parcels are separate. Developer jobs, tax, cooling, gas-generator and noise claims are not measured operation or enforceable commitments. No exact hearing date, current tenant or later judgment inferred; sensitive burial details and private family history are excluded from map content.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.theassemblync.com/news/environment/data-center-rezoning-stokes-county/", "host": "theassemblync.com", "date": "2026-03-19", "published": "2026-03-19", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Walnut Cove · Stokes · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37169" } }, { "id": "quiet-data-centers-enfield-halifax-county-nc", "state": "nc", "kind": "facility", "name": "Project Q - Quiet Data Centers Enfield (Halifax County)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Halifax" ], "city": "Enfield", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.. Finalizing is not a closed sale, exact Enfield parcel or approved site plan. No tenant, power or current operation established. Other counties moratoriums are separate jurisdictions and include threshold/date ambiguities requiring original texts. Later Raleigh October6and Fayetteville October meetings are not observed outcomes from this September update. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wral.com/news/local/central-north-carolina-data-center-plans-april-2026/", "host": "wral.com", "date": "2026-04-24", "published": "2026-04-24", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.halifaxnc.com/", "host": "www.halifaxnc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.halifaxnc.com/129/Agendas-Minutes", "host": "www.halifaxnc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 36.25783, "lng": -77.65165, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round32-2026-10-14.json", "scope": "Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.", "fields": { "reported_context": "WRAL regional roundup, updated September16, says Halifax officials were finalizing sale of a251-acre industrial site to Quiet Data Centers.", "independently_verified_current_operating_status": null }, "notes": [ "Finalizing is not a closed sale, exact Enfield parcel or approved site plan. No tenant, power or current operation established. Other counties moratoriums are separate jurisdictions and include threshold/date ambiguities requiring original texts. Later Raleigh October6and Fayetteville October meetings are not observed outcomes from this September update.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.wral.com/news/local/central-north-carolina-data-center-plans-april-2026/", "host": "wral.com", "date": "2026-04-24", "published": "2026-04-24", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 57", "scope": "The current original Halifax County home and official agendas index supply government and Board meeting navigation, including links to a public agenda portal and a separate minutes library. Their selected bodies do not substantively name or establish the Quiet Data Centers development agreement disposition, actual land closing or current computing stage. A private expected September 18 closing forecast is not adopted as a completed transaction, physical construction or computing service. No meeting cancellation or generic County schedule is transferred to an exact project outcome, and no notice subscription, login or contact request was submitted.", "fields": { "current_stage_evidence": { "outcome": "official_meeting_navigation_exact_project_stage_held", "scope": "The current original Halifax County home and official agendas index supply government and Board meeting navigation, including links to a public agenda portal and a separate minutes library. Their selected bodies do not substantively name or establish the Quiet Data Centers development agreement disposition, actual land closing or current computing stage. A private expected September 18 closing forecast is not adopted as a completed transaction, physical construction or computing service. No meeting cancellation or generic County schedule is transferred to an exact project outcome, and no notice subscription, login or contact request was submitted." }, "source_read_scope": { "original_county_home_and_agendas_index_read": true, "underlying_complete_agreement_and_final_minutes_not_read": true, "expected_land_closing_not_actual_or_compute": true, "no_minutes_library_login_or_subscription": true } }, "notes": [ "The current original Halifax County home and official agendas index supply government and Board meeting navigation, including links to a public agenda portal and a separate minutes library. Their selected bodies do not substantively name or establish the Quiet Data Centers development agreement disposition, actual land closing or current computing stage. A private expected September 18 closing forecast is not adopted as a completed transaction, physical construction or computing service. No meeting cancellation or generic County schedule is transferred to an exact project outcome, and no notice subscription, login or contact request was submitted.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.halifaxnc.com/", "host": "www.halifaxnc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.halifaxnc.com/129/Agendas-Minutes", "host": "www.halifaxnc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Enfield · Halifax · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37083" } }, { "id": "prsm-group-cumberland-county-nc", "state": "nc", "kind": "facility", "name": "PRSM Group Cumberland County AI Data Center (undisclosed industrial park)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Cumberland" ], "city": "", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. The exact site was withheld and cannot be mapped as a verified parcel. A county moratorium would not govern Fayetteville city limits. Proposed 225 MW is unspecified basis, not utility reserve or operating IT; the utility's average existing load is not available capacity. Cooling descriptions, jobs and claimed protections require engineering/contracts. Other canceled/proposed county projects are separate; no later moratorium vote inferred. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.cityviewnc.com/stories/data-center-proposal-emerges-as-county-holds-hearing-on-moratorium/", "host": "cityviewnc.com", "date": "2026-05-21", "published": "2026-05-21", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.prsm-group.com/", "host": "www.prsm-group.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.cumberlandcountync.gov/departments/planning-group/planning-and-inspections/datacenter", "host": "www.cumberlandcountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 35.04109, "lng": -78.87016, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round30-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "CityView reports PRSM's undisclosed Cumberland client concept and a May 18 moratorium hearing at which commissioners took no formal action.", "independently_verified_current_operating_status": null }, "notes": [ "The exact site was withheld and cannot be mapped as a verified parcel. A county moratorium would not govern Fayetteville city limits. Proposed 225 MW is unspecified basis, not utility reserve or operating IT; the utility's average existing load is not available capacity. Cooling descriptions, jobs and claimed protections require engineering/contracts. Other canceled/proposed county projects are separate; no later moratorium vote inferred.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.cityviewnc.com/stories/data-center-proposal-emerges-as-county-holds-hearing-on-moratorium/", "host": "cityviewnc.com", "date": "2026-05-21", "published": "2026-05-21", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 57", "scope": "The current original PRSM company home describes development work across multiple States and includes North Carolina, without naming an exact Cumberland County client, industrial park or computing facility in the selected public body. Its portfolio totals and State list are not point level stage facts. The County current data center information page describes County ordinance development and expressly separates that process from approval of a particular proposal. Its current introduction dates October 20, 2026 Joint Planning Board discussion, while an FAQ also refers to September 15. Both describe an unadopted draft; neither establishes this exact project identity, construction, computing operation or completed future November action.", "fields": { "current_stage_evidence": { "outcome": "state_portfolio_and_county_policy_not_named_facility_stage", "scope": "The current original PRSM company home describes development work across multiple States and includes North Carolina, without naming an exact Cumberland County client, industrial park or computing facility in the selected public body. Its portfolio totals and State list are not point level stage facts. The County current data center information page describes County ordinance development and expressly separates that process from approval of a particular proposal. Its current introduction dates October 20, 2026 Joint Planning Board discussion, while an FAQ also refers to September 15. Both describe an unadopted draft; neither establishes this exact project identity, construction, computing operation or completed future November action." }, "source_read_scope": { "original_company_main_body_and_county_policy_main_sections_read": true, "company_state_list_not_exact_cumberland_client": true, "portfolio_count_and_list_not_exported": true, "october20_intro_and_september15_faq_both_retained": true, "county_regulation_process_not_specific_project_approval": true, "november_month_not_exact_hearing_day": true } }, "notes": [ "The current original PRSM company home describes development work across multiple States and includes North Carolina, without naming an exact Cumberland County client, industrial park or computing facility in the selected public body. Its portfolio totals and State list are not point level stage facts. The County current data center information page describes County ordinance development and expressly separates that process from approval of a particular proposal. Its current introduction dates October 20, 2026 Joint Planning Board discussion, while an FAQ also refers to September 15. Both describe an unadopted draft; neither establishes this exact project identity, construction, computing operation or completed future November action.