{
  "schema_version": 1,
  "source_compilation_context": {
    "ne": {
      "attribution": {
        "inventory": {
          "name": "Compute Atlas",
          "creator": "Edward Kubiak",
          "url": "https://www.compute-atlas.com/api",
          "license": "CC BY 4.0",
          "license_url": "https://creativecommons.org/licenses/by/4.0/",
          "snapshot_url": "https://www.compute-atlas.com/api/facilities",
          "retrieved": "2026-10-14",
          "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37",
          "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally."
        },
        "counties": "U.S. Census Bureau county boundaries (public domain)",
        "research": "Field-specific source context. See the linked source and limits on each record."
      },
      "source_data_url": "https://datacentersatlas.com/data/ne.json",
      "updated": "2026-10-24"
    }
  },
  "scope": "Source compiled state collection. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.",
  "collection": {
    "kind": "states",
    "key": "ne",
    "label": "Nebraska"
  },
  "records": [
    {
      "id": "1623-farnam-omaha-ne",
      "state": "ne",
      "kind": "facility",
      "name": "1623 Farnam",
      "group": "operating",
      "status": "Operator listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Douglas"
      ],
      "city": "Omaha",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. OMA2futureexpansion not separately operating. This page supplies noadoptedcampusMWorarea. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.1623farnam.com/omaha-edge-data-center/",
          "host": "1623farnam.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 41.29545,
        "lng": -96.1549,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "published_address": "1623 Farnam Street, Suite860, Omaha, NE68102",
            "planned_expansion_name": "OMA2",
            "existing_use_operator_statement": "flagship interconnection carrier hotel"
          },
          "notes": [
            "OMA2futureexpansion not separately operating. This page supplies noadoptedcampusMWorarea.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.1623farnam.com/omaha-edge-data-center/",
              "host": "1623farnam.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "The complete original provider body explicitly describes its current flagship carrier hotel at 1623 Farnam Street, with cabinet, cage and private suite service and interconnection. This supports operator listed colocation service for the inherited flagship scope. The same body describes OMA2 as a future campus expansion, which is not certified as built or serving computing. Carrier counts, security, compliance support and performance claims remain attributed marketing without independent certification. No additional phase, capacity or exact opening is inferred.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "current_provider_named_flagship_interconnection_colocation",
              "scope": "The complete original provider body explicitly describes its current flagship carrier hotel at 1623 Farnam Street, with cabinet, cage and private suite service and interconnection. This supports operator listed colocation service for the inherited flagship scope. The same body describes OMA2 as a future campus expansion, which is not certified as built or serving computing. Carrier counts, security, compliance support and performance claims remain attributed marketing without independent certification. No additional phase, capacity or exact opening is inferred."
            },
            "source_read_scope": {
              "complete_original_current_provider_body_read": true,
              "planned_oma2_not_existing_flagship_capacity": true,
              "no_capacity_compliance_or_performance_certification": true
            }
          },
          "notes": [
            "The complete original provider body explicitly describes its current flagship carrier hotel at 1623 Farnam Street, with cabinet, cage and private suite service and interconnection. This supports operator listed colocation service for the inherited flagship scope. The same body describes OMA2 as a future campus expansion, which is not certified as built or serving computing. Carrier counts, security, compliance support and performance claims remain attributed marketing without independent certification. No additional phase, capacity or exact opening is inferred.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://www.1623farnam.com/omaha-edge-data-center/",
              "host": "www.1623farnam.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Omaha · Douglas · Source context reviewed",
      "status_scope": "The complete original provider body explicitly describes its current flagship carrier hotel at 1623 Farnam Street, with cabinet, cage and private suite service and interconnection. This supports operator listed colocation service for the inherited flagship scope. The same body describes OMA2 as a future campus expansion, which is not certified as built or serving computing. Carrier counts, security, compliance support and performance claims remain attributed marketing without independent certification. No additional phase, capacity or exact opening is inferred.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31055"
      }
    },
    {
      "id": "archgreen-doniphan-hall-ne",
      "state": "ne",
      "kind": "facility",
      "name": "ArchGreen Doniphan Data Center (proposed)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "Hall"
      ],
      "city": "Doniphan",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Doniphan denial must not be replaced by operating status of a different ArchGreen location. Later applications and rulings remain unobserved. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.centralnebraskatoday.com/2026/06/26/data-center-nearing-completion-in-east-grand-island/",
          "host": "centralnebraskatoday.com",
          "date": "2026-06-26",
          "published": "2026-06-26",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 40.87262,
        "lng": -98.50219,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round22-2026-10-14.json",
          "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.",
          "fields": {
            "reported_context": "Reported October 2023 denial of ArchGreen Doniphan permit at 2502 E Giltner Road, separate from northwest Grand Island site.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Doniphan denial must not be replaced by operating status of a different ArchGreen location. Later applications and rulings remain unobserved.",
            "Original executed approvals, current operator disclosures and subsequent decisions take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.centralnebraskatoday.com/2026/06/26/data-center-nearing-completion-in-east-grand-island/",
              "host": "centralnebraskatoday.com",
              "date": "2026-06-26",
              "published": "2026-06-26",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Doniphan · Hall · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31079"
      }
    },
    {
      "id": "archgreen-grand-island-hall-ne",
      "state": "ne",
      "kind": "facility",
      "name": "ArchGreen Grand Island Data Center",
      "group": "building",
      "status": "Company reported construction",
      "raw_status": "under construction",
      "status_field": "current_status",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "Hall"
      ],
      "city": "Grand Island",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Same page says development completed and currently under construction. Actual commissioning and exact build completion remain null. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.arch-green.com/project-1-3",
          "host": "arch-green.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 40.88438,
        "lng": -98.51504,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round22-2026-10-14.json",
          "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.",
          "fields": {
            "reported_context": "ArchGreen operator page names modular crypto development west of Grand Island in Hall County.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Same page says development completed and currently under construction. Actual commissioning and exact build completion remain null.",
            "Original executed approvals, current operator disclosures and subsequent decisions take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.arch-green.com/project-1-3",
              "host": "arch-green.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "The complete original developer project body explicitly says the modular cryptocurrency project west of Grand Island in Hall County is currently under construction. Its separate completed development wording is not treated as physical construction completion or computing operation. The developer reports receipt of a conditional use permit, without an independently read final County instrument in this review. The page has no independently established exact publication or first construction day. No Doniphan project, permit quantity or operating load is substituted.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "developer_explicit_named_grandisland_construction",
              "scope": "The complete original developer project body explicitly says the modular cryptocurrency project west of Grand Island in Hall County is currently under construction. Its separate completed development wording is not treated as physical construction completion or computing operation. The developer reports receipt of a conditional use permit, without an independently read final County instrument in this review. The page has no independently established exact publication or first construction day. No Doniphan project, permit quantity or operating load is substituted."
            },
            "source_read_scope": {
              "complete_original_current_developer_project_body_read": true,
              "completed_development_not_completed_construction": true,
              "undated_page_not_invented_event_day": true,
              "separate_doniphan_project_not_merged": true
            }
          },
          "notes": [
            "The complete original developer project body explicitly says the modular cryptocurrency project west of Grand Island in Hall County is currently under construction. Its separate completed development wording is not treated as physical construction completion or computing operation. The developer reports receipt of a conditional use permit, without an independently read final County instrument in this review. The page has no independently established exact publication or first construction day. No Doniphan project, permit quantity or operating load is substituted.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://www.arch-green.com/project-1-3",
              "host": "www.arch-green.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Grand Island · Hall · Source context reviewed",
      "status_scope": "The complete original developer project body explicitly says the modular cryptocurrency project west of Grand Island in Hall County is currently under construction. Its separate completed development wording is not treated as physical construction completion or computing operation. The developer reports receipt of a conditional use permit, without an independently read final County instrument in this review. The page has no independently established exact publication or first construction day. No Doniphan project, permit quantity or operating load is substituted.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31079"
      }
    },
    {
      "id": "basic-mining-superior-nuckolls-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Basic Mining Superior Hosting Site",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "Nuckolls"
      ],
      "city": "Superior",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Hosting customer fleet/hashrate is not entire building capacity or host ownership. Historical customer power tariff is not current public colocation offer; no investment recommendation adopted. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.share-talk.com/vinanz-limited-bitcoin-mining-fleet-increases-by-50-in-nebraska/",
          "host": "share-talk.com",
          "date": "2024-08-14",
          "published": "2024-08-14",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 40.17637,
        "lng": -98.04735,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round22-2026-10-14.json",
          "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.",
          "fields": {
            "reported_context": "Vinanz issued announcement reproduced by Share Talk describes hosted mining equipment at Basic Mining in Superior, Nebraska.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Hosting customer fleet/hashrate is not entire building capacity or host ownership. Historical customer power tariff is not current public colocation offer; no investment recommendation adopted.",
            "Original executed approvals, current operator disclosures and subsequent decisions take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.share-talk.com/vinanz-limited-bitcoin-mining-fleet-increases-by-50-in-nebraska/",
              "host": "share-talk.com",
              "date": "2024-08-14",
              "published": "2024-08-14",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Superior · Nuckolls · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31129"
      }
    },
    {
      "id": "bginusa-york-ne",
      "state": "ne",
      "kind": "facility",
      "name": "BginUSA York Data Mining Complex",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "York"
      ],
      "city": "York",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Historical transactions do not establish present operator or operation. Kearney numerical metrics are another site. Jigowatt/Stanton is not named in the reviewed article. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://flatwaterfreepress.org/crypto-needs-cheap-energy-it-found-a-whole-bunch-in-nebraska/",
          "host": "flatwaterfreepress.org",
          "date": "2023-01-25",
          "published": "2023-01-25",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://bgin.io/news.html",
          "host": "bgin.io",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed operator source"
        },
        {
          "url": "https://bgin.io/operations.html",
          "host": "bgin.io",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 40.87275,
        "lng": -97.5971,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round22-2026-10-14.json",
          "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.",
          "fields": {
            "reported_context": "Flatwater Free Press names BginUSA York land sale and pending transfer of Minden project to Foundry.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Historical transactions do not establish present operator or operation. Kearney numerical metrics are another site. Jigowatt/Stanton is not named in the reviewed article.",
            "Original executed approvals, current operator disclosures and subsequent decisions take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://flatwaterfreepress.org/crypto-needs-cheap-energy-it-found-a-whole-bunch-in-nebraska/",
              "host": "flatwaterfreepress.org",
              "date": "2023-01-25",
              "published": "2023-01-25",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "The complete original provider York news body describes selection of York and a forecast for construction in 2022. Its current operations page describes unnamed Site 1 and Site 2 without independently naming York. These bodies do not establish which site is the inherited York project or its current physical stage. The annual filing host was unavailable at robots, so its search indexed operations wording was not adopted or obtained through an alternate copy. No current operation, exact publication day, capacity or site identity is inferred.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "historical_named_york_proposal_unnamed_operations_crosswalk_held",
              "scope": "The complete original provider York news body describes selection of York and a forecast for construction in 2022. Its current operations page describes unnamed Site 1 and Site 2 without independently naming York. These bodies do not establish which site is the inherited York project or its current physical stage. The annual filing host was unavailable at robots, so its search indexed operations wording was not adopted or obtained through an alternate copy. No current operation, exact publication day, capacity or site identity is inferred."
            },
            "source_read_scope": {
              "complete_original_provider_york_news_and_operations_bodies_read": true,
              "old2022_construction_forecast_not_accomplished": true,
              "unnamed_sites_not_forced_to_york": true,
              "denied_annual_filing_body_not_adopted": true
            }
          },
          "notes": [
            "The complete original provider York news body describes selection of York and a forecast for construction in 2022. Its current operations page describes unnamed Site 1 and Site 2 without independently naming York. These bodies do not establish which site is the inherited York project or its current physical stage. The annual filing host was unavailable at robots, so its search indexed operations wording was not adopted or obtained through an alternate copy. No current operation, exact publication day, capacity or site identity is inferred.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://bgin.io/news.html",
              "host": "bgin.io",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            },
            {
              "url": "https://bgin.io/operations.html",
              "host": "bgin.io",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "York · York · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31185"
      }
    },
    {
      "id": "binary-net-vault-lincoln-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Binary Net The Vault Data Center",
      "group": "operating",
      "status": "Operator listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Lancaster"
      ],
      "city": "Lincoln",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Vault-specific address/status and exact acquisition date not established by this page. Operator confirms Lincoln data-center services under LincolnDataCenters acquisition; selected document is not a site-specific Vault specification. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.binary.net/lincolndatacenters/",
          "host": "binary.net",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.binary.net/vault/",
          "host": "www.binary.net",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 40.7841,
        "lng": -96.68775,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "field-verification-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "city": "Lincoln",
            "marketed_service": "colocation"
          },
          "notes": [
            "Vault-specific address/status and exact acquisition date not established by this page.",
            "Operator confirms Lincoln data-center services under LincolnDataCenters acquisition; selected document is not a site-specific Vault specification.",
            "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.binary.net/lincolndatacenters/",
              "host": "binary.net",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "The complete original current provider Vault body explicitly describes colocation and integrated hosting from its former Federal Reserve vault in downtown Lincoln. This supports operator listed colocation service at the named Vault scope. The separately named Sharp Annex is not merged with the Vault. Tier, redundancy, security and disaster resilience descriptions are attributed provider claims rather than independently verified current certification or measured performance. The observed same host canonical redirect was followed without bypassing a denial.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "current_provider_named_vault_colocation",
              "scope": "The complete original current provider Vault body explicitly describes colocation and integrated hosting from its former Federal Reserve vault in downtown Lincoln. This supports operator listed colocation service at the named Vault scope. The separately named Sharp Annex is not merged with the Vault. Tier, redundancy, security and disaster resilience descriptions are attributed provider claims rather than independently verified current certification or measured performance. The observed same host canonical redirect was followed without bypassing a denial."
            },
            "source_read_scope": {
              "complete_original_current_vault_body_read": true,
              "observed_same_host_canonical_redirect_only": true,
              "separate_sharp_annex_not_merged": true,
              "no_compliance_or_capacity_certification": true
            }
          },
          "notes": [
            "The complete original current provider Vault body explicitly describes colocation and integrated hosting from its former Federal Reserve vault in downtown Lincoln. This supports operator listed colocation service at the named Vault scope. The separately named Sharp Annex is not merged with the Vault. Tier, redundancy, security and disaster resilience descriptions are attributed provider claims rather than independently verified current certification or measured performance. The observed same host canonical redirect was followed without bypassing a denial.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://www.binary.net/vault/",
              "host": "www.binary.net",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Lincoln · Lancaster · Source context reviewed",
      "status_scope": "The complete original current provider Vault body explicitly describes colocation and integrated hosting from its former Federal Reserve vault in downtown Lincoln. This supports operator listed colocation service at the named Vault scope. The separately named Sharp Annex is not merged with the Vault. Tier, redundancy, security and disaster resilience descriptions are attributed provider claims rather than independently verified current certification or measured performance. The observed same host canonical redirect was followed without bypassing a denial.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31109"
      }
    },
    {
      "id": "clop-omaha-papillion-ne",
      "state": "ne",
      "kind": "facility",
      "name": "CLOP Omaha NE Data Center (5 MW)",
      "group": "proposed",
      "status": "Agency listed proposal",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Sarpy"
      ],
      "city": "Papillion",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. historical state air-construction permit notice. Proposed construction permit notice, not issued permit or operating proof in2026. Seven engines not seven new data centers. No current consumed MW or investment adopted. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://dwee.nebraska.gov/node/5401",
          "host": "dwee.nebraska.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://dwee.nebraska.gov/news-events/public-notices/clop-omaha-ne-llc",
          "host": "dwee.nebraska.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed government record"
        }
      ],
      "loc": {
        "lat": 41.1131,
        "lng": -96.1117,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "government-primary-review-round7-2026-10-14.json",
          "scope": "historical state air-construction permit notice",
          "fields": {
            "proposed_power_mw": 5,
            "power_basis": "data center power, not explicitly IT",
            "published_address": "11684 S158th Street, Papillion, Sarpy County, Nebraska68138",
            "air_facility_id": "122487",
            "proposed_emergency_diesel_generators": 7,
            "historical_comment_start": "2025-10-06",
            "historical_comment_end": "2025-11-07"
          },
          "notes": [
            "Proposed construction permit notice, not issued permit or operating proof in2026. Seven engines not seven new data centers. No current consumed MW or investment adopted.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://dwee.nebraska.gov/node/5401",
              "host": "dwee.nebraska.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "The complete original State public notice identifies a proposed CLOP computing facility in Papillion and a proposed air construction permit. This supports an agency listed proposal at the notice scope. The comment window is October 6 through November 7, 2025. The notice does not independently establish issuance of the final permit, completed construction or computing service. Its generator and emissions estimates are prospective permit descriptions, not installed equipment or measured pollution. A possible hearing upon petition is not a granted hearing or a new future event.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "agency_named_clop_proposed_permit_account",
              "scope": "The complete original State public notice identifies a proposed CLOP computing facility in Papillion and a proposed air construction permit. This supports an agency listed proposal at the notice scope. The comment window is October 6 through November 7, 2025. The notice does not independently establish issuance of the final permit, completed construction or computing service. Its generator and emissions estimates are prospective permit descriptions, not installed equipment or measured pollution. A possible hearing upon petition is not a granted hearing or a new future event."
            },
            "source_read_scope": {
              "complete_original_state_notice_body_read": true,
              "observed_exact_301_canonical_redirect_only": true,
              "proposed_permit_not_issued_permission_or_operation": true,
              "historical_comment_window_not_new_future_hearing": true,
              "no_c4_quantity_or_air_measurement_adopted": true
            }
          },
          "notes": [
            "The complete original State public notice identifies a proposed CLOP computing facility in Papillion and a proposed air construction permit. This supports an agency listed proposal at the notice scope. The comment window is October 6 through November 7, 2025. The notice does not independently establish issuance of the final permit, completed construction or computing service. Its generator and emissions estimates are prospective permit descriptions, not installed equipment or measured pollution. A possible hearing upon petition is not a granted hearing or a new future event.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://dwee.nebraska.gov/news-events/public-notices/clop-omaha-ne-llc",
              "host": "dwee.nebraska.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Papillion · Sarpy · Source context reviewed",
      "status_scope": "The complete original State public notice identifies a proposed CLOP computing facility in Papillion and a proposed air construction permit. This supports an agency listed proposal at the notice scope. The comment window is October 6 through November 7, 2025. The notice does not independently establish issuance of the final permit, completed construction or computing service. Its generator and emissions estimates are prospective permit descriptions, not installed equipment or measured pollution. A possible hearing upon petition is not a granted hearing or a new future event.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31153"
      }
    },
    {
      "id": "crusoe-monolith-hallam-lancaster-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Crusoe Hallam Data Center (Monolith Olive Creek campus)",
      "group": "proposed",
      "status": "Agency listed proposal",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Lancaster"
      ],
      "city": "Hallam",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.. No construction date released. Original approval conditions and power basis not reviewed; public reaction is not unanimous support. Subsequent original decisions and current operator disclosures take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2026-08-19",
          "The original Hallam August 19, 2026 Planning Commission minutes record a unanimous pause to obtain further information and the discussed sound study. This is a procedural action rather than a general enacted Village moratorium or a final computing permit decision."
        ],
        [
          "2026-09-16",
          "The original Hallam September 16, 2026 Planning Commission minutes record four members supporting a recommendation on the revised computing application to the Board. A recommendation is separate from a completed final Board permit vote or computing construction."
        ],
        [
          "2026-09-14",
          "The original Hallam September 14, 2026 Board minutes record all five trustees voting to table a resident proposal for a single facility limit until further planning information and the October Board meeting. This is postponement rather than enactment of a Village computing ban or numerical limit."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.wowt.com/2026/10/06/hallam-village-board-approves-zoning-rights-data-center/",
          "host": "wowt.com",
          "date": "2026-10-05",
          "published": "2026-10-05",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://villageofhallamnebraska.com/wp-content/uploads/2026/10/8-19-26-Planning-Commision-minutes.pdf",
          "host": "villageofhallamnebraska.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed government record"
        },
        {
          "url": "https://villageofhallamnebraska.com/wp-content/uploads/2026/10/9-16-2026-Planning-Commision-minutes.pdf",
          "host": "villageofhallamnebraska.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed government record"
        },
        {
          "url": "https://villageofhallamnebraska.com/wp-content/uploads/2026/10/9-14-26-minutes.pdf",
          "host": "villageofhallamnebraska.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed government record"
        },
        {
          "url": "https://villageofhallamnebraska.com/wp-content/uploads/2026/10/October-Agenda-2026-R.pdf",
          "host": "villageofhallamnebraska.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed government record"
        }
      ],
      "loc": {
        "lat": 40.7993,
        "lng": -96.70435,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round24-2026-10-14.json",
          "scope": "Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.",
          "fields": {
            "reported_context": "KOLN report carried by WOWT says Hallam board approved zoning rights Monday following July special-permit step with Monolith.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "No construction date released. Original approval conditions and power basis not reviewed; public reaction is not unanimous support.",
            "Subsequent original decisions and current operator disclosures take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.wowt.com/2026/10/06/hallam-village-board-approves-zoning-rights-data-center/",
              "host": "wowt.com",
              "date": "2026-10-05",
              "published": "2026-10-05",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "Selected original Village minutes and the complete October 5 agenda explicitly identify the proposed Monolith and Crusoe computing project at the existing Olive Creek property. This supports an agency listed proposal. August 19 minutes record a pause for further information; September 16 minutes record a four member recommendation to the Board; September 14 Board minutes table a separate resident proposal to limit facilities. These are distinct actions. The October 5 agenda is planned consideration, without an independently read completed October decision. Neither recommendation nor an agenda establishes current construction or service. Private resident names and addresses are omitted from research prose, and projected noise, water and financial benefits remain attributed claims.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "village_named_olive_creek_proposal_recommendation_not_final_vote",
              "scope": "Selected original Village minutes and the complete October 5 agenda explicitly identify the proposed Monolith and Crusoe computing project at the existing Olive Creek property. This supports an agency listed proposal. August 19 minutes record a pause for further information; September 16 minutes record a four member recommendation to the Board; September 14 Board minutes table a separate resident proposal to limit facilities. These are distinct actions. The October 5 agenda is planned consideration, without an independently read completed October decision. Neither recommendation nor an agenda establishes current construction or service. Private resident names and addresses are omitted from research prose, and projected noise, water and financial benefits remain attributed claims."
            },
            "source_read_scope": {
              "original_august_minutes_selected_physical_pages1_3_4_5_6_14_16_21_read": true,
              "original_september_planning_minutes_selected_physical_pages1_4_5_read": true,
              "original_september_board_selected_resolution_and_vote_passages_read": true,
              "complete_original_october_agenda_text_read": true,
              "no_unread_october_vote_or_current_operation_adopted": true,
              "private_resident_names_and_addresses_omitted": true
            }
          },
          "notes": [
            "Selected original Village minutes and the complete October 5 agenda explicitly identify the proposed Monolith and Crusoe computing project at the existing Olive Creek property. This supports an agency listed proposal. August 19 minutes record a pause for further information; September 16 minutes record a four member recommendation to the Board; September 14 Board minutes table a separate resident proposal to limit facilities. These are distinct actions. The October 5 agenda is planned consideration, without an independently read completed October decision. Neither recommendation nor an agenda establishes current construction or service. Private resident names and addresses are omitted from research prose, and projected noise, water and financial benefits remain attributed claims.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://villageofhallamnebraska.com/wp-content/uploads/2026/10/8-19-26-Planning-Commision-minutes.pdf",
              "host": "villageofhallamnebraska.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed government record"
            },
            {
              "url": "https://villageofhallamnebraska.com/wp-content/uploads/2026/10/9-16-2026-Planning-Commision-minutes.pdf",
              "host": "villageofhallamnebraska.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed government record"
            },
            {
              "url": "https://villageofhallamnebraska.com/wp-content/uploads/2026/10/9-14-26-minutes.pdf",
              "host": "villageofhallamnebraska.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed government record"
            },
            {
              "url": "https://villageofhallamnebraska.com/wp-content/uploads/2026/10/October-Agenda-2026-R.pdf",
              "host": "villageofhallamnebraska.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Hallam · Lancaster · Source context reviewed",
      "status_scope": "Selected original Village minutes and the complete October 5 agenda explicitly identify the proposed Monolith and Crusoe computing project at the existing Olive Creek property. This supports an agency listed proposal. August 19 minutes record a pause for further information; September 16 minutes record a four member recommendation to the Board; September 14 Board minutes table a separate resident proposal to limit facilities. These are distinct actions. The October 5 agenda is planned consideration, without an independently read completed October decision. Neither recommendation nor an agenda establishes current construction or service. Private resident names and addresses are omitted from research prose, and projected noise, water and financial benefits remain attributed claims.",
      "event_evidence": [
        {
          "date": "2026-08-19",
          "text": "The original Hallam August 19, 2026 Planning Commission minutes record a unanimous pause to obtain further information and the discussed sound study. This is a procedural action rather than a general enacted Village moratorium or a final computing permit decision.",
          "kind": "announced",
          "sources": [
            {
              "url": "https://villageofhallamnebraska.com/wp-content/uploads/2026/10/8-19-26-Planning-Commision-minutes.pdf",
              "host": "villageofhallamnebraska.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed government record"
            }
          ]
        },
        {
          "date": "2026-09-16",
          "text": "The original Hallam September 16, 2026 Planning Commission minutes record four members supporting a recommendation on the revised computing application to the Board. A recommendation is separate from a completed final Board permit vote or computing construction.",
          "kind": "announced",
          "sources": [
            {
              "url": "https://villageofhallamnebraska.com/wp-content/uploads/2026/10/9-16-2026-Planning-Commision-minutes.pdf",
              "host": "villageofhallamnebraska.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed government record"
            }
          ]
        },
        {
          "date": "2026-09-14",
          "text": "The original Hallam September 14, 2026 Board minutes record all five trustees voting to table a resident proposal for a single facility limit until further planning information and the October Board meeting. This is postponement rather than enactment of a Village computing ban or numerical limit.",
          "kind": "announced",
          "sources": [
            {
              "url": "https://villageofhallamnebraska.com/wp-content/uploads/2026/10/9-14-26-minutes.pdf",
              "host": "villageofhallamnebraska.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed government record"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31109"
      }
    },
    {
      "id": "fortitude-aurora-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Fortitude Aurora Nebraska Facility",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "Hamilton"
      ],
      "city": "Aurora",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.. The article does not name Fortitude, so operator identity needs a crosswalk. Initial capacity lies inside a 15 MW target. The 2024 opening and future franchise-fee scenario do not establish current operation or paid tax benefits. Current original approvals, disclosures and later outcomes take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.auroranewsregister.com/news/data-center-be-built-mission-critical",
          "host": "auroranewsregister.com",
          "date": "2023-12-13",
          "published": "2023-12-13",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 40.87318,
        "lng": -98.02281,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round26-2026-10-14.json",
          "scope": "Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.",
          "fields": {
            "reported_context": "Aurora News-Register reports AAIM's land purchase and initial five-MW plan at the Mission Critical subdivision.",
            "independently_verified_current_operating_status": null,
            "operator_or_site_identity_needs_crosswalk": true
          },
          "notes": [
            "The article does not name Fortitude, so operator identity needs a crosswalk. Initial capacity lies inside a 15 MW target. The 2024 opening and future franchise-fee scenario do not establish current operation or paid tax benefits.",
            "Current original approvals, disclosures and later outcomes take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.auroranewsregister.com/news/data-center-be-built-mission-critical",
              "host": "auroranewsregister.com",
              "date": "2023-12-13",
              "published": "2023-12-13",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Aurora · Hamilton · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31081"
      }
    },
    {
      "id": "fortitude-grand-island-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Fortitude Grand Island Nebraska Facility",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "Hall"
      ],
      "city": "Grand Island",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. No observed opening or final current status inferred; original lease, rates and acoustic reports not retained. Company/utility water and noise claims are attributed. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2026-07-28",
          "The original Fortitude investor index dates its Grand Island energization announcement July 28, 2026. This is the index statement date; the linked full release was not read, and actual computing commissioning or the exact first energization day is not independently certified."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.centralnebraskatoday.com/2026/06/26/data-center-nearing-completion-in-east-grand-island/",
          "host": "centralnebraskatoday.com",
          "date": "2026-06-26",
          "published": "2026-06-26",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://fortitudemining.com/investors/",
          "host": "fortitudemining.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 40.84808,
        "lng": -98.50004,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round22-2026-10-14.json",
          "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.",
          "fields": {
            "reported_context": "Reported Fortitude nearing completion at 380 Museum Drive; July/August opening forecast.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "No observed opening or final current status inferred; original lease, rates and acoustic reports not retained. Company/utility water and noise claims are attributed.",
            "Original executed approvals, current operator disclosures and subsequent decisions take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.centralnebraskatoday.com/2026/06/26/data-center-nearing-completion-in-east-grand-island/",
              "host": "centralnebraskatoday.com",
              "date": "2026-06-26",
              "published": "2026-06-26",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "The complete original issuer investor index carries a July 28, 2026 energization announcement title for Grand Island. The linked full release host was unavailable at robots, so its body was not read through an alternate copy. Energization and a title do not independently establish commissioned mining, installed computing load or exact present operation. The index publication date is retained as a statement date without recasting it as the exact first physical energization or opening.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "issuer_index_energization_headline_computing_operation_held",
              "scope": "The complete original issuer investor index carries a July 28, 2026 energization announcement title for Grand Island. The linked full release host was unavailable at robots, so its body was not read through an alternate copy. Energization and a title do not independently establish commissioned mining, installed computing load or exact present operation. The index publication date is retained as a statement date without recasting it as the exact first physical energization or opening."
            },
            "source_read_scope": {
              "complete_original_issuer_investor_index_read": true,
              "linked_release_robots_unavailable_body_not_adopted": true,
              "energization_headline_not_computing_operation": true
            }
          },
          "notes": [
            "The complete original issuer investor index carries a July 28, 2026 energization announcement title for Grand Island. The linked full release host was unavailable at robots, so its body was not read through an alternate copy. Energization and a title do not independently establish commissioned mining, installed computing load or exact present operation. The index publication date is retained as a statement date without recasting it as the exact first physical energization or opening.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://fortitudemining.com/investors/",
              "host": "fortitudemining.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Grand Island · Hall · Source context reviewed",
      "event_evidence": [
        {
          "date": "2026-07-28",
          "text": "The original Fortitude investor index dates its Grand Island energization announcement July 28, 2026. This is the index statement date; the linked full release was not read, and actual computing commissioning or the exact first energization day is not independently certified.",
          "kind": "announced",
          "sources": [
            {
              "url": "https://fortitudemining.com/investors/",
              "host": "fortitudemining.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31079"
      }
    },
    {
      "id": "fortitude-prosser-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Fortitude Prosser Nebraska Facility",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "Adams"
      ],
      "city": "Prosser",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.. WillVraspir HastingsTribune January4,2024 (updatedFeb27,2025) originalmeetingreport names A-NE/AAIM2.64acreProsser proposal near82nd/Overland/Hayland.6-1planningRECOMMENDATION withsiteplan/setbackconditions; countyboardJanuary16stillfuture. Notfinalpermit/2026Fortitudeownershipproofalone. 12.5MW SUBSTATION planned, notcertifiedIT. Noise measurements fromMexicoMISSOURI OTHERfacilitynotProsserreadings; reported55dB/hour/propertyrules not currentcompliancetest. Upfrontconnectioncostscreditedlater notblanketutilitygift. FortitudeissueracquisitionbelowprovideslaternamedProssercontext, no unverifieddeedlinkclaim. Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified. FortitudeoriginalissuerBWmainbodyreadwithweb; ordinarylocalcapturetimeout, nohash/HTTPstatusinvented. AnnouncementURLAugust4,2026 versusissuerindexAugust8 listingdiscrepancyheld; preciseclosingdayunknown. IssuersaysProsser12.5MWrealpropertyassetacquisitionCOMPLETEDandgeneratingrevenueatclose, notnewgreenfieldconstruction. 6.25Mpurchaseprice versusapproximately4.7MNEWCASH aftercredits/deposits, not10.95Mtotalcapex.985khostingcredit/465500minerscreditcomponentsnotextraacquisitions.67kVsubstationnot67MW.12.5MWcontractedpowernotexplicitIT;60MWseven-siteportfolioINCLUDESsite.4.5c/kWhESTIMATEnot2026executedall-intariff. Mergerstillproposed, notcompletedHeartSciencesownership.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.hastingstribune.com/news/adams-county-planning-and-zoning-commission-recommends-conditional-use-permit-for-countys-first-data-center/article_b39985d2-ab6e-11ee-9c27-832166c0311a.html",
          "host": "hastingstribune.com",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.businesswire.com/news/home/20260804871523/en/Fortitude-Completes-Acquisition-of-12.5-MW-Prosser-Nebraska-Facility",
          "host": "businesswire.com",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://fortitudemining.com/investors/",
          "host": "fortitudemining.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 40.52449,
        "lng": -98.50118,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "national-acquisitions-regulatory-stage-and-site-crosswalks-round81-2026-10-15.json",
          "scope": "Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.",
          "fields": {},
          "notes": [
            "WillVraspir HastingsTribune January4,2024 (updatedFeb27,2025) originalmeetingreport names A-NE/AAIM2.64acreProsser proposal near82nd/Overland/Hayland.6-1planningRECOMMENDATION withsiteplan/setbackconditions; countyboardJanuary16stillfuture. Notfinalpermit/2026Fortitudeownershipproofalone.",
            "12.5MW SUBSTATION planned, notcertifiedIT. Noise measurements fromMexicoMISSOURI OTHERfacilitynotProsserreadings; reported55dB/hour/propertyrules not currentcompliancetest. Upfrontconnectioncostscreditedlater notblanketutilitygift. FortitudeissueracquisitionbelowprovideslaternamedProssercontext, no unverifieddeedlinkclaim.",
            "Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified."