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.prsm-group.com/", "host": "www.prsm-group.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.cumberlandcountync.gov/departments/planning-group/planning-and-inspections/datacenter", "host": "www.cumberlandcountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Cumberland · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37051" } }, { "id": "radius-dc-raleigh-1-wake-county-nc", "state": "nc", "kind": "facility", "name": "Radius DC Raleigh I", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wake" ], "city": "Raleigh", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Raleigh signed annexation request, not municipal approval. Signed applicant petition is not adopted annexation or certificate of occupancy.180M projected market value is not actual construction spending/incentive. Project title identifies RadiusDC but use field saysOffice; clarify development use before treating whole99345sqft as data hall. Requested water/sewer boxes are not issued service capacity. No critical IT MW or current operations. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://cityofraleigh0drupal.blob.core.usgovcloudapi.net/drupal-prod/COR22/AX-009-26.pdf", "host": "cityofraleigh0drupal.blob.core.usgovcloudapi.net", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 35.80885, "lng": -78.67086, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Raleigh signed annexation request, not municipal approval", "fields": { "publisher_role": "applicant petition hosted by City of Raleigh", "project": "Radius DC RaleighI", "address": "3101 Jones Sausage Road, Raleigh, NC27529", "wake_county_pin": "1722731048", "requested_annexation_acres": 13.646, "applicant_nonresidential_space_sqft": 99345, "applicant_use_description": "Office", "projected_buildout_market_value_usd": 180000000, "owner": "B3-SFRE JSR LLC", "owner_petition_signature_date": "2026-03-11", "city_clerk_receipt_fields": "blank" }, "notes": [ "Signed applicant petition is not adopted annexation or certificate of occupancy.180M projected market value is not actual construction spending/incentive. Project title identifies RadiusDC but use field saysOffice; clarify development use before treating whole99345sqft as data hall. Requested water/sewer boxes are not issued service capacity. No critical IT MW or current operations.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cityofraleigh0drupal.blob.core.usgovcloudapi.net/drupal-prod/COR22/AX-009-26.pdf", "host": "cityofraleigh0drupal.blob.core.usgovcloudapi.net", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Raleigh · Wake · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37183" } }, { "id": "drox-group-rural-hall-forsyth-county-nc", "state": "nc", "kind": "facility", "name": "Rural Hall Data Center (The Drox Group)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Forsyth" ], "city": "Rural Hall", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Rural Hall source-role correction and reported denial requiring official record. Upstream government label was wrong. Campaign contains archived pre-vote language alongside later denial report. Independent county final minutes/decision needed before authoritative legal status. Approximate 144-acre site is not identical to 128.54-acre rezoning scope. Campaign environmental claims are concerns, not measured violations. Tenant unknown. No exact IT MW or operations inferred. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.ruralhallinfo.com/project-iron-spur/", "host": "ruralhallinfo.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.cityofws.org/3659/2026-City-County-Planning-Board-Items", "host": "www.cityofws.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.cityofws.org/DocumentCenter/View/41920/F-1669-PDF", "host": "www.cityofws.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 36.13062, "lng": -80.25613, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Rural Hall source-role correction and reported denial requiring official record", "fields": { "publisher_role": "resident opposition campaign, not municipal government", "case": "F-1669", "project": "Project Iron Spur", "developer_as_reported": "Drox Group LLC", "reported_rezoning_acres": 128.54, "campaign_reported_denial_date": "2026-07-30", "campaign_reported_denial_vote": "5-2", "reported_planned_buildings": 3, "reported_planned_gross_sqft": 1122300 }, "notes": [ "Upstream government label was wrong. Campaign contains archived pre-vote language alongside later denial report. Independent county final minutes/decision needed before authoritative legal status. Approximate 144-acre site is not identical to 128.54-acre rezoning scope. Campaign environmental claims are concerns, not measured violations. Tenant unknown. No exact IT MW or operations inferred.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.ruralhallinfo.com/project-iron-spur/", "host": "ruralhallinfo.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 57", "scope": "The original City and County planning index and linked F 1669 continuance report identify Project Iron Spur near Bethania Rural Hall Road and Glade Street. The April 2026 report records automatic continuance to a May 14 Planning Board hearing for plan refinement and additional documentation. This supports only the named case context, without an independently verified completed hearing, later Board decision, present physical stage or exact Drox legal role. The inherited ruralhallinfo source identifies itself as a resident advocacy group rather than the Town government. Its legal and impact accounts and mirrored resolutions are not adopted under this official source pass. The actual Town host was held by unavailable robots.", "fields": { "current_stage_evidence": { "outcome": "original_case_continuance_current_stage_and_final_action_held", "scope": "The original City and County planning index and linked F 1669 continuance report identify Project Iron Spur near Bethania Rural Hall Road and Glade Street. The April 2026 report records automatic continuance to a May 14 Planning Board hearing for plan refinement and additional documentation. This supports only the named case context, without an independently verified completed hearing, later Board decision, present physical stage or exact Drox legal role. The inherited ruralhallinfo source identifies itself as a resident advocacy group rather than the Town government. Its legal and impact accounts and mirrored resolutions are not adopted under this official source pass. The actual Town host was held by unavailable robots." }, "source_read_scope": { "original_case_index_selected_row_and_continuance_report_page1_read": true, "april_report_month_not_invented_exact_day": true, "future_may_hearing_schedule_not_occurrence": true, "later_private_denial_account_not_official_final_action": true, "advocacy_portal_not_town_government": true, "private_property_owner_names_excluded": true, "no_drox_role_or_exact_parcel_certification": true } }, "notes": [ "The original City and County planning index and linked F 1669 continuance report identify Project Iron Spur near Bethania Rural Hall Road and Glade Street. The April 2026 report records automatic continuance to a May 14 Planning Board hearing for plan refinement and additional documentation. This supports only the named case context, without an independently verified completed hearing, later Board decision, present physical stage or exact Drox legal role. The inherited ruralhallinfo source identifies itself as a resident advocacy group rather than the Town government. Its legal and impact accounts and mirrored resolutions are not adopted under this official source pass. The actual Town host was held by unavailable robots.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.cityofws.org/3659/2026-City-County-Planning-Board-Items", "host": "www.cityofws.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.cityofws.org/DocumentCenter/View/41920/F-1669-PDF", "host": "www.cityofws.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Rural Hall · Forsyth · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37067" } }, { "id": "t5-charlotte-nc", "state": "nc", "kind": "facility", "name": "T5@Charlotte", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Cleveland" ], "city": "Kings Mountain", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. 2022reportdoesnot independentlyestablish2026status or exactaddress. Perfect assessmentscore isnot measured uptime guarantee. OperatorSeptember14,2022reportsM&OStampofApprovalrenewalforT5Charlotte;differentfromTierdesign/facilitycertificate. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2022-09-14", "T5 Data Centers published its Charlotte Management and Operations renewal account September 14, 2022. This dates the provider publication, not an independently verified assessment day, a Tier certification, physical opening or present computing service." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://t5datacenters.com/resources/t5-charlotte-stamp-of-approval/", "host": "t5datacenters.com", "date": "2022-09-14", "published": "2022-09-14", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 35.33366, "lng": -81.55547, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "field-verification-2026-10-14.json", "scope": "Field or source context only", "fields": { "historic_operation_evidence_date": "2022-09-14", "assessment": "Uptime M&O Stamp of Approval renewal" }, "notes": [ "2022reportdoesnot independentlyestablish2026status or exactaddress.", "Perfect assessmentscore isnot measured uptime guarantee.", "OperatorSeptember14,2022reportsM&OStampofApprovalrenewalforT5Charlotte;differentfromTierdesign/facilitycertificate.", "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://t5datacenters.com/resources/t5-charlotte-stamp-of-approval/", "host": "t5datacenters.com", "date": "2022-09-14", "published": "2022-09-14", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 57", "scope": "The original September 14, 2022 provider account describes a Management and Operations Stamp of Approval renewal at T5 Charlotte and historical facility management. It does not establish present computing service, a current certification, an exact original opening day or independent current Uptime Institute verification. The old location link returned an ordinary observed redirect whose destination was HTTP 404. That missing page is not evidence of physical closure or a provider identity change. No rating, Tier, role or technical field is promoted.", "fields": { "current_stage_evidence": { "outcome": "historical_provider_account_current_service_held", "scope": "The original September 14, 2022 provider account describes a Management and Operations Stamp of Approval renewal at T5 Charlotte and historical facility management. It does not establish present computing service, a current certification, an exact original opening day or independent current Uptime Institute verification. The old location link returned an ordinary observed redirect whose destination was HTTP 404. That missing page is not evidence of physical closure or a provider identity change. No rating, Tier, role or technical field is promoted." }, "source_read_scope": { "original_provider_date_and_historical_assessment_account_read": true, "m_and_o_not_tier_certification": true, "ordinary_location_redirect_then404_retained": true, "http404_not_physical_closure": true, "current_original_service_page_not_verified": true } }, "notes": [ "The original September 14, 2022 provider account describes a Management and Operations Stamp of Approval renewal at T5 Charlotte and historical facility management. It does not establish present computing service, a current certification, an exact original opening day or independent current Uptime Institute verification. The old location link returned an ordinary observed redirect whose destination was HTTP 404. That missing page is not evidence of physical closure or a provider identity change. No rating, Tier, role or technical field is promoted.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://t5datacenters.com/resources/t5-charlotte-stamp-of-approval/", "host": "t5datacenters.com", "published": "2022-09-14", "date": "2022-09-14", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Kings Mountain · Cleveland · Source context reviewed", "event_evidence": [ { "date": "2022-09-14", "text": "T5 Data Centers published its Charlotte Management and Operations renewal account September 14, 2022. This dates the provider publication, not an independently verified assessment day, a Tier certification, physical opening or present computing service.", "kind": "announced", "sources": [ { "url": "https://t5datacenters.com/resources/t5-charlotte-stamp-of-approval/", "host": "t5datacenters.com", "published": "2022-09-14", "date": "2022-09-14", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37045" } }, { "id": "terra-nexus-custer-avenue-fayetteville-cumberland-county-nc", "state": "nc", "kind": "facility", "name": "Terra Nexus Custer Avenue Data Center (Fayetteville)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Cumberland" ], "city": "Fayetteville", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. TerraNexus Custer proposal separated from speculative DunnRoad project. Separate EnergyStorageSolutions DunnRoad50acre300MW6.4Bidea reportedlynotundercontract; notsameproject or actualfinancing. SeminarrelativeThursdaynotconvertedtofuturehearingdate. PlanCCrypto andAITexistingfacilities distinct. No exactparcel, finalapproval, currenttenant or energization established. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.cityviewnc.com/stories/how-to-learn-more-about-data-centers-in-fayetteville/", "host": "cityviewnc.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.cumberlandcountync.gov/departments/planning-group/planning-and-inspections/datacenter", "host": "www.cumberlandcountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 35.0227, "lng": -78.78695, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round13-2026-10-14.json", "scope": "TerraNexus Custer proposal separated from speculative DunnRoad project", "fields": { "company": "Terra Nexus Ventures", "reported_proposal_location": "CusterAvenue nearFayettevillePWCpowerplant andEastover, NorthCarolina", "reported_site_acres": 180, "reported_proposed_power_mw": 200, "power_basis": "reported proposal MW, not explicit critical IT", "reported_stage": "plans submitted to city" }, "notes": [ "Separate EnergyStorageSolutions DunnRoad50acre300MW6.4Bidea reportedlynotundercontract; notsameproject or actualfinancing. SeminarrelativeThursdaynotconvertedtofuturehearingdate. PlanCCrypto andAITexistingfacilities distinct. No exactparcel, finalapproval, currenttenant or energization established.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.cityviewnc.com/stories/how-to-learn-more-about-data-centers-in-fayetteville/", "host": "cityviewnc.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 57", "scope": "The current original Cumberland County data center information page concerns County rule development, not approval of a specific named facility. It does not substantively identify the exact Terra Nexus Custer Avenue proposal or certify current construction or computing. County ordinance development and its separate moratorium are not automatically assigned to City of Fayetteville jurisdiction or to a particular inherited proposal. A generic future November consideration month does not establish a scheduled project hearing, final ordinance or physical stage.", "fields": { "current_stage_evidence": { "outcome": "county_policy_not_exact_city_project_stage", "scope": "The current original Cumberland County data center information page concerns County rule development, not approval of a specific named facility. It does not substantively identify the exact Terra Nexus Custer Avenue proposal or certify current construction or computing. County ordinance development and its separate moratorium are not automatically assigned to City of Fayetteville jurisdiction or to a particular inherited proposal. A generic future November consideration month does not establish a scheduled project hearing, final ordinance or physical stage." }, "source_read_scope": { "original_county_policy_scope_and_specific_project_disclaimer_read": true, "city_fayetteville_not_automatically_county_regulatory_scope": true, "exact_custer_project_identity_not_certified": true, "no_specific_project_concern_assigned_from_county_input": true } }, "notes": [ "The current original Cumberland County data center information page concerns County rule development, not approval of a specific named facility. It does not substantively identify the exact Terra Nexus Custer Avenue proposal or certify current construction or computing. County ordinance development and its separate moratorium are not automatically assigned to City of Fayetteville jurisdiction or to a particular inherited proposal. A generic future November consideration month does not establish a scheduled project hearing, final ordinance or physical stage.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.cumberlandcountync.gov/departments/planning-group/planning-and-inspections/datacenter", "host": "www.cumberlandcountync.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Fayetteville · Cumberland · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37051" } }, { "id": "terra-nexus-rockingham-richmond-county-nc", "state": "nc", "kind": "facility", "name": "Terra Nexus Rockingham Data Center (Old Cheraw Highway)", "group": "proposed", "status": "Listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Richmond" ], "city": "Rockingham", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.. Council-hearing chronology is inconsistent: article publishedAugust 13 uses futureTuesday while caption citesAugust 11 packet; do not invent exact hearing/result. Initial 75,000 gallons/day is explicitly superseded by a proposed lower-water cooling design, but revised exact demand is unknown;1000 gallons/daysewer is distinct not additive consumption.48.4 dB is model output, not measurement. Staff claim no air permit needed despite backup generators is not adopted legal conclusion.30 jobs and 9 to 12 monthfirst-phase timing lack an observed start.824.3 million is whole-city existing taxable value, not project investment. No city incentives statement does not exclude all state/federal assistance. Project Blue Marlin/Amazon is separate. Later original decisions and observed outcomes take precedence; future events have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.yourdailyjournal.com/news/265529/rockingham-council-to-hold-public-hearing-on-data-center-rezoning", "host": "yourdailyjournal.com", "date": "2026-08-13", "published": "2026-08-13", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://img1.wsimg.com/blobby/go/b2b3cb0c-2c60-4ad2-90bc-2c01c4adfee4/downloads/84474868-d2c5-42ae-9e19-65736f6b2a31/Terra%20Nexus%20Rockingham%20Operational%20Noise%20Study.pdf?ver=1792020521238", "host": "img1.wsimg.