          ],
          "sources": [
            {
              "url": "https://www.hastingstribune.com/news/adams-county-planning-and-zoning-commission-recommends-conditional-use-permit-for-countys-first-data-center/article_b39985d2-ab6e-11ee-9c27-832166c0311a.html",
              "host": "hastingstribune.com",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "national-acquisitions-regulatory-stage-and-site-crosswalks-round81-2026-10-15.json",
          "scope": "Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.",
          "fields": {},
          "notes": [
            "FortitudeoriginalissuerBWmainbodyreadwithweb; ordinarylocalcapturetimeout, nohash/HTTPstatusinvented. AnnouncementURLAugust4,2026 versusissuerindexAugust8 listingdiscrepancyheld; preciseclosingdayunknown. IssuersaysProsser12.5MWrealpropertyassetacquisitionCOMPLETEDandgeneratingrevenueatclose, notnewgreenfieldconstruction.",
            "6.25Mpurchaseprice versusapproximately4.7MNEWCASH aftercredits/deposits, not10.95Mtotalcapex.985khostingcredit/465500minerscreditcomponentsnotextraacquisitions.67kVsubstationnot67MW.12.5MWcontractedpowernotexplicitIT;60MWseven-siteportfolioINCLUDESsite.4.5c/kWhESTIMATEnot2026executedall-intariff. Mergerstillproposed, notcompletedHeartSciencesownership.",
            "Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified."
          ],
          "sources": [
            {
              "url": "https://www.businesswire.com/news/home/20260804871523/en/Fortitude-Completes-Acquisition-of-12.5-MW-Prosser-Nebraska-Facility",
              "host": "businesswire.com",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "The original issuer investor index carries a Prosser acquisition announcement with an August 8, 2026 display date while its linked distributor URL contains an August 4 date segment. The linked full release host was unavailable at robots. No acquisition or publication day is silently harmonized, and a title or acquisition does not independently establish exact present computing operation. The denied full body, alleged County permission and technical capacity are not adopted.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "issuer_index_acquisition_title_date_conflict_current_stage_held",
              "scope": "The original issuer investor index carries a Prosser acquisition announcement with an August 8, 2026 display date while its linked distributor URL contains an August 4 date segment. The linked full release host was unavailable at robots. No acquisition or publication day is silently harmonized, and a title or acquisition does not independently establish exact present computing operation. The denied full body, alleged County permission and technical capacity are not adopted."
            },
            "source_read_scope": {
              "complete_original_issuer_index_read": true,
              "index_display_day_and_link_path_date_not_harmonized": true,
              "linked_denied_release_not_adopted": true,
              "no_exact_acquisition_event_or_current_operation_inferred": true
            }
          },
          "notes": [
            "The original issuer investor index carries a Prosser acquisition announcement with an August 8, 2026 display date while its linked distributor URL contains an August 4 date segment. The linked full release host was unavailable at robots. No acquisition or publication day is silently harmonized, and a title or acquisition does not independently establish exact present computing operation. The denied full body, alleged County permission and technical capacity are not adopted.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://fortitudemining.com/investors/",
              "host": "fortitudemining.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": false,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Prosser · Adams · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31001"
      }
    },
    {
      "id": "foundry-minden-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Foundry Digital Minden Site (former Compute North expansion)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "Kearney"
      ],
      "city": "Minden",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Historical transactions do not establish present operator or operation. Kearney numerical metrics are another site. Jigowatt/Stanton is not named in the reviewed article. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://flatwaterfreepress.org/crypto-needs-cheap-energy-it-found-a-whole-bunch-in-nebraska/",
          "host": "flatwaterfreepress.org",
          "date": "2023-01-25",
          "published": "2023-01-25",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 40.50671,
        "lng": -98.94792,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round22-2026-10-14.json",
          "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.",
          "fields": {
            "reported_context": "Flatwater Free Press names BginUSA York land sale and pending transfer of Minden project to Foundry.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Historical transactions do not establish present operator or operation. Kearney numerical metrics are another site. Jigowatt/Stanton is not named in the reviewed article.",
            "Original executed approvals, current operator disclosures and subsequent decisions take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://flatwaterfreepress.org/crypto-needs-cheap-energy-it-found-a-whole-bunch-in-nebraska/",
              "host": "flatwaterfreepress.org",
              "date": "2023-01-25",
              "published": "2023-01-25",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Minden · Kearney · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31099"
      }
    },
    {
      "id": "google-lincoln-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Google Lincoln Data Center",
      "group": "operating",
      "status": "Operating phase",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Lancaster"
      ],
      "city": "Lincoln",
      "address": "",
      "who": "Google",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Nebraska namedsite milestones and regionaltotal. CurrentprimarymilestoneexplicitlyLincolncomesonline2026, month/dayunknown.15Bregionalnotpercampus.1.2B2023jointgrowthnotadditive. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Original annual report visibly read; self-reported period, redactions and number definitions control.. The 2026 annual report contains 2025 resource/tax labels; do not relabel usage as 2026. Area is the reported total campus footprint in a gross-floor-area column, not verified white space or individual-building area. Efficiency, demand response and clean-energy discussion includes Google-wide/global figures; do not assign them to this campus. Design-life language is not an opening date or a scheduled closure. Nebraska Advantage sales/use exemptions utilized or expected are described; no ImagiNE payments received or expected is the report statement, not all tax benefits zero. Resource and tax values visibly redacted in the current public report. No underlying hidden text extracted. Not all-field or current operating-building certification.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://datacenters.google/locations/nebraska/",
          "host": "datacenters.google",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/AfCJDhMKiqvTaxJZjfRNNDI6NZNHB9INCqfl2wzh85kTJ5AE62%C3%81MxmFV9%C3%89EHOJJySbhd12bX5kAuxOTW2i6MdPg%3D/",
          "host": "ecmp.nebraska.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.datacenters.google/locations/nebraska/",
          "host": "www.datacenters.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Google reviewed primary source"
        },
        {
          "url": "https://www.datacenters.google/locations/",
          "host": "www.datacenters.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Google official location source"
        }
      ],
      "loc": {
        "lat": 40.7524,
        "lng": -96.68497,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "Nebraska namedsite milestones and regionaltotal",
          "fields": {
            "operator_reported_papillion_built_year": 2019,
            "operator_reported_omaha_built_year": 2022,
            "lincoln_development_announcement_year": 2023,
            "operator_reported_lincoln_online_year": 2026,
            "regional_investment_usd_min_exclusive": 15000000000,
            "investment_scope": "Nebraska statewide"
          },
          "notes": [
            "CurrentprimarymilestoneexplicitlyLincolncomesonline2026, month/dayunknown.15Bregionalnotpercampus.1.2B2023jointgrowthnotadditive.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://datacenters.google/locations/nebraska/",
              "host": "datacenters.google",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "nebraska-annual-reports-visible-review-round51-2026-10-15.json",
          "scope": "Original annual report visibly read; self-reported period, redactions and number definitions control.",
          "fields": {},
          "notes": [
            "The 2026 annual report contains 2025 resource/tax labels; do not relabel usage as 2026.",
            "Area is the reported total campus footprint in a gross-floor-area column, not verified white space or individual-building area.",
            "Efficiency, demand response and clean-energy discussion includes Google-wide/global figures; do not assign them to this campus.",
            "Design-life language is not an opening date or a scheduled closure.",
            "Nebraska Advantage sales/use exemptions utilized or expected are described; no ImagiNE payments received or expected is the report statement, not all tax benefits zero.",
            "Resource and tax values visibly redacted in the current public report. No underlying hidden text extracted.",
            "Not all-field or current operating-building certification."
          ],
          "sources": [
            {
              "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/AfCJDhMKiqvTaxJZjfRNNDI6NZNHB9INCqfl2wzh85kTJ5AE62%C3%81MxmFV9%C3%89EHOJJySbhd12bX5kAuxOTW2i6MdPg%3D/",
              "host": "ecmp.nebraska.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "S4-Google-Pending-20261016",
          "scope": "Scoped Google regional identity and lifecycle review; existing approximate points, jurisdiction, legacy totals and opening fields are retained.",
          "fields": {
            "record_association_scope": "Explicit association of the existing named Google Lincoln, Nebraska research context with the primary named location. This does not resolve a parcel, building allocation or distinct physical-site census; inherited project-code aliases are retained rather than independently certified.",
            "operator_online_year": {
              "year": "2026",
              "precision": "year",
              "exact_date": null,
              "scope": "Operator location-page milestone; no January 1 date inferred."
            },
            "current_status_basis": "Google’s current Nebraska location page records Lincoln coming online in 2026 and names the operating data center community. This supports an operating phase, not every campus expansion or a specific opening day. Year-only source precision is retained; legacy opened and point fields remain unchanged."
          },
          "notes": [
            "Partial record/field review only. No point movement, exact opening day, commissioned IT capacity, or whole-state freshness certification."
          ],
          "sources": [
            {
              "url": "https://www.datacenters.google/locations/nebraska/",
              "host": "www.datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Google reviewed primary source"
            },
            {
              "url": "https://www.datacenters.google/locations/",
              "host": "www.datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Google official location source"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check57, October24,2026",
          "scope": "Google identifies the named Lincoln data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Nebraska page names Lincoln, Omaha and Papillion separately. Its2026Lincoln comes online milestone has no exact day; the statewide15billion investment is not a Lincoln project cost.",
          "fields": {
            "company_association": {
              "name": "Google",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Google identifies the named Lincoln data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Nebraska page names Lincoln, Omaha and Papillion separately. Its2026Lincoln comes online milestone has no exact day; the statewide15billion investment is not a Lincoln project cost."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Google identifies the named Lincoln data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Nebraska page names Lincoln, Omaha and Papillion separately. Its2026Lincoln comes online milestone has no exact day; the statewide15billion investment is not a Lincoln project cost."
          ],
          "sources": [
            {
              "url": "https://datacenters.google/locations/nebraska/",
              "host": "datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Lincoln · Lancaster · Source context reviewed",
      "status_scope": "Google’s current Nebraska location page records Lincoln coming online in 2026 and names the operating data center community. This supports an operating phase, not every campus expansion or a specific opening day. Year-only source precision is retained; legacy opened and point fields remain unchanged.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31109"
      }
    },
    {
      "id": "google-nebraska-ai-campus-proposed",
      "state": "ne",
      "kind": "facility",
      "name": "Google Nebraska AI Campus (proposed)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Otoe"
      ],
      "city": "",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.. Land options are not completed purchases or operator commitments. Proposed gas generation is not critical IT. Carbon capture is prospective, and the historical bill stage does not establish current law. No exact site or current opening is confirmed. Current original approvals, disclosures and later outcomes take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://grist.org/accountability/google-data-center-carbon-capture-nebraska/",
          "host": "grist.org",
          "date": "2026-03-24",
          "published": "2026-03-24",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 40.64857,
        "lng": -96.135,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round26-2026-10-14.json",
          "scope": "Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.",
          "fields": {
            "reported_context": "Grist and Flatwater report Tenaska land options and documents suggesting a Nebraska Google gas-and-computing project, while Tallgrass denies partnership.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Land options are not completed purchases or operator commitments. Proposed gas generation is not critical IT. Carbon capture is prospective, and the historical bill stage does not establish current law. No exact site or current opening is confirmed.",
            "Current original approvals, disclosures and later outcomes take precedence.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://grist.org/accountability/google-data-center-carbon-capture-nebraska/",
              "host": "grist.org",
              "date": "2026-03-24",
              "published": "2026-03-24",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Otoe · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31131"
      }
    },
    {
      "id": "google-omaha-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Google Omaha Data Center",
      "group": "operating",
      "status": "Operating phase",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Douglas"
      ],
      "city": "Omaha",
      "address": "",
      "who": "Google",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "Calendar-year 2025 operator-reported location totals. Withdrawal, discharge and consumption are separate quantities; methodology permits estimates and does not establish today’s use.",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Omaha named environmental permit revision. Draft air-permit revision notice, not final approval/installation or consumed fuel. Other hub/booster/CLCengines listed separately; do not sumengine countsinto buildingsor ITMW. Source does not independently establish Google subsidiary alias; retain applicant as published. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Original annual report visibly read; self-reported period, redactions and number definitions control.. The 2026 annual report contains 2025 resource/tax labels; do not relabel usage as 2026. Area is the reported total campus footprint in a gross-floor-area column, not verified white space or individual-building area. Efficiency, demand response and clean-energy discussion includes Google-wide/global figures; do not assign them to this campus. Design-life language is not an opening date or a scheduled closure. Nebraska Advantage sales/use exemptions utilized or expected are described; no ImagiNE payments received or expected is the report statement, not all tax benefits zero. Resource and tax values visibly redacted in the current public report. No underlying hidden text extracted. Not all-field or current operating-building certification. Google 2026 quarterly performance table; named regional campus scope. Operator-reported period metrics, not an October operating inspection, current MW load or building-specific measurement. Regional values are not assigned to a separate expansion or street-address record. Blank TTM remains unknown. No status, location precision or whole-campus completion upgrade; publication date unknown.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://dwee.nebraska.gov/news-events/public-notices/westwood-solutions-llc-0",
          "host": "dwee.nebraska.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/ARuMkgE1TvD7Umlj6wRARHuYJ40%C3%81%C3%890lDqLE4lryd4tuqzMUw7BJFzTpAydzwcQK6MmQc9GLu9GQlAFjgVozyT4g%3D/",
          "host": "ecmp.nebraska.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://datacenters.google/efficiency/",
          "host": "datacenters.google",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://datacenters.google/locations/nebraska/",
          "host": "datacenters.google",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.datacenters.google/locations/nebraska/",
          "host": "www.datacenters.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Google official location source"
        },
        {
          "url": "https://www.datacenters.google/locations/",
          "host": "www.datacenters.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Google official location source"
        },
        {
          "url": "https://sustainability.google/files/google-2026-environmental-report.pdf",
          "host": "sustainability.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Google 2026 Environmental Report"
        },
        {
          "url": "https://dcgis.org/server/rest/services/vector/Parcels_public/MapServer/0/query?where=UPPER%28PROPERTY_A%29+LIKE+%27%258425%25114%25%27&outFields=PIN%2CADDRESS1%2CADDRESS2%2CPROPERTY_A%2CSTREET_DIR%2CSTREET_NAM%2CSTREET_TYP%2CPROP_CITY%2CPROP_ZIP&returnGeometry=true&outSR=4326&resultRecordCount=30&f=json",
          "host": "dcgis.org",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "One exact public tax reference parcel feature and situs"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-96.09241763230894%2C41.336825910887534%2C-96.08404236769105%2C41.34311408911247&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Actually viewed setting only, acquisition date unknown"
        },
        {
          "url": "https://dcgis.org/server/rest/services/vector/Parcels_public/MapServer/0?f=pjson",
          "host": "dcgis.org",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Official dataset attribution and reference mapping method"
        }
      ],
      "loc": {
        "lng": -96.08823,
        "lat": 41.33997,
        "precision": "approximate",
        "basis": "Approximate reference parcel center for Google service address 8425 N. 114th Street, Omaha, NE 68142. Official tax map reference 2245320128 only, not a roof, surveyed title, tenant floor or full campus. Aerial acquisition date is unknown and may predate construction."
      },
      "reviewed_evidence": [
        {
          "overlay": "government-primary-review-round7-2026-10-14.json",
          "scope": "Omaha named environmental permit revision",
          "fields": {
            "air_permit_applicant": "Westwood Solutions LLC",
            "air_facility_id": "117197",
            "published_address": "8425 North114thStreet,Omaha,DouglasCounty,Nebraska68142",
            "permit_revision_comment_start": "2026-07-23",
            "permit_revision_comment_end": "2026-08-24",
            "proposed_additional_type1_emergency_engines": 72,
            "proposed_additional_type2_emergency_engines": 4,
            "proposed_additional_cooling_towers": 24,
            "proposed_annual_emergency_diesel_fuel_limit_gallons": 1190000
          },
          "notes": [
            "Draft air-permit revision notice, not final approval/installation or consumed fuel. Other hub/booster/CLCengines listed separately; do not sumengine countsinto buildingsor ITMW. Source does not independently establish Google subsidiary alias; retain applicant as published.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://dwee.nebraska.gov/news-events/public-notices/westwood-solutions-llc-0",
              "host": "dwee.nebraska.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "nebraska-annual-reports-visible-review-round51-2026-10-15.json",
          "scope": "Original annual report visibly read; self-reported period, redactions and number definitions control.",
          "fields": {},
          "notes": [
            "The 2026 annual report contains 2025 resource/tax labels; do not relabel usage as 2026.",
            "Area is the reported total campus footprint in a gross-floor-area column, not verified white space or individual-building area.",
            "Efficiency, demand response and clean-energy discussion includes Google-wide/global figures; do not assign them to this campus.",
            "Design-life language is not an opening date or a scheduled closure.",
            "Nebraska Advantage sales/use exemptions utilized or expected are described; no ImagiNE payments received or expected is the report statement, not all tax benefits zero.",
            "Resource and tax values visibly redacted in the current public report. No underlying hidden text extracted.",
            "Not all-field or current operating-building certification."
          ],
          "sources": [
            {
              "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/ARuMkgE1TvD7Umlj6wRARHuYJ40%C3%81%C3%890lDqLE4lryd4tuqzMUw7BJFzTpAydzwcQK6MmQc9GLu9GQlAFjgVozyT4g%3D/",
              "host": "ecmp.nebraska.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Atlas targeted primary-source follow-up",
          "scope": "Google 2026 quarterly performance table; named regional campus scope",
          "fields": {
            "operator_reported_pue_period": "2026-Q2",
            "operator_reported_campus_pue": [
              {
                "source_campus_label": "Omaha, Nebraska",
                "quarterly_pue": 1.06,
                "trailing_twelve_month_pue": 1.05
              }
            ]
          },
          "notes": [
            "Operator-reported period metrics, not an October operating inspection, current MW load or building-specific measurement. Regional values are not assigned to a separate expansion or street-address record. Blank TTM remains unknown. No status, location precision or whole-campus completion upgrade; publication date unknown."
          ],
          "sources": [
            {
              "url": "https://datacenters.google/efficiency/",
              "host": "datacenters.google",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            },
            {
              "url": "https://datacenters.google/locations/nebraska/",
              "host": "datacenters.google",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "checked": "2026-10-15",
          "capture_sha256": "398f42d55ca9e2ebecd3b24e2dede307ad2d9d3b653469d1efebd135488f9c17",
          "events": [],
          "whole_record_certified": false
        },
        {
          "overlay": "S4-Google-Locations-20261016",
          "scope": "Named Google location research context; regional campus and individual building identity remain separate.",
          "fields": {
            "operator_location_scope": "Omaha, Nebraska is named in Google’s current directory and linked location page. Regional entries can include several facilities; directory development flags alone do not establish an operating stage.",
            "record_association_scope": "The named operator location is associated with this existing research context by provider and named city/county. This is an explicit research association, not proof of a distinct physical site or an exact parcel.",
            "annual_water_reporting": {
              "source_location": "Omaha, NE",
              "report_year": 2026,
              "reporting_year": 2025,
              "source_page": 97,
              "unit": "Million gallons",
              "withdrawal": 241.8,
              "discharge": 57.9,
              "consumption": 183.9
            },
            "water_method_scope": "Annual calendar-year 2025 figures for the reported location, not instantaneous use, a daily rate, an approved limit or one building. Google uses metered or invoiced values when available and can estimate missing data; the table does not identify each row’s metering completeness. Consumption is calculated as withdrawal minus discharge; values are rounded. Seawater and brackish water over 1,000 mg/L total dissolved solids are excluded. Unless otherwise specified, withdrawals are potable; Douglas County includes reclaimed wastewater. No litres or daily averages are calculated.",
            "water_location_association": "Omaha, NE is associated with this regional campus research context only; no allocation to separate expansion/street-address records or individual buildings.",
            "current_status_basis": "An operating component is supported at Google’s named Omaha, Nebraska location by its current operator listing and 2025 operational reporting. This is regional campus scope, not verification that every expansion/building is complete, fully commissioned or operating at a stated MW. Annual reporting is historical, not an October operating inspection."
          },
          "notes": [
            "A partial operator/field review does not certify every fact or a whole state. No precise address, map point, current IT load or per-campus investment is inferred."
          ],
          "sources": [
            {
              "url": "https://www.datacenters.google/locations/nebraska/",
              "host": "www.datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Google official location source"
            },
            {
              "url": "https://www.datacenters.google/locations/",
              "host": "www.datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Google official location source"
            },
            {
              "url": "https://sustainability.google/files/google-2026-environmental-report.pdf",
              "host": "sustainability.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Google 2026 Environmental Report"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 24, October 23, 2026",
          "scope": "Approximate remains approximate. One source bound tax reference parcel only. Existing native status and every protected fact remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -96.08823,
                "lat": 41.33997,
                "precision": "approximate",
                "basis": "Approximate reference parcel center for Google service address 8425 N. 114th Street, Omaha, NE 68142. Official tax map reference 2245320128 only, not a roof, surveyed title, tenant floor or full campus. Aerial acquisition date is unknown and may predate construction."
              },
              "reference_method": "Approximate county reference parcel center",
              "reference_parcel": {
                "identifier": "2245320128",
                "identifier_field": "PIN",
                "objectid": null,
                "agency": "Douglas County Assessor and Register of Deeds Office, Nebraska",
                "agency_situs_field": "PROPERTY_A",
                "agency_situs": "8425 N 114 ST",
                "reference_method": "calculated_polygon_centroid",
                "not_survey_quality": true,
                "legal_title_verified": false,
                "independent_building_identity": false,
                "full_campus_verified": false,
                "operator_ownership_verified": false
              },
              "operator_coordinates_adopted": false,
              "census_range_adopted": false
            }
          },
          "notes": [
            "The service situs is joined to one exact official reference parcel identifier. This establishes one approximate tax map reference only. It does not certify a roof, title, ownership, tenant unit, floor, independent building or complete campus.",
            "All identity, jurisdiction, status, physical dates, quantities, company roles, canonical address and original source history remain exact. Raw parcel geometry is not exported.",
            "Official imagery was actually viewed; acquisition date is unknown and may predate construction. No residential roof is selected and imagery does not certify current operation.",
            "The actually viewed filed report names Westwood Solutions LLC, identifies Google LLC as its submitting owner, gives facility ID 117197 and supplies the physical service address 8425 N. 114th Street, Omaha, Nebraska 68142. Current Google Nebraska context supplies the regional operator binding but no numeric address. The exact county property situs is 8425 N 114 ST, with postal code 68142 and retained Douglas County. County owner mail at 1600 Amphitheatre Parkway and the agency Fallbrook office are excluded. Report water, power, acreage, tax, useful life and performance figures are not adopted. The report year and receipt are not physical event dates.",
            "The inherited point is an unreviewed general area reference, not an earlier accepted site parcel or street. The actually viewed Nebraska filed Westwood Solutions report names the retained Google Omaha record and physical service address 8425 N. 114th Street, Omaha, NE 68142. Exactly one official Douglas County tax feature repeats 8425 N 114 ST, PIN 2245320128 and postal code 68142. Its mathematical center is inside that reference parcel and retained Douglas County, 4786.0 metres from the inherited point. Imagery of unknown acquisition date shows agricultural ground and may predate campus construction. The rural residence at the southern edge is not selected. This is an approximate reference to one source bound tax parcel, with no current roof, independent building, full campus, title, construction milestone or operation certification."
          ],
          "sources": [
            {
              "url": "https://datacenters.google/locations/nebraska/",
              "host": "datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Current named operator location context and service address where published"
            },
            {
              "url": "https://dcgis.org/server/rest/services/vector/Parcels_public/MapServer/0/query?where=UPPER%28PROPERTY_A%29+LIKE+%27%258425%25114%25%27&outFields=PIN%2CADDRESS1%2CADDRESS2%2CPROPERTY_A%2CSTREET_DIR%2CSTREET_NAM%2CSTREET_TYP%2CPROP_CITY%2CPROP_ZIP&returnGeometry=true&outSR=4326&resultRecordCount=30&f=json",
              "host": "dcgis.org",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "One exact public tax reference parcel feature and situs"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-96.09241763230894%2C41.336825910887534%2C-96.08404236769105%2C41.34311408911247&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Actually viewed setting only, acquisition date unknown"
            },
            {
              "url": "https://dcgis.org/server/rest/services/vector/Parcels_public/MapServer/0?f=pjson",
              "host": "dcgis.org",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Official dataset attribution and reference mapping method"
            },
            {
              "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/ARuMkgE1TvD7Umlj6wRARHuYJ40%C3%81%C3%890lDqLE4lryd4tuqzMUw7BJFzTpAydzwcQK6MmQc9GLu9GQlAFjgVozyT4g%3D/",
              "host": "ecmp.nebraska.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Actually viewed filed Westwood Solutions physical service address"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check57, October24,2026",
          "scope": "Google identifies the named Omaha data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Nebraska page names Omaha separately and describes the Omaha facility as built in2022. That year is not a new exact opening date, nor a finding about every phase or building.",
          "fields": {
            "company_association": {
              "name": "Google",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Google identifies the named Omaha data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Nebraska page names Omaha separately and describes the Omaha facility as built in2022. That year is not a new exact opening date, nor a finding about every phase or building."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Google identifies the named Omaha data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Nebraska page names Omaha separately and describes the Omaha facility as built in2022. That year is not a new exact opening date, nor a finding about every phase or building."
          ],
          "sources": [
            {
              "url": "https://datacenters.google/locations/nebraska/",
              "host": "datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Approximate reference parcel, not a surveyed building or full campus",
      "summary": "Omaha · Douglas · Source context reviewed",
      "status_scope": "An operating component is supported at Google’s named Omaha, Nebraska location by its current operator listing and 2025 operational reporting. This is regional campus scope, not verification that every expansion/building is complete, fully commissioned or operating at a stated MW. Annual reporting is historical, not an October operating inspection.",
      "typed_water_facts": [
        {
          "measure": "withdrawal",
          "value": 241.8,
          "unit": "million gallons",
          "as_of": null,
          "as_of_basis": "reporting_period",
          "reporting_period": {
            "label": "2025",
            "start": "2025-01-01",
            "end": "2025-12-31"
          },
          "observed_on": "2026-10-16",
          "basis": "operator_reported_total",
          "scope": "Google 2026 Environmental Report p.97: Omaha, NE, calendar year 2025 withdrawal; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.",
          "sources": [
            "https://sustainability.google/files/google-2026-environmental-report.pdf"
          ]
        },
        {
          "measure": "discharge",
          "value": 57.9,
          "unit": "million gallons",
          "as_of": null,
          "as_of_basis": "reporting_period",
          "reporting_period": {
            "label": "2025",
            "start": "2025-01-01",
            "end": "2025-12-31"
          },
          "observed_on": "2026-10-16",
          "basis": "operator_reported_total",
          "scope": "Google 2026 Environmental Report p.97: Omaha, NE, calendar year 2025 discharge; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.",
          "sources": [
            "https://sustainability.google/files/google-2026-environmental-report.pdf"
          ]
        },
        {
          "measure": "consumption",
          "value": 183.9,
          "unit": "million gallons",
          "as_of": null,
          "as_of_basis": "reporting_period",
          "reporting_period": {
            "label": "2025",
            "start": "2025-01-01",
            "end": "2025-12-31"
          },
          "observed_on": "2026-10-16",
          "basis": "operator_reported_total",
          "scope": "Google 2026 Environmental Report p.97: Omaha, NE, calendar year 2025 consumption; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.",
          "sources": [
            "https://sustainability.google/files/google-2026-environmental-report.pdf"
          ]
        }
      ]
    },
    {
      "id": "google-papillion-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Google Papillion Data Center",
      "group": "operating",
      "status": "Operating phase",
      "raw_status": "partly operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Sarpy"
      ],
      "city": "Papillion",
      "address": "",
      "who": "Google",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "Calendar-year 2025 operator-reported location totals. Withdrawal, discharge and consumption are separate quantities; methodology permits estimates and does not establish today’s use.",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Nebraska namedsite milestones and regionaltotal. CurrentprimarymilestoneexplicitlyLincolncomesonline2026, month/dayunknown.15Bregionalnotpercampus.1.2B2023jointgrowthnotadditive. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Original annual report visibly read; self-reported period, redactions and number definitions control.. The 2026 annual report contains 2025 resource/tax labels; do not relabel usage as 2026. Area is the reported total campus footprint in a gross-floor-area column, not verified white space or individual-building area. Efficiency, demand response and clean-energy discussion includes Google-wide/global figures; do not assign them to this campus. Design-life language is not an opening date or a scheduled closure. Nebraska Advantage sales/use exemptions utilized or expected are described; no ImagiNE payments received or expected is the report statement, not all tax benefits zero. Fireball additionally states no Nebraska Advantage rebates received to date; do not infer that statement for all reports. Resource and tax values visibly redacted in the current public report. No underlying hidden text extracted. Not all-field or current operating-building certification. Google 2026 quarterly performance table; named regional campus scope. Operator-reported period metrics, not an October operating inspection, current MW load or building-specific measurement. Regional values are not assigned to a separate expansion or street-address record. Blank TTM remains unknown. No status, location precision or whole-campus completion upgrade; publication date unknown.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://datacenters.google/locations/nebraska/",
          "host": "datacenters.google",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/Aerrd1gj6liDUR%C3%81TTL9Uc3n82mcP0rlZ7xFegDul%C3%89UBjKadUONlF4aV%C3%895cr8WpV57TAEW0lDJpmfgfbZl2NKjV0%3D/",
          "host": "ecmp.nebraska.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://datacenters.google/efficiency/",
          "host": "datacenters.google",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.datacenters.google/locations/nebraska/",
          "host": "www.datacenters.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Google official location source"
        },
        {
          "url": "https://www.datacenters.google/locations/",
          "host": "www.datacenters.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Google official location source"
        },
        {
          "url": "https://sustainability.google/files/google-2026-environmental-report.pdf",
          "host": "sustainability.google",
          "published": "",
          "date": "",
          "checked": "2026-10-16",
          "label": "Google 2026 Environmental Report"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=14865+Gold+Coast+Road%2C+Papillion%2C+NE+68138&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-96.15104967884459%2C41.13670883909453%2C-96.14270001952143%2C41.142997017319466&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Viewed aerial setting, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -96.146875,
        "lat": 41.139853,
        "precision": "address",
        "basis": "Publicly filed facility address 14865 Gold Coast Road, Papillion, NE 68138 matched to one Census street range inside the retained Sarpy County. Calculated campus service street reference only, not a surveyed roof, title, independent expansion parcel or full campus boundary. Existing native status remains operating."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "Nebraska namedsite milestones and regionaltotal",
          "fields": {
            "operator_reported_papillion_built_year": 2019,
            "operator_reported_omaha_built_year": 2022,
            "lincoln_development_announcement_year": 2023,
            "operator_reported_lincoln_online_year": 2026,
            "regional_investment_usd_min_exclusive": 15000000000,
            "investment_scope": "Nebraska statewide"
          },
          "notes": [
            "CurrentprimarymilestoneexplicitlyLincolncomesonline2026, month/dayunknown.15Bregionalnotpercampus.1.2B2023jointgrowthnotadditive.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://datacenters.google/locations/nebraska/",
              "host": "datacenters.google",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "nebraska-annual-reports-visible-review-round51-2026-10-15.json",
          "scope": "Original annual report visibly read; self-reported period, redactions and number definitions control.",
          "fields": {},
          "notes": [
            "The 2026 annual report contains 2025 resource/tax labels; do not relabel usage as 2026.",
            "Area is the reported total campus footprint in a gross-floor-area column, not verified white space or individual-building area.",
            "Efficiency, demand response and clean-energy discussion includes Google-wide/global figures; do not assign them to this campus.",
            "Design-life language is not an opening date or a scheduled closure.",
            "Nebraska Advantage sales/use exemptions utilized or expected are described; no ImagiNE payments received or expected is the report statement, not all tax benefits zero.",
            "Fireball additionally states no Nebraska Advantage rebates received to date; do not infer that statement for all reports.",
            "Resource and tax values visibly redacted in the current public report. No underlying hidden text extracted.",
            "Not all-field or current operating-building certification."
          ],
          "sources": [
            {
              "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/Aerrd1gj6liDUR%C3%81TTL9Uc3n82mcP0rlZ7xFegDul%C3%89UBjKadUONlF4aV%C3%895cr8WpV57TAEW0lDJpmfgfbZl2NKjV0%3D/",
              "host": "ecmp.nebraska.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Atlas targeted primary-source follow-up",
          "scope": "Google 2026 quarterly performance table; named regional campus scope",
          "fields": {
            "operator_reported_pue_period": "2026-Q2",
            "operator_reported_campus_pue": [
              {
                "source_campus_label": "Papillion, Nebraska",
                "quarterly_pue": 1.09,
                "trailing_twelve_month_pue": 1.09
              }
            ]
          },
          "notes": [
            "Operator-reported period metrics, not an October operating inspection, current MW load or building-specific measurement. Regional values are not assigned to a separate expansion or street-address record. Blank TTM remains unknown. No status, location precision or whole-campus completion upgrade; publication date unknown."
          ],
          "sources": [
            {
              "url": "https://datacenters.google/efficiency/",
              "host": "datacenters.google",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            },
            {
              "url": "https://datacenters.google/locations/nebraska/",
              "host": "datacenters.google",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "checked": "2026-10-15",
          "capture_sha256": "398f42d55ca9e2ebecd3b24e2dede307ad2d9d3b653469d1efebd135488f9c17",
          "events": [],
          "whole_record_certified": false
        },
        {
          "overlay": "S4-Google-Locations-20261016",
          "scope": "Named Google location research context; regional campus and individual building identity remain separate.",
          "fields": {
            "operator_location_scope": "Papillion, Nebraska is named in Google’s current directory and linked location page. Regional entries can include several facilities; directory development flags alone do not establish an operating stage.",
            "record_association_scope": "The named operator location is associated with this existing research context by provider and named city/county. This is an explicit research association, not proof of a distinct physical site or an exact parcel.",
            "annual_water_reporting": {
              "source_location": "Papillion, NE",
              "report_year": 2026,
              "reporting_year": 2025,
              "source_page": 97,
              "unit": "Million gallons",
              "withdrawal": 677.8,
              "discharge": 129.6,
              "consumption": 548.2
            },
            "water_method_scope": "Annual calendar-year 2025 figures for the reported location, not instantaneous use, a daily rate, an approved limit or one building. Google uses metered or invoiced values when available and can estimate missing data; the table does not identify each row’s metering completeness. Consumption is calculated as withdrawal minus discharge; values are rounded. Seawater and brackish water over 1,000 mg/L total dissolved solids are excluded. Unless otherwise specified, withdrawals are potable; Douglas County includes reclaimed wastewater. No litres or daily averages are calculated.",
            "water_location_association": "Papillion, NE is associated with this regional campus research context only; no allocation to separate expansion/street-address records or individual buildings.",
            "current_status_basis": "An operating component is supported at Google’s named Papillion, Nebraska location by its current operator listing and 2025 operational reporting. This is regional campus scope, not verification that every expansion/building is complete, fully commissioned or operating at a stated MW. Annual reporting is historical, not an October operating inspection."
          },
          "notes": [
            "A partial operator/field review does not certify every fact or a whole state. No precise address, map point, current IT load or per-campus investment is inferred."