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gorockingham.com/city-council-agendas", "host": "gorockingham.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 35.0058, "lng": -79.74793, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round33-2026-10-14.json", "scope": "Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.", "fields": { "reported_context": "Richmond County Daily Journal reports Terra Nexus’s 165-acre conditional-rezoning proposal at 316 OldCherawHighway, with planning recommendation onAugust 4 and a proposed phased 1.2 billion-dollar data center.", "independently_verified_current_operating_status": null, "original_water_design_gallons_per_day": 75000, "original_water_design_superseded_by_revised_proposal": true, "revised_water_design_gallons_per_day": null }, "notes": [ "Council-hearing chronology is inconsistent: article publishedAugust 13 uses futureTuesday while caption citesAugust 11 packet; do not invent exact hearing/result. Initial 75,000 gallons/day is explicitly superseded by a proposed lower-water cooling design, but revised exact demand is unknown;1000 gallons/daysewer is distinct not additive consumption.48.4 dB is model output, not measurement. Staff claim no air permit needed despite backup generators is not adopted legal conclusion.30 jobs and 9 to 12 monthfirst-phase timing lack an observed start.824.3 million is whole-city existing taxable value, not project investment. No city incentives statement does not exclude all state/federal assistance. Project Blue Marlin/Amazon is separate.", "Later original decisions and observed outcomes take precedence; future events have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.yourdailyjournal.com/news/265529/rockingham-council-to-hold-public-hearing-on-data-center-rezoning", "host": "yourdailyjournal.com", "date": "2026-08-13", "published": "2026-08-13", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 57", "scope": "The current original City agenda index posts a March 2026 Meridian Consultants Operational Noise Study for Terra Nexus at Rockingham. Its executive summary and project description explicitly evaluate a proposed data center development. This supports a named listed proposal within the engineering planning scope, without observed construction, computing service or a verified final City vote. Operational noise in the title refers to modeled future operation. The study says its chosen FERC comparison is a benchmark even though this project is not subject to FERC jurisdiction; it is not a newly enacted City numerical noise standard. Predicted effects, equipment counts, dimensions and suggested operational behavior are not exported as measured facility facts.", "fields": { "current_stage_evidence": { "outcome": "original_named_engineering_proposal_not_operating_noise_measurement", "scope": "The current original City agenda index posts a March 2026 Meridian Consultants Operational Noise Study for Terra Nexus at Rockingham. Its executive summary and project description explicitly evaluate a proposed data center development. This supports a named listed proposal within the engineering planning scope, without observed construction, computing service or a verified final City vote. Operational noise in the title refers to modeled future operation. The study says its chosen FERC comparison is a benchmark even though this project is not subject to FERC jurisdiction; it is not a newly enacted City numerical noise standard. Predicted effects, equipment counts, dimensions and suggested operational behavior are not exported as measured facility facts." }, "source_read_scope": { "original_city_index_and_selected_study_text_pages": [ 1, 2, 3, 4 ], "full_32_page_study_not_claimed_read": true, "predicted_operational_noise_not_observed_computing": true, "ferc_comparison_not_binding_city_rule": true, "exact_old_cheraw_street_or_parcel_not_newly_certified": true, "city_of_rockingham_in_richmond_county_not_rockingham_county": true, "unread_scanned_agendas_not_final_vote": true, "no_technical_quantity_export": true } }, "notes": [ "The current original City agenda index posts a March 2026 Meridian Consultants Operational Noise Study for Terra Nexus at Rockingham. Its executive summary and project description explicitly evaluate a proposed data center development. This supports a named listed proposal within the engineering planning scope, without observed construction, computing service or a verified final City vote. Operational noise in the title refers to modeled future operation. The study says its chosen FERC comparison is a benchmark even though this project is not subject to FERC jurisdiction; it is not a newly enacted City numerical noise standard. Predicted effects, equipment counts, dimensions and suggested operational behavior are not exported as measured facility facts.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://img1.wsimg.com/blobby/go/b2b3cb0c-2c60-4ad2-90bc-2c01c4adfee4/downloads/84474868-d2c5-42ae-9e19-65736f6b2a31/Terra%20Nexus%20Rockingham%20Operational%20Noise%20Study.pdf?ver=1792020521238", "host": "img1.wsimg.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gorockingham.com/city-council-agendas", "host": "gorockingham.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Rockingham · Richmond · Source context reviewed", "status_scope": "The current original City agenda index posts a March 2026 Meridian Consultants Operational Noise Study for Terra Nexus at Rockingham. Its executive summary and project description explicitly evaluate a proposed data center development. This supports a named listed proposal within the engineering planning scope, without observed construction, computing service or a verified final City vote. Operational noise in the title refers to modeled future operation. The study says its chosen FERC comparison is a benchmark even though this project is not subject to FERC jurisdiction; it is not a newly enacted City numerical noise standard. Predicted effects, equipment counts, dimensions and suggested operational behavior are not exported as measured facility facts.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37153" } }, { "id": "tierpoint-charlotte-center-park-nc", "state": "nc", "kind": "facility", "name": "TierPoint Charlotte - Center Park", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Mecklenburg" ], "city": "Charlotte", "address": "", "who": "TierPoint", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Redundant generator ratings are not critical IT or utility capacity. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/charlotte-center-park/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1805+Center+Park+Drive%2C+Charlotte%2C+NC+28217&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint facility navigation links and separate corporate headquarters section" } ], "loc": { "lat": 35.174313531197, "lng": -80.927472430193, "precision": "address", "basis": "Published TierPoint facility address 1805 Center Park Drive, Charlotte, NC 28217 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "direct-operators-round5-2026-10-14.json", "scope": "named operator source", "fields": { "gross_area_sqft_lower_bound": 60000, "raised_floor_sqft_lower_bound": 20000, "backup_generator_configuration": { "units": 4, "mw_each": 2.25 } }, "notes": [ "Redundant generator ratings are not critical IT or utility capacity.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/charlotte-center-park/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "TierPoint lists colocation and managed services at its Charlotte - Center Park location. This supports an operator-listed colocation service label, not an opening date, full energized capacity, independently verified certification, legal ownership or a surveyed parcel.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "TierPoint lists colocation and managed services at its Charlotte - Center Park location. This supports an operator-listed colocation service label, not an opening date, full energized capacity, independently verified certification, legal ownership or a surveyed parcel." } }, "notes": [ "Named main-body introduction, current product-availability passage and physical-location block. Promotional guarantees, technical totals and certifications were not adopted." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/charlotte-center-park/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 5, October 22, 2026", "scope": "Published operator street reference only. No canonical address, status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 35.174313531197, "lng": -80.927472430193, "precision": "address", "basis": "Published TierPoint facility address 1805 Center Park Drive, Charlotte, NC 28217 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "1805 Center Park Drive, Charlotte, NC 28217", "county_fips": [ "37119" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named facility address section supplies the street and locality. The corporate headquarters footer is excluded. The published facility address is retained as location evidence; the existing blank canonical address field is not changed in this location only transaction.", "The source facility page and its current navigation link identify the same existing research record. A regional market name does not replace the published locality or county. The existing service status, physical dates, technical figures, organizations and jurisdiction wrappers remain exact." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/charlotte-center-park/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint named facility address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1805+Center+Park+Drive%2C+Charlotte%2C+NC+28217&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint facility navigation links and separate corporate headquarters section" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "K3 sourced operator roles October 22, 2026", "scope": "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted.", "fields": { "company_association": { "name": "TierPoint", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted." }, "provider_role": "operator" }, "notes": [ "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted.", "Source retrieval is not an opening or operating date." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/charlotte-center-park/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator identity source" } ], "checked": "2026-10-22", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Charlotte · Mecklenburg · Source context reviewed", "status_scope": "TierPoint lists colocation and managed services at its Charlotte - Center Park location. This supports an operator-listed colocation service label, not an opening date, full energized capacity, independently verified certification, legal ownership or a surveyed parcel." }, { "id": "tierpoint-charlotte-north-myers-nc", "state": "nc", "kind": "facility", "name": "TierPoint Charlotte - North Myers", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Mecklenburg" ], "city": "Charlotte", "address": "", "who": "TierPoint", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. North Carolina regional source with three bound named addresses. 230000 square feet covers four North Carolina locations including Center Park, not per site. RTP is Durham, not Raleigh municipality. Tax-exemption marketing not a reviewed incentive award. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.tierpoint.com/data-centers/north-carolina/charlotte-north-myers/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=125+North+Myers+Street%2C+Charlotte%2C+NC+28202&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint facility navigation links and separate corporate headquarters section" } ], "loc": { "lat": 35.221490050708, "lng": -80.835818238517, "precision": "address", "basis": "Published TierPoint facility address 125 North Myers Street, Charlotte, NC 28202 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "North Carolina regional source with three bound named addresses", "fields": { "named_site_addresses": [ { "site": "Charlotte North Myers", "address": "125 North Myers Street, Charlotte, NC28202" }, { "site": "Raleigh Departure", "address": "5301 Departure Drive, Raleigh, NC27616" }, { "site": "Raleigh RTP", "address": "99 TW Alexander Drive, Durham, NC27709" } ], "regional_combined_area_sqft": 230000 }, "notes": [ "230000 square feet covers four North Carolina locations including Center Park, not per site. RTP is Durham, not Raleigh municipality. Tax-exemption marketing not a reviewed incentive award.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "TierPoint lists colocation and managed services at its Charlotte - North Myers location. This supports an operator-listed colocation service label, not an opening date, full energized capacity, independently verified certification, legal ownership or a surveyed parcel.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "TierPoint lists colocation and managed services at its Charlotte - North Myers location. This supports an operator-listed colocation service label, not an opening date, full energized capacity, independently verified certification, legal ownership or a surveyed parcel." } }, "notes": [ "Named main-body introduction, current product-availability passage and physical-location block. Promotional guarantees, technical totals and certifications were not adopted." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/charlotte-north-myers/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 5, October 22, 2026", "scope": "Published operator street reference only. No canonical address, status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 35.221490050708, "lng": -80.835818238517, "precision": "address", "basis": "Published TierPoint facility address 125 North Myers Street, Charlotte, NC 28202 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "125 North Myers Street, Charlotte, NC 28202", "county_fips": [ "37119" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named facility address section supplies the street and locality. The corporate headquarters footer is excluded. The published facility address is retained as location evidence; the existing blank canonical address field is not changed in this location only transaction.", "The source facility page and its current navigation link identify the same existing research record. A regional market name does not replace the published locality or county. The existing service status, physical dates, technical figures, organizations and jurisdiction wrappers remain exact." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/charlotte-north-myers/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint named facility address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=125+North+Myers+Street%2C+Charlotte%2C+NC+28202&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint facility navigation links and separate corporate headquarters section" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "K3 sourced operator roles October 22, 2026", "scope": "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted.", "fields": { "company_association": { "name": "TierPoint", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted." }, "provider_role": "operator" }, "notes": [ "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted.", "Source retrieval is not an opening or operating date." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/charlotte-north-myers/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator identity source" } ], "checked": "2026-10-22", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Charlotte · Mecklenburg · Source context reviewed", "status_scope": "TierPoint lists colocation and managed services at its Charlotte - North Myers location. This supports an operator-listed colocation service label, not an opening date, full energized capacity, independently verified certification, legal ownership or a surveyed parcel." }, { "id": "tierpoint-raleigh-departure-drive-nc", "state": "nc", "kind": "facility", "name": "TierPoint Raleigh (Departure Drive)", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wake" ], "city": "Raleigh", "address": "", "who": "TierPoint", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. North Carolina regional source with three bound named addresses. 230000 square feet covers four North Carolina locations including Center Park, not per site. RTP is Durham, not Raleigh municipality. Tax-exemption marketing not a reviewed incentive award. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.tierpoint.com/data-centers/north-carolina/raleigh/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=5301+Departure+Drive%2C+Raleigh%2C+NC+27616&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint facility navigation links and separate corporate headquarters section" } ], "loc": { "lat": 35.854413339075, "lng": -78.595783985463, "precision": "address", "basis": "Published TierPoint facility address 5301 Departure Drive, Raleigh, NC 27616 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "North Carolina regional source with three bound named addresses", "fields": { "named_site_addresses": [ { "site": "Charlotte North Myers", "address": "125 North Myers Street, Charlotte, NC28202" }, { "site": "Raleigh Departure", "address": "5301 Departure Drive, Raleigh, NC27616" }, { "site": "Raleigh RTP", "address": "99 TW Alexander Drive, Durham, NC27709" } ], "regional_combined_area_sqft": 230000 }, "notes": [ "230000 square feet covers four North Carolina locations including Center Park, not per site. RTP is Durham, not Raleigh municipality. Tax-exemption marketing not a reviewed incentive award.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "TierPoint lists current colocation services at its Raleigh RAL facility on Departure Drive, distinct from its RTP location. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "TierPoint lists current colocation services at its Raleigh RAL facility on Departure Drive, distinct from its RTP location. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "TierPoint lists current colocation services at its Raleigh RAL facility on Departure Drive, distinct from its RTP location." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/raleigh/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 5, October 22, 2026", "scope": "Published operator street reference only. No canonical address, status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 35.854413339075, "lng": -78.595783985463, "precision": "address", "basis": "Published TierPoint facility address 5301 Departure Drive, Raleigh, NC 27616 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "5301 Departure Drive, Raleigh, NC 27616", "county_fips": [ "37183" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named facility address section supplies the street and locality. The corporate headquarters footer is excluded. The published facility address is retained as location evidence; the existing blank canonical address field is not changed in this location only transaction.", "The source facility page and its current navigation link identify the same existing research record. A regional market name does not replace the published locality or county. The existing service status, physical dates, technical figures, organizations and jurisdiction wrappers remain exact." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/raleigh/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint named facility address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=5301+Departure+Drive%2C+Raleigh%2C+NC+27616&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint facility navigation links and separate corporate headquarters section" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "K3 sourced operator roles October 22, 2026", "scope": "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted.", "fields": { "company_association": { "name": "TierPoint", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted." }, "provider_role": "operator" }, "notes": [ "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted.", "Source retrieval is not an opening or operating date." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/raleigh/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator identity source" } ], "checked": "2026-10-22", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Raleigh · Wake · Source context reviewed", "status_scope": "TierPoint lists current colocation services at its Raleigh RAL facility on Departure Drive, distinct from its RTP location. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "tierpoint-raleigh-rtp-durham-nc", "state": "nc", "kind": "facility", "name": "TierPoint Raleigh - RTP", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Durham" ], "city": "Durham", "address": "", "who": "TierPoint", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. North Carolina regional source with three bound named addresses. 230000 square feet covers four North Carolina locations including Center Park, not per site. RTP is Durham, not Raleigh municipality. Tax-exemption marketing not a reviewed incentive award. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.tierpoint.com/data-centers/north-carolina/raleigh-rtp/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" }, { "url": "https://services2.arcgis.com/G5vR3cOjh6g2Ed8E/arcgis/rest/services/Parcels_NEW/FeatureServer/0/query?where=REID%3D%27154120%27+AND+PIN%3D%270738519437%27+AND+PIN_EXT%3D%27000%27&outFields=OBJECTID_1%2CFEATURE_KEY%2CPARCEL_TYPE%2CREID%2CPIN%2CPIN_EXT%2CLOCATION_ADDR%2CPHYADDR_STR_NUM%2CPHYADDR_DIR_PFX%2CPHYADDR_STR%2CPHYADDR_STR_TYPE%2CPHYADDR_STR_SFX%2CPHYADDR_CITY%2CPHYADDR_STATE%2CPHYADDR_ZIP&returnGeometry=true&outSR=4326&resultRecordCount=25&f=json", "host": "services2.arcgis.com", "published": "", "date": "", "checked": "2026-10-23", "label": "One exact bounded official reference parcel" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-78.88256125123392%2C35.89398591088753%2C-78.87479874876608%2C35.900274089112465&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting only, acquisition date unknown" }, { "url": "https://services2.arcgis.com/G5vR3cOjh6g2Ed8E/arcgis/rest/services/Parcels_NEW/FeatureServer/0?f=pjson", "host": "services2.arcgis.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Official reference parcel field definitions and attribution" }, { "url": "https://services2.arcgis.com/G5vR3cOjh6g2Ed8E/arcgis/rest/services/Parcels_NEW/FeatureServer?f=pjson", "host": "services2.arcgis.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Official agency reference purpose and assessment limitations" }, { "url": "https://services2.arcgis.com/G5vR3cOjh6g2Ed8E/arcgis/rest/services/Parcels_NEW/FeatureServer/0/query?where=UPPER%28LOCATION_ADDR%29+LIKE+%2799%25ALEXANDER%25%27&outFields=OBJECTID_1%2CFEATURE_KEY%2CPARCEL_TYPE%2CREID%2CPIN%2CPIN_EXT%2CLOCATION_ADDR%2CCITY%2CTOWNSHIP%2CPHYADDR_STR_NUM%2CPHYADDR_DIR_PFX%2CPHYADDR_STR%2CPHYADDR_STR_TYPE%2CPHYADDR_STR_SFX%2CPHYADDR_CITY%2CPHYADDR_STATE%2CPHYADDR_ZIP&returnGeometry=true&outSR=4326&resultRecordCount=25&f=json", "host": "services2.arcgis.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Broad complete street query, unit assessment alternatives excluded" } ], "loc": { "lng": -78.87868, "lat": 35.89713, "precision": "approximate", "basis": "Approximate reference parcel center for TierPoint service address 99 TW Alexander Drive, Durham, NC 27709. Official reference 0738519437 only, not a roof, surveyed title, tenant unit or full campus. Aerial acquisition date is unknown and may predate construction. Existing native status remains operating." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "North Carolina regional source with three bound named addresses", "fields": { "named_site_addresses": [ { "site": "Charlotte North Myers", "address": "125 North Myers Street, Charlotte, NC28202" }, { "site": "Raleigh Departure", "address": "5301 Departure Drive, Raleigh, NC27616" }, { "site": "Raleigh RTP", "address": "99 TW Alexander Drive, Durham, NC27709" } ], "regional_combined_area_sqft": 230000 }, "notes": [ "230000 square feet covers four North Carolina locations including Center Park, not per site. RTP is Durham, not Raleigh municipality. Tax-exemption marketing not a reviewed incentive award.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "TierPoint lists current colocation services and a hosted cloud pod at its Raleigh RTP facility in Durham, distinct from RAL. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "TierPoint lists current colocation services and a hosted cloud pod at its Raleigh RTP facility in Durham, distinct from RAL. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "TierPoint lists current colocation services and a hosted cloud pod at its Raleigh RTP facility in Durham, distinct from RAL." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/raleigh-rtp/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "K3 sourced operator roles October 22, 2026", "scope": "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted.", "fields": { "company_association": { "name": "TierPoint", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted." }, "provider_role": "operator" }, "notes": [ "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted.", "Source retrieval is not an opening or operating date." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/raleigh-rtp/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator identity source" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 28, October 23, 2026", "scope": "Approximate remains approximate. One bounded official reference parcel only. Existing native status remains operating.", "fields": { "location_review_decision": { "location": { "lng": -78.87868, "lat": 35.89713, "precision": "approximate", "basis": "Approximate reference parcel center for TierPoint service address 99 TW Alexander Drive, Durham, NC 27709. Official reference 0738519437 only, not a roof, surveyed title, tenant unit or full campus. Aerial acquisition date is unknown and may predate construction. Existing native status remains operating." }, "reference_method": "Approximate county reference parcel center", "reference_parcel": { "identifier": "0738519437", "identifier_field": "PIN", "objectid": 139270245, "agency": "Durham County Tax Administration", "reference_method": "calculated_polygon_centroid", "not_survey_quality": true, "legal_title_verified": false, "independent_building_identity": false, "full_campus_verified": false, "operator_ownership_verified": false, "reid": "154120", "pin_extension": "000", "county_postal": "27713", "operator_postal": "27709", "postal_difference_unresolved": true }, "operator_coordinates_adopted": false, "census_range_adopted": false } }, "notes": [ "The current named TierPoint RTP section gives 99 TW Alexander Drive, Durham, postal 27709. The exact county base reference REID 154120, PIN 0738519437, extension 000 gives 99 T W Alexander Drive, Durham, postal 27713. Numeric street and directions agree, while the postal difference remains explicit and unresolved. The three feature address query also returns separately assessed unit references with extensions 001 and 002. Only the exact complete street reference with extension 000 is selected; no leasehold, condo unit, title or whole building is certified. County documentation explains stacked ground and unit assessment polygons. PARCEL_TYPE 1 is retained as an attribute without inventing an undocumented domain meaning. The linked data dictionary returned access denial, which remains documented.", "This is one explicitly reviewed approximate reference parcel, not surveyed title, ownership, a roof, tenant unit, independent building or complete campus.", "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact.", "Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. Raw parcel geometry is not exported.", "The inherited Compute Atlas point is an unreviewed general area, not an earlier accepted parcel or street reference. The current named TierPoint RTP section gives 99 TW Alexander Drive, Durham. The exact county base reference REID 154120 and PIN 0738519437 extension 000 gives the same complete numeric street. Operator postal 27709 and county postal 27713 remain explicitly unresolved. The approximate mathematical center lies inside that source polygon and retained Durham County, 3907.5 metres from the inherited point. Actually viewed imagery shows commercial or industrial forms, paved access and woodland of unknown acquisition date. No unit extension, roof, full campus, title or physical milestone is certified." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/north-carolina/raleigh-rtp/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Current dedicated named operator service address section" }, { "url": "https://services2.arcgis.com/G5vR3cOjh6g2Ed8E/arcgis/rest/services/Parcels_NEW/FeatureServer/0/query?where=REID%3D%27154120%27+AND+PIN%3D%270738519437%27+AND+PIN_EXT%3D%27000%27&outFields=OBJECTID_1%2CFEATURE_KEY%2CPARCEL_TYPE%2CREID%2CPIN%2CPIN_EXT%2CLOCATION_ADDR%2CPHYADDR_STR_NUM%2CPHYADDR_DIR_PFX%2CPHYADDR_STR%2CPHYADDR_STR_TYPE%2CPHYADDR_STR_SFX%2CPHYADDR_CITY%2CPHYADDR_STATE%2CPHYADDR_ZIP&returnGeometry=true&outSR=4326&resultRecordCount=25&f=json", "host": "services2.arcgis.com", "published": "", "date": "", "checked": "2026-10-23", "label": "One exact bounded official reference parcel" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-78.88256125123392%2C35.89398591088753%2C-78.87479874876608%2C35.900274089112465&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting only, acquisition date unknown" }, { "url": "https://services2.arcgis.com/G5vR3cOjh6g2Ed8E/arcgis/rest/services/Parcels_NEW/FeatureServer/0?f=pjson", "host": "services2.arcgis.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Official reference parcel field definitions and attribution" }, { "url": "https://services2.arcgis.com/G5vR3cOjh6g2Ed8E/arcgis/rest/services/Parcels_NEW/FeatureServer?f=pjson", "host": "services2.arcgis.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Official agency reference purpose and assessment limitations" }, { "url": "https://services2.arcgis.com/G5vR3cOjh6g2Ed8E/arcgis/rest/services/Parcels_NEW/FeatureServer/0/query?where=UPPER%28LOCATION_ADDR%29+LIKE+%2799%25ALEXANDER%25%27&outFields=OBJECTID_1%2CFEATURE_KEY%2CPARCEL_TYPE%2CREID%2CPIN%2CPIN_EXT%2CLOCATION_ADDR%2CCITY%2CTOWNSHIP%2CPHYADDR_STR_NUM%2CPHYADDR_DIR_PFX%2CPHYADDR_STR%2CPHYADDR_STR_TYPE%2CPHYADDR_STR_SFX%2CPHYADDR_CITY%2CPHYADDR_STATE%2CPHYADDR_ZIP&returnGeometry=true&outSR=4326&resultRecordCount=25&f=json", "host": "services2.arcgis.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Broad complete street query, unit assessment alternatives excluded" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Approximate reference parcel, not a surveyed building or full campus", "summary": "Durham · Durham · Source context reviewed", "status_scope": "TierPoint lists current colocation services and a hosted cloud pod at its Raleigh RTP facility in Durham, distinct from RAL. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "eco-tip-west-moncure-chatham-county-nc", "state": "nc", "kind": "facility", "name": "Triangle Innovation Point West Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Chatham" ], "city": "Moncure", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read exact-project public section or complete named article; derivative database/AI aggregation, exact-site mismatch and generic directories receive no independent manual-ID credit.. Secondary screeningcontextonly; nocourtjudgment,originalcomplaintoradoptedChathammoratoriumreviewedhere.750MWbasisnotcriticalITverified;11millionispartyclaimnotauditedcapex.20plusNCjurisdictioncountmixespauses/bans/drafts; cannotadoptascomplete/currentcensus. TrackerAprilRowanclaimconflictswithseparatelyreviewedMay4original,whichcontrols. UnenactedHB1063notlaw; genericinterconnectiontimelines/homewater/forecastelectricitysharesnotcampuscommitments. Unverifiedfuturecourtoutcomedoesnotautomaticallysetstatewideprecedent. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gpuleaseindex.com/readiness/nc-data-center-moratoriums", "host": "gpuleaseindex.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 35.7027, "lng": -79.25534, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round38-2026-10-14.json", "scope": "Personally read exact-project public section or complete named article; derivative database/AI aggregation, exact-site mismatch and generic directories receive no independent manual-ID credit.", "fields": { "reported_context": "Commercial GPULeaseIndex tracker describes EcoTIPWest lawsuit against ChathamCounty moratorium over a750MW/400plusacreMoncureproposal, with developer claiming11millionUSDpre-pauseexpenditure andvested/permitted-usearguments.", "independently_verified_current_operating_status": null }, "notes": [ "Secondary screeningcontextonly; nocourtjudgment,originalcomplaintoradoptedChathammoratoriumreviewedhere.750MWbasisnotcriticalITverified;11millionispartyclaimnotauditedcapex.20plusNCjurisdictioncountmixespauses/bans/drafts; cannotadoptascomplete/currentcensus. TrackerAprilRowanclaimconflictswithseparatelyreviewedMay4original,whichcontrols. UnenactedHB1063notlaw; genericinterconnectiontimelines/homewater/forecastelectricitysharesnotcampuscommitments. Unverifiedfuturecourtoutcomedoesnotautomaticallysetstatewideprecedent.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gpuleaseindex.com/readiness/nc-data-center-moratoriums", "host": "gpuleaseindex.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Moncure · Chatham · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37037" } }, { "id": "whitefiber-nc1-madison-nc", "state": "nc", "kind": "facility", "name": "WhiteFiber NC-1 AI Data Center Campus", "group": "operating", "status": "Reported service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Rockingham" ], "city": "Madison", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. WhiteFiber NC1 mixed-date status and conditional investment. May2026updatedpagestillusesDec2025futuretargetand24expectedbodywhileheadline24operational;statusconflictheld.200conditionalESAnotcurrentIToradditionalto99.45Mcashpropertyacquisitionnotfullbuildcapex;1Bplanincludesconditionalphasesnotallpaid.970kgrossindustrialreuse notallbuiltDCwhitespace. Noobservedcommissioning/executedtenantlease. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-08-12", "WhiteFiber issued its corrected quarterly results release August 12, 2026, reporting active customer deployment and initial billing at NC 1. This dates issuer publication, not the first physical commissioning day, full contracted load or completion of every planned campus phase." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.whitefiber.com/blog/nc-1-data-center", "host": "whitefiber.com", "date": "2026-05-06", "published": "2026-05-06", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.prnewswire.com/news-releases/whitefiber-inc-reports-second-quarter-2026-results-302848971.html", "host": "www.prnewswire.com", "published": "2026-08-12", "date": "2026-08-12", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 36.39602, "lng": -79.77497, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "WhiteFiber NC1 mixed-date status and conditional investment", "fields": { "operator": "WhiteFiber", "site": "NC1", "locality": "Madison, Rockingham County, North Carolina", "page_updated_date": "2026-05-06", "existing_industrial_sqft_approx": 970000, "site_acres": 96, "reported_cash_property_purchase_usd": 45000000, "headline_operational_power_mw": 24, "body_expected_power_mw": 24, "body_expected_power_target": "2025-Q4", "historical_go_live_target": "2025-12", "reported_power_secured_mw": 99, "conditional_potential_power_mw_max": 200, "planned_investment_usd_min_exclusive": 1000000000, "investment_condition": "up-to200MWfromDukeEnergyoverextendedperiod,financingandexecutionmilestones", "first_customer_commitment": "nonbindingLOI", "canonical_current_operating_power_mw": null }, "notes": [ "May2026updatedpagestillusesDec2025futuretargetand24expectedbodywhileheadline24operational;statusconflictheld.200conditionalESAnotcurrentIToradditionalto99.45Mcashpropertyacquisitionnotfullbuildcapex;1Bplanincludesconditionalphasesnotallpaid.970kgrossindustrialreuse notallbuiltDCwhitespace. Noobservedcommissioning/executedtenantlease.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.whitefiber.com/blog/nc-1-data-center", "host": "whitefiber.com", "date": "2026-05-06", "published": "2026-05-06", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 57", "scope": "The original corrected August 12, 2026 WhiteFiber issuer release explicitly reports that NC 1 moved from construction into active customer deployment, that initial billing had commenced and that the site was generating revenue. This supports reported initial service at the named Madison campus within the issuer account. Full contracted billing later that month and larger future campus scale remain forecasts, without a verified exact first commissioning day or current full load. The older blog last updated May 6 mixes operational power with an older expected power date and planned retrofit language; those power and property claims do not independently establish computing operation. The selected SEC filing source was held by unavailable robots, while this distinct original issuer release was independently read.", "fields": { "current_stage_evidence": { "outcome": "original_corrected_issuer_reports_initial_customer_service", "scope": "The original corrected August 12, 2026 WhiteFiber issuer release explicitly reports that NC 1 moved from construction into active customer deployment, that initial billing had commenced and that the site was generating revenue. This supports reported initial service at the named Madison campus within the issuer account. Full contracted billing later that month and larger future campus scale remain forecasts, without a verified exact first commissioning day or current full load. The older blog last updated May 6 mixes operational power with an older expected power date and planned retrofit language; those power and property claims do not independently establish computing operation. The selected SEC filing source was held by unavailable robots, while this distinct original issuer release was independently read." }, "source_read_scope": { "original_corrected_issuer_authorship_and_nc1_executive_account_read": true, "correction_notice_and_final_correction_note_read": true, "original_fiscal_period_not_service_start_day": true, "first_billing_and_deployment_not_full_future_contracted_load": true, "older_blog_last_updated_not_original_opening_day": true, "power_availability_not_compute_occupancy": true, "sec_body_not_read_or_substituted": true, "no_technical_financial_or_provider_role_export": true } }, "notes": [ "The original corrected August 12, 2026 WhiteFiber issuer release explicitly reports that NC 1 moved from construction into active customer deployment, that initial billing had commenced and that the site was generating revenue. This supports reported initial service at the named Madison campus within the issuer account. Full contracted billing later that month and larger future campus scale remain forecasts, without a verified exact first commissioning day or current full load. The older blog last updated May 6 mixes operational power with an older expected power date and planned retrofit language; those power and property claims do not independently establish computing operation. The selected SEC filing source was held by unavailable robots, while this distinct original issuer release was independently read.