          ],
          "sources": [
            {
              "url": "https://www.datacenters.google/locations/nebraska/",
              "host": "www.datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Google official location source"
            },
            {
              "url": "https://www.datacenters.google/locations/",
              "host": "www.datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Google official location source"
            },
            {
              "url": "https://sustainability.google/files/google-2026-environmental-report.pdf",
              "host": "sustainability.google",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Google 2026 Environmental Report"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 23, October 23, 2026",
          "scope": "Filed campus service street reference only. Existing native status remains operating. Protected facts and canonical address remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -96.146875,
                "lat": 41.139853,
                "precision": "address",
                "basis": "Publicly filed facility address 14865 Gold Coast Road, Papillion, NE 68138 matched to one Census street range inside the retained Sarpy County. Calculated campus service street reference only, not a surveyed roof, title, independent expansion parcel or full campus boundary. Existing native status remains operating."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "14865 Gold Coast Road, Papillion, NE 68138",
              "county_fips": [
                "31153"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The publicly filed company report names this data center and gives its physical service location. The agency office at 245 Fallbrook Boulevard is excluded.",
            "The unique Census street range agrees with the existing Sarpy County and retained display polygon. This one campus service reference does not certify an individual expansion parcel, building, roof, floor, title or complete campus boundary.",
            "All status, physical date, quantity, role, identity and jurisdiction wrappers remain exact, and the canonical address stays blank. Reported water, power, area, taxes, useful life and claimed performance are not adopted. Existing native status remains operating.",
            "The raw Census match is retained unchanged. The public interpolated street coordinates are rounded to six decimal places, with rounding displacement below 0.1 metre. This does not establish survey accuracy or a roof."
          ],
          "sources": [
            {
              "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/Aerrd1gj6liDUR%C3%81TTL9Uc3n82mcP0rlZ7xFegDul%C3%89UBjKadUONlF4aV%C3%895cr8WpV57TAEW0lDJpmfgfbZl2NKjV0%3D/",
              "host": "ecmp.nebraska.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Filed named facility numeric service address only"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=14865+Gold+Coast+Road%2C+Papillion%2C+NE+68138&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-96.15104967884459%2C41.13670883909453%2C-96.14270001952143%2C41.142997017319466&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Viewed aerial setting, acquisition date unknown"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check57, October24,2026",
          "scope": "Google identifies the named Papillion data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Nebraska page separately names Papillion and a2019facility context. This does not merge Omaha or Lincoln into Papillion or allocate statewide investment to this campus.",
          "fields": {
            "company_association": {
              "name": "Google",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Google identifies the named Papillion data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Nebraska page separately names Papillion and a2019facility context. This does not merge Omaha or Lincoln into Papillion or allocate statewide investment to this campus."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Google identifies the named Papillion data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Nebraska page separately names Papillion and a2019facility context. This does not merge Omaha or Lincoln into Papillion or allocate statewide investment to this campus."
          ],
          "sources": [
            {
              "url": "https://datacenters.google/locations/nebraska/",
              "host": "datacenters.google",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Filed facility address reference, not a surveyed building or parcel",
      "summary": "Papillion · Sarpy · Source context reviewed",
      "status_scope": "An operating component is supported at Google’s named Papillion, Nebraska location by its current operator listing and 2025 operational reporting. This is regional campus scope, not verification that every expansion/building is complete, fully commissioned or operating at a stated MW. Annual reporting is historical, not an October operating inspection.",
      "typed_water_facts": [
        {
          "measure": "withdrawal",
          "value": 677.8,
          "unit": "million gallons",
          "as_of": null,
          "as_of_basis": "reporting_period",
          "reporting_period": {
            "label": "2025",
            "start": "2025-01-01",
            "end": "2025-12-31"
          },
          "observed_on": "2026-10-16",
          "basis": "operator_reported_total",
          "scope": "Google 2026 Environmental Report p.97: Papillion, NE, calendar year 2025 withdrawal; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.",
          "sources": [
            "https://sustainability.google/files/google-2026-environmental-report.pdf"
          ]
        },
        {
          "measure": "discharge",
          "value": 129.6,
          "unit": "million gallons",
          "as_of": null,
          "as_of_basis": "reporting_period",
          "reporting_period": {
            "label": "2025",
            "start": "2025-01-01",
            "end": "2025-12-31"
          },
          "observed_on": "2026-10-16",
          "basis": "operator_reported_total",
          "scope": "Google 2026 Environmental Report p.97: Papillion, NE, calendar year 2025 discharge; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.",
          "sources": [
            "https://sustainability.google/files/google-2026-environmental-report.pdf"
          ]
        },
        {
          "measure": "consumption",
          "value": 548.2,
          "unit": "million gallons",
          "as_of": null,
          "as_of_basis": "reporting_period",
          "reporting_period": {
            "label": "2025",
            "start": "2025-01-01",
            "end": "2025-12-31"
          },
          "observed_on": "2026-10-16",
          "basis": "operator_reported_total",
          "scope": "Google 2026 Environmental Report p.97: Papillion, NE, calendar year 2025 consumption; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.",
          "sources": [
            "https://sustainability.google/files/google-2026-environmental-report.pdf"
          ]
        }
      ]
    },
    {
      "id": "h5-la-vista-ne",
      "state": "ne",
      "kind": "facility",
      "name": "H5 Data Centers Omaha (La Vista)",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Sarpy"
      ],
      "city": "La Vista",
      "address": "",
      "who": "H5 Data Centers",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Omaha is market label; physical location is LaVista. Do not add redundant equipment capacities. Operator service/design assertions, not an independent uptime or certification audit. Repeated Ashburn42MW/Q32024 promotional footer is excluded from this location. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://h5datacenters.com/omaha-data-center.html",
          "host": "h5datacenters.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=10917+Harry+Watanabe+Pkwy%2C+La+Vista%2C+NE&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street method and limits"
        }
      ],
      "loc": {
        "lat": 41.180601309036,
        "lng": -96.082712981255,
        "precision": "address",
        "basis": "Published H5 Data Centers facility address 10917 Harry Watanabe Pkwy, La Vista, NE matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "h5-primary-review-round4-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "published_address": "10917 Harry Watanabe Pkwy, La Vista, NE",
            "campus_sqft": 234500,
            "campus_acres": 32,
            "advertised_critical_capacity_mw": 17.3,
            "power_redundancy": "N+1"
          },
          "notes": [
            "Omaha is market label; physical location is LaVista. Do not add redundant equipment capacities.",
            "Operator service/design assertions, not an independent uptime or certification audit. Repeated Ashburn42MW/Q32024 promotional footer is excluded from this location.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://h5datacenters.com/omaha-data-center.html",
              "host": "h5datacenters.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "H5 lists current carrier-neutral colocation and interconnection services at its Omaha campus in La Vista. The separate Ashburn future-delivery footer is excluded. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "H5 lists current carrier-neutral colocation and interconnection services at its Omaha campus in La Vista. The separate Ashburn future-delivery footer is excluded. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "H5 lists current carrier-neutral colocation and interconnection services at its Omaha campus in La Vista. The separate Ashburn future-delivery footer is excluded."
          ],
          "sources": [
            {
              "url": "https://h5datacenters.com/omaha-data-center.html",
              "host": "h5datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 7, October 22, 2026",
          "scope": "Official facility service street reference only. No canonical address, current operation, physical date, capacity, company role, jurisdiction, parcel, complete campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 41.180601309036,
                "lng": -96.082712981255,
                "precision": "address",
                "basis": "Published H5 Data Centers facility address 10917 Harry Watanabe Pkwy, La Vista, NE matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "10917 Harry Watanabe Pkwy, La Vista, NE",
              "county_fips": [
                "31153"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named operator facility page publishes this service address in its facility location section. Navigation, related facilities, corporate addresses, embedded maps and operator template coordinates are excluded. The canonical address wrapper remains exact; the published address is retained as reviewed location evidence.",
            "The unique Census street match and retained county boundary agree with the existing county. Street interpolation does not identify a roof, suite, floor, campus boundary, legal parcel, ownership or distinct physical building. Status, dates, quantities and jurisdiction remain unchanged."
          ],
          "sources": [
            {
              "url": "https://h5datacenters.com/omaha-data-center.html",
              "host": "h5datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Official named facility street address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=10917+Harry+Watanabe+Pkwy%2C+La+Vista%2C+NE&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street method and limits"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 12, October 23, 2026",
          "scope": "H5 Data Centers presents this named facility or campus in its own colocation service portfolio. Operator is the attributed provider brand relationship, not an independently established legal operating entity, property owner or confirmation that every building and phase is operating. No status, location, physical date, capacity, certification, outage guarantee, utility price or environmental outcome is promoted. Omaha is the marketed area name while the source states La Vista. No jurisdiction change is inferred.",
          "fields": {
            "company_association": {
              "name": "H5 Data Centers",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "H5 Data Centers presents this named facility or campus in its own colocation service portfolio. Operator is the attributed provider brand relationship, not an independently established legal operating entity, property owner or confirmation that every building and phase is operating. No status, location, physical date, capacity, certification, outage guarantee, utility price or environmental outcome is promoted. Omaha is the marketed area name while the source states La Vista. No jurisdiction change is inferred."
            },
            "provider_role": "operator"
          },
          "notes": [
            "H5 Data Centers presents this named facility or campus in its own colocation service portfolio. Operator is the attributed provider brand relationship, not an independently established legal operating entity, property owner or confirmation that every building and phase is operating. No status, location, physical date, capacity, certification, outage guarantee, utility price or environmental outcome is promoted. Omaha is the marketed area name while the source states La Vista. No jurisdiction change is inferred.",
            "Source dates remain separate from physical milestones and the retained status field."
          ],
          "sources": [
            {
              "url": "https://h5datacenters.com/omaha-data-center.html",
              "host": "h5datacenters.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party named colocation portfolio page, scoped provider relationship reviewed"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "La Vista · Sarpy · Source context reviewed",
      "status_scope": "H5 lists current carrier-neutral colocation and interconnection services at its Omaha campus in La Vista. The separate Ashburn future-delivery footer is excluded. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "jigowatt-stanton-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Jigowatt Stanton Bitcoin Mine",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "Stanton"
      ],
      "city": "Stanton",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. FlatwaterJune27,2025originalJigowattStantonreport:20MWthenexistingCOUNTYload/70MWrequestedfuture not90MWorIT. PriorNorthernData40ac2021cloudplanpaused/soldwithoutgroundbreaking;Jigowattpods2023differentoperation. Separate4acNorfolksiteunmerged.20Mapproxinfraprogramincludes11Mline/9.5Msubstations,notsummedagainorDCcapex.5Mlettersofcreditcollateralnotpaidcost/rebate;100kparkpledge,paymentunverified.2024taxBILLS98kpersonal+18krealnotcashcollections/current2026taxes. Eminentdomainappealsongoingnotfinallegalityfinding;healthsymptomsresidentreportsnotcausation;partialimmersionconversionnotalltenantfanseliminated. Sourcecommentsnotadopted. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations.",
      "date": "",
      "events": [
        [
          "2023-08-10",
          "The original NPPD minutes record August 10, 2023 adoption of resolution 23 40 authorizing preliminary transmission routing and public involvement for the proposed Jigowatt computing load. This is a utility planning action rather than completed transmission, computing construction or the forecast November 2025 service date."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://flatwaterfreepress.org/a-nebraska-crypto-company-wants-to-get-bigger-landowners-decry-nppds-use-of-eminent-domain-that-will-help-it-grow/",
          "host": "flatwaterfreepress.org",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://docs.nppd.com/Board/2023/2023AugustMinutes.pdf",
          "host": "docs.nppd.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed government record"
        }
      ],
      "loc": {
        "lat": 41.91697,
        "lng": -97.19392,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json",
          "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.",
          "fields": {
            "dated_reported_context": "FlatwaterJune27,2025originalJigowattStantonreport:20MWthenexistingCOUNTYload/70MWrequestedfuture not90MWorIT. PriorNorthernData40ac2021cloudplanpaused/soldwithoutgroundbreaking;Jigowattpods2023differentoperation. Separate4acNorfolksiteunmerged.20Mapproxinfraprogramincludes11Mline/9.5Msubstations,notsummedagainorDCcapex.5Mlettersofcreditcollateralnotpaidcost/rebate;100kparkpledge,paymentunverified.2024taxBILLS98kpersonal+18krealnotcashcollections/current2026taxes. Eminentdomainappealsongoingnotfinallegalityfinding;healthsymptomsresidentreportsnotcausation;partialimmersionconversionnotalltenantfanseliminated. Sourcecommentsnotadopted."
          },
          "notes": [
            "FlatwaterJune27,2025originalJigowattStantonreport:20MWthenexistingCOUNTYload/70MWrequestedfuture not90MWorIT. PriorNorthernData40ac2021cloudplanpaused/soldwithoutgroundbreaking;Jigowattpods2023differentoperation. Separate4acNorfolksiteunmerged.20Mapproxinfraprogramincludes11Mline/9.5Msubstations,notsummedagainorDCcapex.5Mlettersofcreditcollateralnotpaidcost/rebate;100kparkpledge,paymentunverified.2024taxBILLS98kpersonal+18krealnotcashcollections/current2026taxes. Eminentdomainappealsongoingnotfinallegalityfinding;healthsymptomsresidentreportsnotcausation;partialimmersionconversionnotalltenantfanseliminated. Sourcecommentsnotadopted.",
            "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations."
          ],
          "sources": [
            {
              "url": "https://flatwaterfreepress.org/a-nebraska-crypto-company-wants-to-get-bigger-landowners-decry-nppds-use-of-eminent-domain-that-will-help-it-grow/",
              "host": "flatwaterfreepress.org",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "Selected original August 2023 public utility minutes explicitly describe the Jigowatt proposed cloud computing project and adopt routing and public involvement authority for a transmission line. The meeting resumed August 10 and the resolution vote belongs to that day. This is transmission planning authority, not an accomplished computing facility approval, installed line, delivered energy or present mining service. The November 2025 service target is a forecast rather than an actual completion date. The remaining minute business was not fully reviewed.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "historical_utility_routing_action_current_computing_stage_held",
              "scope": "Selected original August 2023 public utility minutes explicitly describe the Jigowatt proposed cloud computing project and adopt routing and public involvement authority for a transmission line. The meeting resumed August 10 and the resolution vote belongs to that day. This is transmission planning authority, not an accomplished computing facility approval, installed line, delivered energy or present mining service. The November 2025 service target is a forecast rather than an actual completion date. The remaining minute business was not fully reviewed."
            },
            "source_read_scope": {
              "original_eighteen_page_minutes_selected_physical_pages1_2_3_11_12_13_14_15_read": true,
              "aug10_reconvened_session_and_resolution_vote_read": true,
              "november2025_forecast_not_completed_service": true,
              "no_transmission_power_or_capacity_fields_changed": true
            }
          },
          "notes": [
            "Selected original August 2023 public utility minutes explicitly describe the Jigowatt proposed cloud computing project and adopt routing and public involvement authority for a transmission line. The meeting resumed August 10 and the resolution vote belongs to that day. This is transmission planning authority, not an accomplished computing facility approval, installed line, delivered energy or present mining service. The November 2025 service target is a forecast rather than an actual completion date. The remaining minute business was not fully reviewed.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://docs.nppd.com/Board/2023/2023AugustMinutes.pdf",
              "host": "docs.nppd.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Stanton · Stanton · Source context reviewed",
      "event_evidence": [
        {
          "date": "2023-08-10",
          "text": "The original NPPD minutes record August 10, 2023 adoption of resolution 23 40 authorizing preliminary transmission routing and public involvement for the proposed Jigowatt computing load. This is a utility planning action rather than completed transmission, computing construction or the forecast November 2025 service date.",
          "kind": "approved",
          "sources": [
            {
              "url": "https://docs.nppd.com/Board/2023/2023AugustMinutes.pdf",
              "host": "docs.nppd.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed government record"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31167"
      }
    },
    {
      "id": "lightedge-papillion-ne",
      "state": "ne",
      "kind": "facility",
      "name": "LightEdge Omaha Data Center",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Sarpy"
      ],
      "city": "Papillion",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Lightedge Papillion street identity. CriticalITandareaheadingshave no numeric values in captured body. No zero or guessedMW adopted. Market name not municipality. Operator commercial listing, no exact original opening. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://lightedge.com/data-centers/omaha-data-center/",
          "host": "lightedge.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1148+American+Parkway%2C+Papillion%2C+NE+68046&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Calculated Census street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-96.03018771406356%2C41.15636945586353%2C-96.02183555058043%2C41.16265763408847&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Aerial setting only, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -96.026011632322,
        "lat": 41.159513544976,
        "precision": "address",
        "basis": "Published Lightedge facility address 1148 American Parkway, Papillion, Nebraska 68046 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "primary-source-review-round9-2026-10-14.json",
          "scope": "Lightedge Papillion street identity",
          "fields": {
            "operator": "Lightedge",
            "market": "Omaha",
            "address": "1148 American Parkway, Papillion, Nebraska 68046"
          },
          "notes": [
            "CriticalITandareaheadingshave no numeric values in captured body. No zero or guessedMW adopted. Market name not municipality. Operator commercial listing, no exact original opening.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://lightedge.com/data-centers/omaha-data-center/",
              "host": "lightedge.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "Lightedge offers current racks, cages and suites, with staffed support, at its Omaha-market facility in Papillion. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "Lightedge offers current racks, cages and suites, with staffed support, at its Omaha-market facility in Papillion. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "Lightedge offers current racks, cages and suites, with staffed support, at its Omaha-market facility in Papillion."