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.prnewswire.com/news-releases/whitefiber-inc-reports-second-quarter-2026-results-302848971.html", "host": "www.prnewswire.com", "published": "2026-08-12", "date": "2026-08-12", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.whitefiber.com/blog/nc-1-data-center", "host": "www.whitefiber.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Madison · Rockingham · Source context reviewed", "status_scope": "The original corrected August 12, 2026 WhiteFiber issuer release explicitly reports that NC 1 moved from construction into active customer deployment, that initial billing had commenced and that the site was generating revenue. This supports reported initial service at the named Madison campus within the issuer account. Full contracted billing later that month and larger future campus scale remain forecasts, without a verified exact first commissioning day or current full load. The older blog last updated May 6 mixes operational power with an older expected power date and planned retrofit language; those power and property claims do not independently establish computing operation. The selected SEC filing source was held by unavailable robots, while this distinct original issuer release was independently read.", "event_evidence": [ { "date": "2026-08-12", "text": "WhiteFiber issued its corrected quarterly results release August 12, 2026, reporting active customer deployment and initial billing at NC 1. This dates issuer publication, not the first physical commissioning day, full contracted load or completion of every planned campus phase.", "kind": "announced", "sources": [ { "url": "https://www.prnewswire.com/news-releases/whitefiber-inc-reports-second-quarter-2026-results-302848971.html", "host": "www.prnewswire.com", "published": "2026-08-12", "date": "2026-08-12", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "37157" } }, { "id": "uncc-rup5-campus-data-center-charlotte-nc", "state": "nc", "kind": "facility", "name": "UNC Charlotte RUP 5 Data Center", "group": "unknown", "status": "Status unclear", "crypto": false, "type": "Data center research context", "counties": [ "Mecklenburg" ], "city": "Charlotte", "address": "", "who": "University of North Carolina at Charlotte", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Official source identifies a named physical or planned data center context. County association only. Current operating stage, exact site point and technical capacity remain unverified.", "date": "", "events": [ [ "2026-10-25", "Added to the atlas. Compilation date only, not opening or construction." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://facilities.charlotte.edu/wp-content/uploads/sites/1297/2026/04/RUP-5-Data-Center-Expansion-NTB-Final.pdf", "host": "facilities.charlotte.edu", "published": "", "date": "", "checked": "2026-10-25", "label": "Official source retained for premises or county context" }, { "url": "https://facilities.charlotte.edu/wp-content/uploads/sites/1297/2024/06/Storm-Water-Master-Plan-Final-Report-201209101.pdf", "host": "facilities.charlotte.edu", "published": "", "date": "", "checked": "2026-10-25", "label": "Official source retained for premises or county context" } ], "loc": { "lat": 35.21095, "lng": -80.82965, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": false, "precision_label": "Exact site not published; shown at county level", "summary": "Charlotte sourced data center research context. County level only.", "reviewed_evidence": [ { "overlay": "Codex 3 inherited discovery review 16", "scope": "Official source identifies a named physical or planned data center context. County association only. Current operating stage, exact site point and technical capacity remain unverified.", "fields": { "source_context": { "name": "UNC Charlotte RUP 5 Data Center", "operator": "University of North Carolina at Charlotte", "scope": "Official source identifies a named physical or planned data center context. County association only. Current operating stage, exact site point and technical capacity remain unverified.", "address": "", "exact_street_unpublished": true }, "county_association": { "county": "Mecklenburg", "county_fips": "37119", "scope": "Campus stormwater report page23 uses MecklenburgCounty tax maps for main campus.891acres is whole campus, not data center acreage." }, "atlas_added_event": { "kind": "atlas_added", "date": "2026-10-25", "scope": "Intended compilation day only. Must equal actual admission day before Native commit; never a physical milestone." } }, "notes": [ "Official source identifies a named physical or planned data center context. County association only. Current operating stage, exact site point and technical capacity remain unverified.", "Historical forecasts, permits, funding and building occupancy do not establish current data center operation." ], "sources": [ { "url": "https://facilities.charlotte.edu/wp-content/uploads/sites/1297/2026/04/RUP-5-Data-Center-Expansion-NTB-Final.pdf", "host": "facilities.charlotte.edu", "published": "", "date": "", "checked": "2026-10-25", "label": "Official source retained for premises or county context" }, { "url": "https://facilities.charlotte.edu/wp-content/uploads/sites/1297/2024/06/Storm-Water-Master-Plan-Final-Report-201209101.pdf", "host": "facilities.charlotte.edu", "published": "", "date": "", "checked": "2026-10-25", "label": "Official source retained for premises or county context" } ], "checked": "2026-10-25", "whole_record_certified": false } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "no_site_point", "county_display": "37119" } }, { "id": "fayetteville-state-butler-campus-data-center-nc", "state": "nc", "kind": "facility", "name": "Fayetteville State University Butler Data Center", "group": "unknown", "status": "Status unclear", "crypto": false, "type": "Data center research context", "counties": [ "Cumberland" ], "city": "Fayetteville", "address": "", "who": "Fayetteville State University", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Official source identifies a named physical or planned data center context. County association only. Current operating stage, exact site point and technical capacity remain unverified.", "date": "", "events": [ [ "2026-10-25", "Added to the atlas. Compilation date only, not opening or construction." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.uncfsu.edu/assets/Documents/Facilities%20Management/Designer%20Solicitation/Designer%20Selection%20Butler%20Telecom%20MEP%202022-03-15.pdf", "host": "www.uncfsu.edu", "published": "", "date": "", "checked": "2026-10-25", "label": "Official source retained for premises or county context" }, { "url": "https://www.uncfsu.edu/assets/Documents/Office%20of%20Legal%20Affairs/Policies/Emergency%20Operations%20Plan%20Rev.%2004-2024.pdf", "host": "www.uncfsu.edu", "published": "", "date": "", "checked": "2026-10-25", "label": "Official source retained for premises or county context" } ], "loc": { "lat": 35.0182, "lng": -78.82499, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": false, "precision_label": "Exact site not published; shown at county level", "summary": "Fayetteville sourced data center research context. County level only.", "reviewed_evidence": [ { "overlay": "Codex 3 inherited discovery review 16", "scope": "Official source identifies a named physical or planned data center context. County association only. Current operating stage, exact site point and technical capacity remain unverified.", "fields": { "source_context": { "name": "Fayetteville State University Butler Data Center", "operator": "Fayetteville State University", "scope": "Official source identifies a named physical or planned data center context. County association only. Current operating stage, exact site point and technical capacity remain unverified.", "address": "", "exact_street_unpublished": true }, "county_association": { "county": "Cumberland", "county_fips": "37051", "scope": "University emergency plan page5 explicitly locates University in Fayetteville,CumberlandCounty. No street or exact point inferred." }, "atlas_added_event": { "kind": "atlas_added", "date": "2026-10-25", "scope": "Intended compilation day only. Must equal actual admission day before Native commit; never a physical milestone." } }, "notes": [ "Official source identifies a named physical or planned data center context. County association only. Current operating stage, exact site point and technical capacity remain unverified.", "Historical forecasts, permits, funding and building occupancy do not establish current data center operation." ], "sources": [ { "url": "https://www.uncfsu.edu/assets/Documents/Facilities%20Management/Designer%20Solicitation/Designer%20Selection%20Butler%20Telecom%20MEP%202022-03-15.pdf", "host": "www.uncfsu.edu", "published": "", "date": "", "checked": "2026-10-25", "label": "Official source retained for premises or county context" }, { "url": "https://www.uncfsu.edu/assets/Documents/Office%20of%20Legal%20Affairs/Policies/Emergency%20Operations%20Plan%20Rev.%2004-2024.pdf", "host": "www.uncfsu.edu", "published": "", "date": "", "checked": "2026-10-25", "label": "Official source retained for premises or county context" } ], "checked": "2026-10-25", "whole_record_certified": false } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "no_site_point", "county_display": "37051" } } ], "compilation_license": "withheld_pending_owner_decision" }