          ],
          "sources": [
            {
              "url": "https://lightedge.com/data-centers/omaha-data-center/",
              "host": "lightedge.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 16, October 23, 2026",
          "scope": "Current official facility street reference only. Native protected facts and canonical address remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -96.026011632322,
                "lat": 41.159513544976,
                "precision": "address",
                "basis": "Published Lightedge facility address 1148 American Parkway, Papillion, Nebraska 68046 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "1148 American Parkway, Papillion, Nebraska 68046",
              "county_fips": [
                "31153"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named official numeric facility section binds the service address to this existing research record. Corporate offices, related facility cards and embedded map coordinates are excluded.",
            "The unique Census calculated street range agrees with the retained state and county. Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. The reference does not locate a surveyed roof, parcel, full campus, legal owner, floor or suite.",
            "All canonical address, status, physical dates, quantity, role, identity and jurisdiction wrappers remain exact. The retained Census method source keeps its actual October 22 date; new captures are dated October 23."
          ],
          "sources": [
            {
              "url": "https://lightedge.com/data-centers/omaha-data-center/",
              "host": "lightedge.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Official named Omaha Data Center numeric facility address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1148+American+Parkway%2C+Papillion%2C+NE+68046&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Calculated Census street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-96.03018771406356%2C41.15636945586353%2C-96.02183555058043%2C41.16265763408847&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Aerial setting only, acquisition date unknown"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Papillion · Sarpy · Source context reviewed",
      "status_scope": "Lightedge offers current racks, cages and suites, with staffed support, at its Omaha-market facility in Papillion. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "mara-kearney-buffalo-ne",
      "state": "ne",
      "kind": "facility",
      "name": "MARA Kearney Facility",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": true,
      "type": "Crypto/HPC (inventory classification)",
      "counties": [
        "Buffalo"
      ],
      "city": "Kearney",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original annual report visibly read; self-reported period, redactions and number definitions control.. Peak electrical demand is not IT load, nominal site capacity or delivered energy. Annual electricity MWh is separate. January 2025 water includes an estimate of 3 HCF. Report states domestic water only and no water used for cooling; neither claim establishes zero total water or zero indirect water footprint. Report states no participation in the listed sales/use exemptions and N/A for the two incentive-payment fields; do not expand this to all taxes or subsidies. Report describes NPPD curtailment participation, not a quantified delivered response or independently verified rate agreement. The annual MWh is numerically close to one anonymous NPPD row after conversion/rounding, but NPPD names no operator. Do not assert a proven row-to-facility identity or add the two as independent consumption. Not all-field or current operating-building certification.",
      "date": "",
      "events": [
        [
          "2024-02-01",
          "The original MARA February 1, 2024 release publishes its intended operating transition at the acquired Kearney and Granbury mining sites. Its reported January 16 acquisition date differs from January 12 in the later original annual note. Neither date is silently corrected, and the forecast April transition is not certified as accomplished."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/AbobcZrAZNpJb7gsgke%C3%89aW5fNZniWK2c1ZflxM9O3rmi8KZ%C3%8171InSLiWRdK2%C3%892SnP%C3%89YoFaZyS%C3%89YR%C3%89hqHqSKSxRU%3D/",
          "host": "ecmp.nebraska.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://ir.mara.com/news-events/press-releases/detail/1340/marathon-digital-holdings-to-assume-full-operational-control-of-its-recently-acquired-bitcoin-mining-sites",
          "host": "ir.mara.com",
          "published": "2024-02-01",
          "date": "2024-02-01",
          "checked": "2026-10-24",
          "label": "Reviewed operator source"
        },
        {
          "url": "https://ir.mara.com/sec-filings/all-sec-filings/content/0001507605-26-000007/mara-20251231.htm",
          "host": "ir.mara.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed government record"
        }
      ],
      "loc": {
        "lat": 40.855,
        "lng": -99.07513,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "nebraska-annual-reports-visible-review-round51-2026-10-15.json",
          "scope": "Original annual report visibly read; self-reported period, redactions and number definitions control.",
          "fields": {},
          "notes": [
            "Peak electrical demand is not IT load, nominal site capacity or delivered energy. Annual electricity MWh is separate.",
            "January 2025 water includes an estimate of 3 HCF. Report states domestic water only and no water used for cooling; neither claim establishes zero total water or zero indirect water footprint.",
            "Report states no participation in the listed sales/use exemptions and N/A for the two incentive-payment fields; do not expand this to all taxes or subsidies.",
            "Report describes NPPD curtailment participation, not a quantified delivered response or independently verified rate agreement.",
            "The annual MWh is numerically close to one anonymous NPPD row after conversion/rounding, but NPPD names no operator. Do not assert a proven row-to-facility identity or add the two as independent consumption.",
            "Not all-field or current operating-building certification."
          ],
          "sources": [
            {
              "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/AbobcZrAZNpJb7gsgke%C3%89aW5fNZniWK2c1ZflxM9O3rmi8KZ%C3%8171InSLiWRdK2%C3%892SnP%C3%89YoFaZyS%C3%89YR%C3%89hqHqSKSxRU%3D/",
              "host": "ecmp.nebraska.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "The complete original February 1, 2024 issuer release reports acquisition of historical operating mining sites and forecasts an operator transition. The selected original fiscal 2025 acquisition note separately dates the acquisition January 12, whereas the release says January 16. Those exact source dates remain distinct and no single corrected acquisition day is adopted. The selected annual note is a historical business combination account rather than independently verified present Kearney computing service. Future Horizon development and adjacent power reuse do not establish conversion or closure of this exact mine. Roles and current stage remain held.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "historical_mining_acquisition_and_transition_current_stage_held",
              "scope": "The complete original February 1, 2024 issuer release reports acquisition of historical operating mining sites and forecasts an operator transition. The selected original fiscal 2025 acquisition note separately dates the acquisition January 12, whereas the release says January 16. Those exact source dates remain distinct and no single corrected acquisition day is adopted. The selected annual note is a historical business combination account rather than independently verified present Kearney computing service. Future Horizon development and adjacent power reuse do not establish conversion or closure of this exact mine. Roles and current stage remain held."
            },
            "source_read_scope": {
              "complete_original_february2024_release_body_read": true,
              "original_annual_selected_gc_acquisition_note_and_adjacent_table_read": true,
              "complete_annual_filing_not_claimed": true,
              "jan12_annual_and_jan16_release_conflict_not_harmonized": true,
              "forecast_operator_transition_not_accomplished": true,
              "no_current_role_conversion_or_closure_adopted": true
            }
          },
          "notes": [
            "The complete original February 1, 2024 issuer release reports acquisition of historical operating mining sites and forecasts an operator transition. The selected original fiscal 2025 acquisition note separately dates the acquisition January 12, whereas the release says January 16. Those exact source dates remain distinct and no single corrected acquisition day is adopted. The selected annual note is a historical business combination account rather than independently verified present Kearney computing service. Future Horizon development and adjacent power reuse do not establish conversion or closure of this exact mine. Roles and current stage remain held.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://ir.mara.com/news-events/press-releases/detail/1340/marathon-digital-holdings-to-assume-full-operational-control-of-its-recently-acquired-bitcoin-mining-sites",
              "host": "ir.mara.com",
              "published": "2024-02-01",
              "date": "2024-02-01",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            },
            {
              "url": "https://ir.mara.com/sec-filings/all-sec-filings/content/0001507605-26-000007/mara-20251231.htm",
              "host": "ir.mara.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed government record"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": false,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Kearney · Buffalo · Source context reviewed",
      "event_evidence": [
        {
          "date": "2024-02-01",
          "text": "The original MARA February 1, 2024 release publishes its intended operating transition at the acquired Kearney and Granbury mining sites. Its reported January 16 acquisition date differs from January 12 in the later original annual note. Neither date is silently corrected, and the forecast April transition is not certified as accomplished.",
          "kind": "announced",
          "sources": [
            {
              "url": "https://ir.mara.com/news-events/press-releases/detail/1340/marathon-digital-holdings-to-assume-full-operational-control-of-its-recently-acquired-bitcoin-mining-sites",
              "host": "ir.mara.com",
              "published": "2024-02-01",
              "date": "2024-02-01",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31019"
      }
    },
    {
      "id": "meta-sarpy-springfield-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Meta Sarpy Campus (Springfield expansion)",
      "group": "operating",
      "status": "Operator-listed service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Sarpy"
      ],
      "city": "Springfield",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Undated fact sheet; file path is not a publication date. First page visually reviewed. Regional investment not allocated per building. Renewable project MW excluded from site power; matching and water-positive goals are not continuous physical renewable supply or measured water use. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Original annual report visibly read; self-reported period, redactions and number definitions control.. Annual electricity is supplied in MWh and is an energy quantity, not peak MW or IT capacity. Withdrawal and consumption are distinct reported measures; never sum them as water usage. The property exemption figure is the value of property exempted, not tax dollars forgiven, cash incentives, capital investment or an extra amount to add to investment credit. Actual treasury payments not verified. A 100% annual renewable/clean-energy matching statement does not establish hourly carbon-free physical supply. Reported campus area and operational-building LEED claim do not establish that every expansion phase is operating. This is an operator submission published by the agency, not an independent meter, title or certification audit. Not all-field or current operating-building certification.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://datacenters.atmeta.com/asset/sarpy-data-center-info-sheet/",
          "host": "datacenters.atmeta.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/Aa%C3%81ITmiK1H%C3%81rd9NGax01kgn7O0Melbh18nAi3oOQU4oAq200thXCFxuBc8J2d13sj5zsw5MOTzNRqmP2jV6Recs%3D/",
          "host": "ecmp.nebraska.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=14734+Friend+Plaza%2C+Springfield%2C+NE+68059&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-96.14474326130951%2C41.120524301014534%2C-96.13639566153648%2C41.12681247923947&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
          "host": "basemap.nationalmap.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-23",
          "label": "Viewed aerial setting, acquisition date unknown"
        }
      ],
      "loc": {
        "lng": -96.140569,
        "lat": 41.123668,
        "precision": "address",
        "basis": "Publicly filed facility address 14734 Friend Plaza, Springfield, NE 68059 matched to one Census street range inside the retained Sarpy County. Calculated campus service street reference only, not a surveyed roof, title, independent expansion parcel or full campus boundary. Existing native status remains operating."
      },
      "reviewed_evidence": [
        {
          "overlay": "captured-operator-review-round6-2026-10-14.json",
          "scope": "named operator source",
          "fields": {
            "groundbreaking_year": 2017,
            "investment_usd_min": 2500000000,
            "investment_scope": "Nebraska statewide",
            "operator_reported_operational_jobs_min": 300,
            "peak_construction_workers": 1300,
            "local_school_nonprofit_funding_usd_min": 5700000,
            "jobs_qualification": "operational jobs supported"
          },
          "notes": [
            "Undated fact sheet; file path is not a publication date. First page visually reviewed. Regional investment not allocated per building. Renewable project MW excluded from site power; matching and water-positive goals are not continuous physical renewable supply or measured water use.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://datacenters.atmeta.com/asset/sarpy-data-center-info-sheet/",
              "host": "datacenters.atmeta.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "nebraska-annual-reports-visible-review-round51-2026-10-15.json",
          "scope": "Original annual report visibly read; self-reported period, redactions and number definitions control.",
          "fields": {},
          "notes": [
            "Annual electricity is supplied in MWh and is an energy quantity, not peak MW or IT capacity.",
            "Withdrawal and consumption are distinct reported measures; never sum them as water usage.",
            "The property exemption figure is the value of property exempted, not tax dollars forgiven, cash incentives, capital investment or an extra amount to add to investment credit. Actual treasury payments not verified.",
            "A 100% annual renewable/clean-energy matching statement does not establish hourly carbon-free physical supply.",
            "Reported campus area and operational-building LEED claim do not establish that every expansion phase is operating.",
            "This is an operator submission published by the agency, not an independent meter, title or certification audit.",
            "Not all-field or current operating-building certification."
          ],
          "sources": [
            {
              "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/Aa%C3%81ITmiK1H%C3%81rd9NGax01kgn7O0Melbh18nAi3oOQU4oAq200thXCFxuBc8J2d13sj5zsw5MOTzNRqmP2jV6Recs%3D/",
              "host": "ecmp.nebraska.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "overnight-status-2026-10-16",
          "scope": "Named project and operator-service status review; phase and source limits retained.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "supported_label",
              "label": "Operator-listed service",
              "basis": "The current named operator factsheet identifies this campus as part of Meta’s infrastructure providing its technologies and reports its existing operational role.",
              "checked_on": "2026-10-16"
            },
            "stage_review_limits": "This is a current operator-listed service context, not independent certification of every building, all planned jobs, occupancy or technical capacity. Offsite renewable procurement and future restoration goals are not site IT load or measured water outcomes."
          },
          "notes": [
            "This is a current operator-listed service context, not independent certification of every building, all planned jobs, occupancy or technical capacity. Offsite renewable procurement and future restoration goals are not site IT load or measured water outcomes.",
            "Current service and project labels are source-scoped research contexts. No entire record, physical site, technical quantity or exact parcel is certified."
          ],
          "sources": [
            {
              "url": "https://datacenters.atmeta.com/asset/sarpy-data-center-info-sheet/",
              "host": "datacenters.atmeta.com",
              "published": "",
              "date": "",
              "checked": "2026-10-16",
              "label": "Reviewed current operator evidence"
            }
          ],
          "checked": "2026-10-16",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 23, October 23, 2026",
          "scope": "Filed campus service street reference only. Existing native status remains operating. Protected facts and canonical address remain exact.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lng": -96.140569,
                "lat": 41.123668,
                "precision": "address",
                "basis": "Publicly filed facility address 14734 Friend Plaza, Springfield, NE 68059 matched to one Census street range inside the retained Sarpy County. Calculated campus service street reference only, not a surveyed roof, title, independent expansion parcel or full campus boundary. Existing native status remains operating."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "14734 Friend Plaza, Springfield, NE 68059",
              "county_fips": [
                "31153"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The publicly filed company report names this data center and gives its physical service location. The agency office at 245 Fallbrook Boulevard is excluded.",
            "The unique Census street range agrees with the existing Sarpy County and retained display polygon. This one campus service reference does not certify an individual expansion parcel, building, roof, floor, title or complete campus boundary.",
            "All status, physical date, quantity, role, identity and jurisdiction wrappers remain exact, and the canonical address stays blank. Reported water, power, area, taxes, useful life and claimed performance are not adopted. Existing native status remains operating.",
            "The inherited Compute Atlas reference at 41.052, -96.148 is an unreviewed general area point, not an earlier accepted parcel or street. The current public Nebraska report already linked in this record explicitly names Meta Sarpy Data Center and gives Location as 14734 Friend Plaza, Springfield, NE 68059, Sarpy County. A unique Census street range inside the retained Sarpy County is 7993.4 metres from the inherited point. Actually viewed official imagery places the reference on a service street beside industrial forms and open ground, with acquisition date unknown. This is one reported campus service address; no particular Springfield expansion parcel, individual building, full campus, legal title, construction date or present operation is certified.",
            "The raw Census match is retained unchanged. The public interpolated street coordinates are rounded to six decimal places, with rounding displacement below 0.1 metre. This does not establish survey accuracy or a roof."
          ],
          "sources": [
            {
              "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/Aa%C3%81ITmiK1H%C3%81rd9NGax01kgn7O0Melbh18nAi3oOQU4oAq200thXCFxuBc8J2d13sj5zsw5MOTzNRqmP2jV6Recs%3D/",
              "host": "ecmp.nebraska.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Filed named facility numeric service address only"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=14734+Friend+Plaza%2C+Springfield%2C+NE+68059&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-96.14474326130951%2C41.120524301014534%2C-96.13639566153648%2C41.12681247923947&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image",
              "host": "basemap.nationalmap.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "Viewed aerial setting, acquisition date unknown"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Filed facility address reference, not a surveyed building or parcel",
      "summary": "Springfield · Sarpy · Source context reviewed",
      "status_scope": "Primary source review checked 2026-10-16. The current named operator factsheet identifies this campus as part of Meta’s infrastructure providing its technologies and reports its existing operational role. This is a current operator-listed service context, not independent certification of every building, all planned jobs, occupancy or technical capacity. Offsite renewable procurement and future restoration goals are not site IT load or measured water outcomes."
    },
    {
      "id": "nebraska-colocation-centers-lincoln-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Nebraska Colocation Centers  -  Lincoln (Sharp Building)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Lancaster"
      ],
      "city": "Lincoln",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. A later page-author timestamp is not the original publication date or an opening event. Omaha's carrier count is not Lincoln's. Unrelated pharmaceutical spam in the body lowers source quality; no current guarantees, operator status, power, contact accuracy or tenant counts are adopted from this old promotional account. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://strictly-business.com/cover-story/nebraska-colocation-centers-defining-moment-technology-lincoln-nebraska/",
          "host": "strictly-business.com",
          "date": "2014-08-01",
          "published": "2014-08-01",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.binary.net/sharpannex/",
          "host": "www.binary.net",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 40.81504,
        "lng": -96.66403,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round28-2026-10-14.json",
          "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.",
          "fields": {
            "reported_context": "Strictly Business's historical cover story describes Nebraska Colocation Centers' first Lincoln raised-floor phase at 206 South 13th Street, opened the preceding October.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "A later page-author timestamp is not the original publication date or an opening event. Omaha's carrier count is not Lincoln's. Unrelated pharmaceutical spam in the body lowers source quality; no current guarantees, operator status, power, contact accuracy or tenant counts are adopted from this old promotional account.",
            "Original approvals and later observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://strictly-business.com/cover-story/nebraska-colocation-centers-defining-moment-technology-lincoln-nebraska/",
              "host": "strictly-business.com",
              "date": "2014-08-01",
              "published": "2014-08-01",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "The complete original Binary Net Sharp Annex body describes present colocation and an acquisition only to the year 2019. It does not independently name the inherited Nebraska Colocation Centers corporate entity or prove that this exact legacy record is the same facility rather than another service at the shared address. A common building and a private old opening article are not an independently established identity crosswalk. The exact inherited current stage stays held and no record, operator role or campus is merged.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "current_sharp_annex_service_legacy_entity_crosswalk_held",
              "scope": "The complete original Binary Net Sharp Annex body describes present colocation and an acquisition only to the year 2019. It does not independently name the inherited Nebraska Colocation Centers corporate entity or prove that this exact legacy record is the same facility rather than another service at the shared address. A common building and a private old opening article are not an independently established identity crosswalk. The exact inherited current stage stays held and no record, operator role or campus is merged."
            },
            "source_read_scope": {
              "complete_original_current_sharp_annex_provider_body_read": true,
              "shared_address_not_automatic_identity_crosswalk": true,
              "year2019_not_exact_event_date": true,
              "no_duplicate_merge_or_role_changes": true
            }
          },
          "notes": [
            "The complete original Binary Net Sharp Annex body describes present colocation and an acquisition only to the year 2019. It does not independently name the inherited Nebraska Colocation Centers corporate entity or prove that this exact legacy record is the same facility rather than another service at the shared address. A common building and a private old opening article are not an independently established identity crosswalk. The exact inherited current stage stays held and no record, operator role or campus is merged.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://www.binary.net/sharpannex/",
              "host": "www.binary.net",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Lincoln · Lancaster · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31109"
      }
    },
    {
      "id": "starwood-project-horizon-kearney-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Project Horizon (Tech oNE Crossing)",
      "group": "proposed",
      "status": "Company listed proposal",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Buffalo"
      ],
      "city": "Kearney",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.. Starwood/Project Horizon identity is not named in this source and needs crosswalk before adopting developer identity. Proposed 368 MW is ultimate campus electrical demand, not additional to reused 100 MW, critical IT or current load. Council vote was future later September 8 in this account; no outcome assumed. First phase late 2027/full 2030 are forecasts. August zoning ordinance/report’s 55 dB average needs original measurement/time/scope definitions; code adoption is not site CUP. Small separate 5 MW proposal is not this campus. No end-user identity known. Later original decisions and observed outcomes take precedence; future events have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.wowt.com/2026/09/08/kearney-poised-go-all-data-centers-even-many-nebraska-towns-throttle-back/",
          "host": "wowt.com",
          "date": "2026-09-08",
          "published": "2026-09-08",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://www.projecthorizonkearney.com/",
          "host": "www.projecthorizonkearney.com",
          "published": "",
          "date": "",
          "checked": "2026-10-24",
          "label": "Reviewed operator source"
        }
      ],
      "loc": {
        "lat": 40.82718,
        "lng": -99.07269,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round33-2026-10-14.json",
          "scope": "Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.",
          "fields": {
            "reported_context": "Flatwater Free Press reporting republished by WOWT describes Worldwide Mission Critical’s Tech One Crossing proposal to replace a 100 MW Marathon bitcoin mine with eventual 368 MW development under Kearney’s new code.",
            "independently_verified_current_operating_status": null,
            "developer_identity_from_this_source": "Worldwide Mission Critical; Starwood not named here",
            "reported_ultimate_electrical_mw": 368,
            "critical_it_mw": null,
            "reported_retired_mining_power_reuse_mw": 100
          },
          "notes": [
            "Starwood/Project Horizon identity is not named in this source and needs crosswalk before adopting developer identity. Proposed 368 MW is ultimate campus electrical demand, not additional to reused 100 MW, critical IT or current load. Council vote was future later September 8 in this account; no outcome assumed. First phase late 2027/full 2030 are forecasts. August zoning ordinance/report’s 55 dB average needs original measurement/time/scope definitions; code adoption is not site CUP. Small separate 5 MW proposal is not this campus. No end-user identity known.",
            "Later original decisions and observed outcomes take precedence; future events have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.wowt.com/2026/09/08/kearney-poised-go-all-data-centers-even-many-nebraska-towns-throttle-back/",
              "host": "wowt.com",
              "date": "2026-09-08",
              "published": "2026-09-08",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "The complete original project body identifies Project Horizon as a proposed campus at Tech oNE Crossing in Buffalo County. This supports a company listed proposal at the inherited campus scope. Claims about existing adjacent mining power, future phases, planned certification, water savings, noise, rates, jobs and tax revenue are attributed design and future benefit assertions, not commissioned campus capacity or measured outcomes. The page is not independently read City approval or proof that the adjacent mine and proposed campus are the same facility. No organization role, quantity or location is changed.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "project_original_named_horizon_proposal",
              "scope": "The complete original project body identifies Project Horizon as a proposed campus at Tech oNE Crossing in Buffalo County. This supports a company listed proposal at the inherited campus scope. Claims about existing adjacent mining power, future phases, planned certification, water savings, noise, rates, jobs and tax revenue are attributed design and future benefit assertions, not commissioned campus capacity or measured outcomes. The page is not independently read City approval or proof that the adjacent mine and proposed campus are the same facility. No organization role, quantity or location is changed."
            },
            "source_read_scope": {
              "complete_original_current_project_body_read": true,
              "adjacent_existing_mining_not_proposed_campus_operation": true,
              "no_independent_legal_approval_or_measured_environmental_benefit": true,
              "no_capacity_role_or_location_changes": true,
              "no_contact_form_submission": true
            }
          },
          "notes": [
            "The complete original project body identifies Project Horizon as a proposed campus at Tech oNE Crossing in Buffalo County. This supports a company listed proposal at the inherited campus scope. Claims about existing adjacent mining power, future phases, planned certification, water savings, noise, rates, jobs and tax revenue are attributed design and future benefit assertions, not commissioned campus capacity or measured outcomes. The page is not independently read City approval or proof that the adjacent mine and proposed campus are the same facility. No organization role, quantity or location is changed.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://www.projecthorizonkearney.com/",
              "host": "www.projecthorizonkearney.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Kearney · Buffalo · Source context reviewed",
      "status_scope": "The complete original project body identifies Project Horizon as a proposed campus at Tech oNE Crossing in Buffalo County. This supports a company listed proposal at the inherited campus scope. Claims about existing adjacent mining power, future phases, planned certification, water savings, noise, rates, jobs and tax revenue are attributed design and future benefit assertions, not commissioned campus capacity or measured outcomes. The page is not independently read City approval or proof that the adjacent mine and proposed campus are the same facility. No organization role, quantity or location is changed.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31019"
      }
    },
    {
      "id": "sagebrush-hallam-hyperscale-campus-lancaster-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Sagebrush Hallam Hyperscale Campus (proposed)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Lancaster"
      ],
      "city": "Hallam",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.. More than $8 million refers to reported optioned land value, not necessarily option fees paid or completed land acquisitions. Local identification with Sagebrush 1 and 1.7 GW remains attributed and basis undefined, not critical IT or a signed utility agreement. Nearby Sheldon/Princeton generation and pipelines do not establish secured service, permits or operating status. Co-located generation is separate from computing load; no current demand, start or RFS verified. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.1011now.com/2026/08/27/data-center-developers-eyeing-land-near-hallam/",
          "host": "1011now.com",
          "date": "2026-08-27",
          "published": "2026-08-27",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 40.77626,
        "lng": -96.73207,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round32-2026-10-14.json",
          "scope": "Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.",
          "fields": {
            "reported_context": "KOLN reports Sagebrush land options covering more than 1,500 acres near Hallam, with residents linking the location to a Stark investor project.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "More than $8 million refers to reported optioned land value, not necessarily option fees paid or completed land acquisitions. Local identification with Sagebrush 1 and 1.7 GW remains attributed and basis undefined, not critical IT or a signed utility agreement. Nearby Sheldon/Princeton generation and pipelines do not establish secured service, permits or operating status. Co-located generation is separate from computing load; no current demand, start or RFS verified.",
            "Original approvals and later observed outcomes take precedence; future dates have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.1011now.com/2026/08/27/data-center-developers-eyeing-land-near-hallam/",
              "host": "1011now.com",
              "date": "2026-08-27",
              "published": "2026-08-27",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Hallam · Lancaster · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31109"
      }
    },
    {
      "id": "scott-data-center-omaha-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Scott Data Center",
      "group": "operating",
      "status": "Operator listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Douglas"
      ],
      "city": "Omaha",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Scott Data named contact and rack capability scope. Contactaddressmaybetenant/suiteaddress;notverifiedwholebuildingparcel.60pluskWcabinetdesignnotcampusMW. CMMCclientcompliancedependsclientcontrols;operatorpageisnotCMMCcertificationofeverytenant. No numeric totalIT or exact openingdate. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.scottdatacenter.com/data-center/",
          "host": "scottdatacenter.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 41.30231,
        "lng": -96.16239,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "primary-source-review-round9-2026-10-14.json",
          "scope": "Scott Data named contact and rack capability scope",
          "fields": {
            "operator": "Scott Data",
            "operator_described_model": "nonprofit data center founded by Walter Scott Jr.",
            "published_contact_address": "6825 Pine Street, Suite141, Omaha, Nebraska68106",
            "advertised_reference_architecture_kw_per_cabinet_min_exclusive": 60
          },
          "notes": [
            "Contactaddressmaybetenant/suiteaddress;notverifiedwholebuildingparcel.60pluskWcabinetdesignnotcampusMW. CMMCclientcompliancedependsclientcontrols;operatorpageisnotCMMCcertificationofeverytenant. No numeric totalIT or exact openingdate.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.scottdatacenter.com/data-center/",
              "host": "scottdatacenter.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "The complete original current provider body explicitly offers cabinet and rack colocation from its integrated Omaha facility and describes existing customer services. This supports operator listed colocation service. High performance readiness, possible defense contractor support, tier descriptions, future scaling and certification assistance do not independently certify installed AI workloads, government tenants, CMMC compliance or current capacity. No exact first opening is inferred and no quote or contact form was submitted.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "current_provider_named_omaha_colocation",
              "scope": "The complete original current provider body explicitly offers cabinet and rack colocation from its integrated Omaha facility and describes existing customer services. This supports operator listed colocation service. High performance readiness, possible defense contractor support, tier descriptions, future scaling and certification assistance do not independently certify installed AI workloads, government tenants, CMMC compliance or current capacity. No exact first opening is inferred and no quote or contact form was submitted."
            },
            "source_read_scope": {
              "complete_original_current_provider_body_read": true,
              "readiness_not_installed_workload_or_verified_tenant": true,
              "no_tier_cmmc_capacity_or_performance_certification": true,
              "no_contact_or_form_submission": true
            }
          },
          "notes": [
            "The complete original current provider body explicitly offers cabinet and rack colocation from its integrated Omaha facility and describes existing customer services. This supports operator listed colocation service. High performance readiness, possible defense contractor support, tier descriptions, future scaling and certification assistance do not independently certify installed AI workloads, government tenants, CMMC compliance or current capacity. No exact first opening is inferred and no quote or contact form was submitted.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://www.scottdatacenter.com/data-center/",
              "host": "www.scottdatacenter.com",
              "published": "",
              "date": "",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Omaha · Douglas · Source context reviewed",
      "status_scope": "The complete original current provider body explicitly offers cabinet and rack colocation from its integrated Omaha facility and describes existing customer services. This supports operator listed colocation service. High performance readiness, possible defense contractor support, tier descriptions, future scaling and certification assistance do not independently certify installed AI workloads, government tenants, CMMC compliance or current capacity. No exact first opening is inferred and no quote or contact form was submitted.",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31055"
      }
    },
    {
      "id": "sequitor-edge-kearney-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Sequitor Edge Kearney Data Center",
      "group": "proposed",
      "status": "Company listed proposal",
      "raw_status": "proposed",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Buffalo"
      ],
      "city": "Kearney",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Sequitor Kearney proposed site, land sale and LOIs. Approvedlandsaleoperatoraccountnotreadcitysignedcontract/deed. NotallDCpermitsorenergization. NonbindingLOIsnotexecutedleases.40kplannednotcurrentoperatingfloor. No numericITMWoractualcurrentheadcount. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [
        [
          "2025-09-19",
          "The original Sequitor Edge September 19, 2025 release announces its Kearney development proposal and reports parcel sale approval. This is the issuer publication day rather than a verified earlier City vote, completed sale, construction or the forecast early 2027 computing opening."
        ]
      ],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://sequitoredge.com/press/approved-site-for-next-generation-data-center-in-kearney-nebraska/",
          "host": "sequitoredge.com",
          "date": "2025-09-19",
          "published": "2025-09-19",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 40.86834,
        "lng": -99.08969,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-primary-review-round10-2026-10-14.json",
          "scope": "Sequitor Kearney proposed site, land sale and LOIs",
          "fields": {
            "developer": "Sequitor Edge",
            "land_buyer": "Shamrock Data LLC",
            "location": "Tech One Crossing, Kearney, Nebraska",
            "land_sale_approved_acres_approx": 16,
            "planned_facility_sqft": 40000,
            "operator_reported_council_land_sale_approval": "announcedSeptember19,2025",
            "service_target": "early2027",
            "tenant_commitment_stage": "nonbinding letters of intent from local organizations"
          },
          "notes": [
            "Approvedlandsaleoperatoraccountnotreadcitysignedcontract/deed. NotallDCpermitsorenergization. NonbindingLOIsnotexecutedleases.40kplannednotcurrentoperatingfloor. No numericITMWoractualcurrentheadcount.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://sequitoredge.com/press/approved-site-for-next-generation-data-center-in-kearney-nebraska/",
              "host": "sequitoredge.com",
              "date": "2025-09-19",
              "published": "2025-09-19",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 3 research cohort 73",
          "scope": "The complete original September 19, 2025 issuer release identifies the Kearney proposal and reports City approval of a parcel sale for development. This supports a company listed proposal. Its early 2027 service forecast, prospective tenants and nonbinding letters are not computing operation, completed construction or independently verified tenants. The issuer account is not an independently read City deed or a precise earlier Council vote day. Tier and energy claims remain attributed descriptions.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "issuer_named_kearney_development_proposal",
              "scope": "The complete original September 19, 2025 issuer release identifies the Kearney proposal and reports City approval of a parcel sale for development. This supports a company listed proposal. Its early 2027 service forecast, prospective tenants and nonbinding letters are not computing operation, completed construction or independently verified tenants. The issuer account is not an independently read City deed or a precise earlier Council vote day. Tier and energy claims remain attributed descriptions."
            },
            "source_read_scope": {
              "complete_original_issuer_release_body_read": true,
              "publication_not_city_vote_or_deed_completion": true,
              "nonbinding_letters_not_verified_tenants": true,
              "forecast2027_not_operation": true
            }
          },
          "notes": [
            "The complete original September 19, 2025 issuer release identifies the Kearney proposal and reports City approval of a parcel sale for development. This supports a company listed proposal. Its early 2027 service forecast, prospective tenants and nonbinding letters are not computing operation, completed construction or independently verified tenants. The issuer account is not an independently read City deed or a precise earlier Council vote day. Tier and energy claims remain attributed descriptions.",
            "Existing roles, identities, physical placement, jurisdiction assignments, technical quantities and exact first opening days remain unchanged. A document date does not date physical commissioning."
          ],
          "sources": [
            {
              "url": "https://sequitoredge.com/press/approved-site-for-next-generation-data-center-in-kearney-nebraska/",
              "host": "sequitoredge.com",
              "published": "2025-09-19",
              "date": "2025-09-19",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ],
          "checked": "2026-10-24",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Kearney · Buffalo · Source context reviewed",
      "status_scope": "The complete original September 19, 2025 issuer release identifies the Kearney proposal and reports City approval of a parcel sale for development. This supports a company listed proposal. Its early 2027 service forecast, prospective tenants and nonbinding letters are not computing operation, completed construction or independently verified tenants. The issuer account is not an independently read City deed or a precise earlier Council vote day. Tier and energy claims remain attributed descriptions.",
      "event_evidence": [
        {
          "date": "2025-09-19",
          "text": "The original Sequitor Edge September 19, 2025 release announces its Kearney development proposal and reports parcel sale approval. This is the issuer publication day rather than a verified earlier City vote, completed sale, construction or the forecast early 2027 computing opening.",
          "kind": "announced",
          "sources": [
            {
              "url": "https://sequitoredge.com/press/approved-site-for-next-generation-data-center-in-kearney-nebraska/",
              "host": "sequitoredge.com",
              "published": "2025-09-19",
              "date": "2025-09-19",
              "checked": "2026-10-24",
              "label": "Reviewed operator source"
            }
          ]
        }
      ],
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31019"
      }
    },
    {
      "id": "tierpoint-omaha-bellevue-ne",
      "state": "ne",
      "kind": "facility",
      "name": "TierPoint Omaha - Bellevue Data Center",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Sarpy"
      ],
      "city": "Bellevue",
      "address": "",
      "who": "TierPoint",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Listed MW/kW values describe emergency generators. No critical IT or measured grid-load value is established by this specification. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.tierpoint.com/data-centers/nebraska/omaha-bellevue/",
          "host": "tierpoint.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1001+North+Fort+Crook+Road%2C+Bellevue%2C+NE+68005&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/",
          "host": "www.tierpoint.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "TierPoint facility navigation links and separate corporate headquarters section"
        }
      ],
      "loc": {
        "lat": 41.176828667585,
        "lng": -95.926408470456,
        "precision": "address",
        "basis": "Published TierPoint facility address 1001 North Fort Crook Road, Bellevue, NE 68005 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-specifications-round3-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "gross_area_sqft": 100000,
            "gross_area_is_lower_bound": true,
            "raised_floor_sqft": 21000,
            "raised_floor_is_lower_bound": true,
            "backup_generator_configuration_source_statement": "Five redundant generators totaling 5.5 MW",
            "current_operator_listing": "Operator currently advertises the named facility and services. This is an operator statement, not a site inspection or uptime measurement."
          },
          "notes": [
            "Listed MW/kW values describe emergency generators. No critical IT or measured grid-load value is established by this specification.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.tierpoint.com/data-centers/nebraska/omaha-bellevue/",
              "host": "tierpoint.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "TierPoint lists colocation and managed services at its Omaha - Bellevue Data Center location. This supports an operator-listed colocation service label, not an opening date, full energized capacity, independently verified certification, legal ownership or a surveyed parcel.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "TierPoint lists colocation and managed services at its Omaha - Bellevue Data Center location. This supports an operator-listed colocation service label, not an opening date, full energized capacity, independently verified certification, legal ownership or a surveyed parcel."
            }
          },
          "notes": [
            "Named main-body introduction, current product-availability passage and physical-location block. Promotional guarantees, technical totals and certifications were not adopted."
          ],
          "sources": [
            {
              "url": "https://www.tierpoint.com/data-centers/nebraska/omaha-bellevue/",
              "host": "www.tierpoint.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 5, October 22, 2026",
          "scope": "Published operator street reference only. No canonical address, status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 41.176828667585,
                "lng": -95.926408470456,
                "precision": "address",
                "basis": "Published TierPoint facility address 1001 North Fort Crook Road, Bellevue, NE 68005 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "1001 North Fort Crook Road, Bellevue, NE 68005",
              "county_fips": [
                "31153"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named facility address section supplies the street and locality. The corporate headquarters footer is excluded. The published facility address is retained as location evidence; the existing blank canonical address field is not changed in this location only transaction.",
            "The source facility page and its current navigation link identify the same existing research record. A regional market name does not replace the published locality or county. The existing service status, physical dates, technical figures, organizations and jurisdiction wrappers remain exact.",
            "The previous point is explicitly an inherited general area reference without a verified street or parcel. The current TierPoint facility section Omaha - Bellevue (BEL) publishes 1001 North Fort Crook Road, Bellevue, NE 68005. Its unique Census street range and retained county polygon agree with the existing county. This 2652.3 meter move replaces that unsupported general area reference with a calculated street address reference. It does not certify a roof, full campus boundary, ownership or physical milestone."
          ],
          "sources": [
            {
              "url": "https://www.tierpoint.com/data-centers/nebraska/omaha-bellevue/",
              "host": "www.tierpoint.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "TierPoint named facility address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1001+North+Fort+Crook+Road%2C+Bellevue%2C+NE+68005&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/",
              "host": "www.tierpoint.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "TierPoint facility navigation links and separate corporate headquarters section"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "K3 sourced operator roles October 22, 2026",
          "scope": "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted.",
          "fields": {
            "company_association": {
              "name": "TierPoint",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted."
            },
            "provider_role": "operator"
          },
          "notes": [
            "Operator relationship attributed to the named facility page published by TierPoint. This identifies the provider brand, not a legal property owner. No new status, service date, address, map reference, capacity or current physical milestone is adopted.",
            "Source retrieval is not an opening or operating date."
          ],
          "sources": [
            {
              "url": "https://www.tierpoint.com/data-centers/nebraska/omaha-bellevue/",
              "host": "www.tierpoint.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Reviewed operator identity source"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Bellevue · Sarpy · Source context reviewed",
      "status_scope": "TierPoint lists colocation and managed services at its Omaha - Bellevue Data Center location. This supports an operator-listed colocation service label, not an opening date, full energized capacity, independently verified certification, legal ownership or a surveyed parcel."
    },
    {
      "id": "tierpoint-omaha-midlands-papillion-ne",
      "state": "ne",
      "kind": "facility",
      "name": "TierPoint Omaha - Midlands Data Center",
      "group": "operating",
      "status": "Operator-listed colocation service",
      "raw_status": "operating",
      "status_field": "current_status",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Sarpy"
      ],
      "city": "Papillion",
      "address": "",
      "who": "TierPoint",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Listed MW/kW values describe emergency generators. No critical IT or measured grid-load value is established by this specification. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.tierpoint.com/data-centers/nebraska/omaha-midlands/",
          "host": "tierpoint.com",
          "date": "",
          "published": "",
          "checked": "2026-10-14",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=11425+South+84th+Street%2C+Papillion%2C+NE+68046&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census calculated street range and county context"
        },
        {
          "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
          "host": "geocoding.geo.census.gov",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "Census address range method and limits"
        },
        {
          "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/",
          "host": "www.tierpoint.com",
          "published": "",
          "date": "",
          "checked": "2026-10-22",
          "label": "TierPoint facility navigation links and separate corporate headquarters section"
        }
      ],
      "loc": {
        "lat": 41.137543481737,
        "lng": -96.042858912916,
        "precision": "address",
        "basis": "Published TierPoint facility address 11425 South 84th Street, Papillion, NE 68046 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding."
      },
      "reviewed_evidence": [
        {
          "overlay": "operator-specifications-round3-2026-10-14.json",
          "scope": "Field or source context only",
          "fields": {
            "gross_area_sqft": 63000,
            "gross_area_is_lower_bound": true,
            "raised_floor_sqft": 15000,
            "raised_floor_is_lower_bound": true,
            "backup_generator_configuration_source_statement": "Two 2.25 MW redundant generators",
            "current_operator_listing": "Operator currently advertises the named facility and services. This is an operator statement, not a site inspection or uptime measurement."
          },
          "notes": [
            "Listed MW/kW values describe emergency generators. No critical IT or measured grid-load value is established by this specification.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.tierpoint.com/data-centers/nebraska/omaha-midlands/",
              "host": "tierpoint.com",
              "date": "",
              "published": "",
              "checked": "2026-10-14",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "orchestra-status-2026-10-19",
          "scope": "TierPoint lists current colocation and managed-service availability at its named Midlands facility in Papillion. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.",
          "fields": {
            "current_stage_evidence": {
              "outcome": "operator_listed_colocation_service",
              "scope": "TierPoint lists current colocation and managed-service availability at its named Midlands facility in Papillion. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
            }
          },
          "notes": [
            "TierPoint lists current colocation and managed-service availability at its named Midlands facility in Papillion."
          ],
          "sources": [
            {
              "url": "https://www.tierpoint.com/data-centers/nebraska/omaha-midlands/",
              "host": "www.tierpoint.com",
              "published": "",
              "date": "",
              "checked": "2026-10-19",
              "label": "Operator source for the qualified stage"
            }
          ],
          "checked": "2026-10-19",
          "whole_record_certified": false
        },
        {
          "overlay": "Codex 2 location cohort 5, October 22, 2026",
          "scope": "Published operator street reference only. No canonical address, status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.",
          "fields": {
            "location_review_decision": {
              "location": {
                "lat": 41.137543481737,
                "lng": -96.042858912916,
                "precision": "address",
                "basis": "Published TierPoint facility address 11425 South 84th Street, Papillion, NE 68046 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding."
              },
              "reference_method": "Census interpolated street address",
              "published_address": "11425 South 84th Street, Papillion, NE 68046",
              "county_fips": [
                "31153"
              ],
              "operator_coordinates_adopted": false,
              "corporate_address_adopted": false
            }
          },
          "notes": [
            "The named facility address section supplies the street and locality. The corporate headquarters footer is excluded. The published facility address is retained as location evidence; the existing blank canonical address field is not changed in this location only transaction.",
            "The source facility page and its current navigation link identify the same existing research record. A regional market name does not replace the published locality or county. The existing service status, physical dates, technical figures, organizations and jurisdiction wrappers remain exact.",
            "The previous point is explicitly an inherited general area reference without a verified street or parcel. The current TierPoint facility section Omaha - Midlands (MID) publishes 11425 South 84th Street, Papillion, NE 68046. Its unique Census street range and retained county polygon agree with the existing county. This 3074.0 meter move replaces that unsupported general area reference with a calculated street address reference. It does not certify a roof, full campus boundary, ownership or physical milestone."
          ],
          "sources": [
            {
              "url": "https://www.tierpoint.com/data-centers/nebraska/omaha-midlands/",
              "host": "www.tierpoint.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "TierPoint named facility address section"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=11425+South+84th+Street%2C+Papillion%2C+NE+68046&benchmark=Public_AR_Current&vintage=Current_Current&format=json",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census calculated street range and county context"
            },
            {
              "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html",
              "host": "geocoding.geo.census.gov",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "Census address range method and limits"
            },
            {
              "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/",
              "host": "www.tierpoint.com",
              "published": "",
              "date": "",
              "checked": "2026-10-22",
              "label": "TierPoint facility navigation links and separate corporate headquarters section"
            }
          ],
          "checked": "2026-10-22",
          "whole_record_certified": false
        },
        {
          "overlay": "Company role source check 06, October 23, 2026",
          "scope": "TierPoint presents this named facility as part of its own colocation service network on its first party facility page. Operator is the attributed provider brand role, not an independently established legal operating entity or property owner. No status, location, physical date, technical figure, certification or environmental outcome is promoted.",
          "fields": {
            "company_association": {
              "name": "TierPoint",
              "role": "operator",
              "identity_scope": "provider_brand_only",
              "scope": "TierPoint presents this named facility as part of its own colocation service network on its first party facility page. Operator is the attributed provider brand role, not an independently established legal operating entity or property owner. No status, location, physical date, technical figure, certification or environmental outcome is promoted."
            },
            "provider_role": "operator"
          },
          "notes": [
            "TierPoint presents this named facility as part of its own colocation service network on its first party facility page. Operator is the attributed provider brand role, not an independently established legal operating entity or property owner. No status, location, physical date, technical figure, certification or environmental outcome is promoted.",
            "Source dates remain separate from physical milestones and the retained status field."
          ],
          "sources": [
            {
              "url": "https://www.tierpoint.com/data-centers/nebraska/omaha-midlands/",
              "host": "www.tierpoint.com",
              "published": "",
              "date": "",
              "checked": "2026-10-23",
              "label": "First party named facility page, reviewed named service or development context"
            }
          ],
          "checked": "2026-10-23",
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Published address reference, not a surveyed building or parcel",
      "summary": "Papillion · Sarpy · Source context reviewed",
      "status_scope": "TierPoint lists current colocation and managed-service availability at its named Midlands facility in Papillion. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy."
    },
    {
      "id": "travelers-data-center-sarpy-ne",
      "state": "ne",
      "kind": "facility",
      "name": "Travelers Data Center (Project Oasis)",
      "group": "unknown",
      "status": "Status unclear",
      "raw_status": "",
      "status_field": "",
      "crypto": false,
      "type": "Data center (inventory classification)",
      "counties": [
        "Sarpy"
      ],
      "city": "",
      "address": "",
      "who": "",
      "end_user": "",
      "mw": null,
      "power": "",
      "power_note": "",
      "investment": "",
      "jobs": "",
      "acres": null,
      "utility": "",
      "water": "",
      "incentives": "",
      "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.. Historical opening announcement is not 2026 operating certification.4 MW basis is unspecified, not independently verified critical IT; TierIII claim is not independently checked Uptime certification.140 acreacquisition,41 acrefacilityparcel,92 acresfutureland and 5 acreOPPDsubstation are overlapping parent/subparcel scopes, not additive holdings. State site/building/job-training funds approved but no amount or disbursement verified. Infrastructure contributions and substation cost are not site-capital/tax-benefit totals. No exact physical completion day inferred beyond dated announcement. Later original decisions and observed outcomes take precedence; future events have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Original annual report visibly read; self-reported period, redactions and number definitions control.. Report claims Tier III and Energy Star 98; no independent certificate checked. Report states none for listed sales/use exemptions, listed incentive payments and renewable commitments, without proving all tax benefits or physical power mix. Service-life text includes a question mark after 100 years; no certain design life or closure date adopted. This reporting period differs from the calendar2025 Meta/MARA data; no cross-site total or ranking derived. Not all-field or current operating-building certification.",
      "date": "",
      "events": [],
      "timeline": [],
      "opened": "",
      "tier": "",
      "sources": [
        {
          "url": "https://www.tradeandindustrydev.com/industry/back-office-call-centers-data-centers/news/ne-travelers-cuts-ribbon-new-data-center-sarpy-c",
          "host": "tradeandindustrydev.com",
          "date": "2015-05-13",
          "published": "2015-05-13",
          "checked": "2026-10-14",
          "date_kind": "publication",
          "label": "Reviewed source"
        },
        {
          "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/AY09VhpYXkD6EN57RKIaU25viqt7O0s9sx9vOIsV%C3%89nA%C3%89yzXAzBbOqvuMT1piq9LHPbWAmVRc%C3%81y3mfDrhFs6Xi9A%3D/",
          "host": "ecmp.nebraska.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        },
        {
          "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/AcFfh0ETS7vgXZ9Qf0jnqiM7UM%C3%899vkIEandSZ8JEc%C3%89rkP5vyukBQjTMobL08opvN64wF3ufApa8r0DGBinWQzXQ%3D/",
          "host": "ecmp.nebraska.gov",
          "date": "",
          "published": "",
          "checked": "2026-10-15",
          "date_kind": "publication date not established",
          "label": "Reviewed source"
        }
      ],
      "loc": {
        "lat": 41.11975,
        "lng": -96.11896,
        "precision": "county",
        "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel."
      },
      "reviewed_evidence": [
        {
          "overlay": "regional-development-review-round33-2026-10-14.json",
          "scope": "Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.",
          "fields": {
            "reported_context": "Trade & Industry Development carries a state/economic-development announcement of Travelers’ Sarpy County ribbon cutting for a 183,000-square-foot facility described as TierIII 4 MW.",
            "independently_verified_current_operating_status": null
          },
          "notes": [
            "Historical opening announcement is not 2026 operating certification.4 MW basis is unspecified, not independently verified critical IT; TierIII claim is not independently checked Uptime certification.140 acreacquisition,41 acrefacilityparcel,92 acresfutureland and 5 acreOPPDsubstation are overlapping parent/subparcel scopes, not additive holdings. State site/building/job-training funds approved but no amount or disbursement verified. Infrastructure contributions and substation cost are not site-capital/tax-benefit totals. No exact physical completion day inferred beyond dated announcement.",
            "Later original decisions and observed outcomes take precedence; future events have no assumed result.",
            "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building."
          ],
          "sources": [
            {
              "url": "https://www.tradeandindustrydev.com/industry/back-office-call-centers-data-centers/news/ne-travelers-cuts-ribbon-new-data-center-sarpy-c",
              "host": "tradeandindustrydev.com",
              "date": "2015-05-13",
              "published": "2015-05-13",
              "checked": "2026-10-14",
              "date_kind": "publication",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        },
        {
          "overlay": "nebraska-annual-reports-visible-review-round51-2026-10-15.json",
          "scope": "Original annual report visibly read; self-reported period, redactions and number definitions control.",
          "fields": {},
          "notes": [
            "Report claims Tier III and Energy Star 98; no independent certificate checked.",
            "Report states none for listed sales/use exemptions, listed incentive payments and renewable commitments, without proving all tax benefits or physical power mix.",
            "Service-life text includes a question mark after 100 years; no certain design life or closure date adopted.",
            "This reporting period differs from the calendar2025 Meta/MARA data; no cross-site total or ranking derived.",
            "Not all-field or current operating-building certification."
          ],
          "sources": [
            {
              "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/AY09VhpYXkD6EN57RKIaU25viqt7O0s9sx9vOIsV%C3%89nA%C3%89yzXAzBbOqvuMT1piq9LHPbWAmVRc%C3%81y3mfDrhFs6Xi9A%3D/",
              "host": "ecmp.nebraska.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            },
            {
              "url": "https://ecmp.nebraska.gov/PublicAccess/api/Document/AcFfh0ETS7vgXZ9Qf0jnqiM7UM%C3%899vkIEandSZ8JEc%C3%89rkP5vyukBQjTMobL08opvN64wF3ufApa8r0DGBinWQzXQ%3D/",
              "host": "ecmp.nebraska.gov",
              "date": "",
              "published": "",
              "checked": "2026-10-15",
              "date_kind": "publication date not established",
              "label": "Reviewed source"
            }
          ],
          "whole_record_certified": false
        }
      ],
      "manual_source_reviewed": true,
      "whole_record_certified": false,
      "field_evidence_present": true,
      "inventory_label_retained": true,
      "precision_label": "Exact site not published; shown at county level",
      "summary": "Sarpy · Source context reviewed",
      "location_display": {
        "policy": "reviewed-map-references-2026-10-23",
        "decision": "withheld_unreviewed_point",
        "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.",
        "county_display": "31153"
      }
    }
  ],
  "compilation_license": "withheld_pending_owner_decision"
}