{ "schema_version": 1, "source_compilation_context": { "oh": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/oh.json", "updated": "2026-10-24" } }, "scope": "Source compiled state collection. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.", "collection": { "kind": "states", "key": "oh", "label": "Ohio" }, "records": [ { "id": "5c-group-vultr-prime-ohio-springfield-oh", "state": "oh", "kind": "facility", "name": "5C Group / Vultr Data Center (Prime Ohio)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Clark" ], "city": "Springfield", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. City publishes answers supplied by the developer. No measured consumption or operational start is established. Peak extreme-heat water figure is not typical daily or annual use; the source does not define 150 MW as critical IT. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://springfieldohio.gov/5c-data-center-faqs/", "host": "springfieldohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.91662, "lng": -83.7844, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "design_maximum_electrical_load_mw_up_to": 150, "forecast_investment_usd_up_to": 1300000000, "forecast_permanent_full_time_jobs": 120, "extreme_heat_theoretical_max_water_gallons_per_day": 300000 }, "notes": [ "City publishes answers supplied by the developer. No measured consumption or operational start is established. Peak extreme-heat water figure is not typical daily or annual use; the source does not define 150 MW as critical IT.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://springfieldohio.gov/5c-data-center-faqs/", "host": "springfieldohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 10", "scope": "The city FAQ says its answers were provided by 5C in response to residents questions. It distinguishes existing generators from a planned expansion and describes infrastructure conditions before operations. These are agency published company statements, not an independently verified opening, current operating load, water demand, permit compliance or a new Vultr tenant certification.", "fields": { "current_stage_evidence": { "outcome": "agency_published_company_answers_current_stage_held", "scope": "The city FAQ says its answers were provided by 5C in response to residents questions. It distinguishes existing generators from a planned expansion and describes infrastructure conditions before operations. These are agency published company statements, not an independently verified opening, current operating load, water demand, permit compliance or a new Vultr tenant certification." }, "response_attribution": { "published_by": "City of Springfield", "answers_provided_by": "5C Data Center", "independent_agency_verification_claimed": false, "planned_and_existing_equipment_kept_separate": true, "usage_and_jobs_not_adopted_as_observed_quantities": true, "inherited_tenant_relationship_newly_certified": false } }, "notes": [ "The city FAQ says its answers were provided by 5C in response to residents questions. It distinguishes existing generators from a planned expansion and describes infrastructure conditions before operations. These are agency published company statements, not an independently verified opening, current operating load, water demand, permit compliance or a new Vultr tenant certification.", "No campus total, service offer or approval is converted into an observed operating capacity, exact site point or verified opening day." ], "sources": [ { "url": "https://springfieldohio.gov/5c-data-center-faqs/", "host": "springfieldohio.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed government record" } ], "checked": "2026-10-22", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Springfield · Clark · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39023" } }, { "id": "aligned-pataskala-licking-oh", "state": "oh", "kind": "facility", "name": "Aligned Data Centers - Pataskala", "group": "proposed", "status": "Operator listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "Pataskala", "address": "", "who": "Aligned Data Centers", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Neither recommendation is council decision; August 25 hearing andJuly 6 petition submission were future.200 MWbasis is undefined, not criticalIT/currentload or an executed electricity agreement. Fuel-cell/closed-loop claims are proposed design, not hydrogen supply contract or zero-water guarantee.110 jobs andJEDDincome-tax estimates are forecasts;300,000 dollarpostconstructionperiod is not explicit annual revenue. Four-to-three redesign is not sevenbuildings. Proposedcharter 25 MWthreshold is not adopted law. Directory 139 regional/224 statecounts are not independently verified operating census. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.aol.com/articles/pataskala-allow-data-center-industrial-180844000.html", "host": "aol.com", "date": "2026-06-30", "published": "2026-06-30", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://aligneddc.com/pataskala-oh-data-center/", "host": "aligneddc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.09155, "lng": -82.48306, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "NewarkAdvocate viaAOL reports Aligned’s revised three-building 89-acre Pataskala 200 MWproposal with staff recommendation in favor but planning commission 5 to 2 recommendation to reject.", "independently_verified_current_operating_status": null }, "notes": [ "Neither recommendation is council decision; August 25 hearing andJuly 6 petition submission were future.200 MWbasis is undefined, not criticalIT/currentload or an executed electricity agreement. Fuel-cell/closed-loop claims are proposed design, not hydrogen supply contract or zero-water guarantee.110 jobs andJEDDincome-tax estimates are forecasts;300,000 dollarpostconstructionperiod is not explicit annual revenue. Four-to-three redesign is not sevenbuildings. Proposedcharter 25 MWthreshold is not adopted law. Directory 139 regional/224 statecounts are not independently verified operating census.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.aol.com/articles/pataskala-allow-data-center-industrial-180844000.html", "host": "aol.com", "date": "2026-06-30", "published": "2026-06-30", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 19", "scope": "Aligned current Pataskala page describes a proposed campus and proposed site plan. Operator listed development describes that proposal only. Cooling, jobs and dedicated power infrastructure are company plans or commitments, not measured effects, delivered utility capacity, completed construction or operation. No exact construction start, current permit or opening day is established.", "fields": { "current_stage_evidence": { "outcome": "current_operator_proposal_not_accomplished_construction", "scope": "Aligned current Pataskala page describes a proposed campus and proposed site plan. Operator listed development describes that proposal only. Cooling, jobs and dedicated power infrastructure are company plans or commitments, not measured effects, delivered utility capacity, completed construction or operation. No exact construction start, current permit or opening day is established." } }, "notes": [ "Aligned current Pataskala page describes a proposed campus and proposed site plan. Operator listed development describes that proposal only. Cooling, jobs and dedicated power infrastructure are company plans or commitments, not measured effects, delivered utility capacity, completed construction or operation. No exact construction start, current permit or opening day is established.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://aligneddc.com/pataskala-oh-data-center/", "host": "aligneddc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check 13, October 23, 2026", "scope": "Aligned Data Centers describes development of this named campus in its own source. Developer is the attributed provider brand relationship, not proof of current construction, completed works, operating service, legal ownership or a confirmed parcel. No status, location, physical date, quantity or environmental outcome is promoted.", "fields": { "company_association": { "name": "Aligned Data Centers", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Aligned Data Centers describes development of this named campus in its own source. Developer is the attributed provider brand relationship, not proof of current construction, completed works, operating service, legal ownership or a confirmed parcel. No status, location, physical date, quantity or environmental outcome is promoted." }, "provider_role": "developer" }, "notes": [ "Aligned Data Centers describes development of this named campus in its own source. Developer is the attributed provider brand relationship, not proof of current construction, completed works, operating service, legal ownership or a confirmed parcel. No status, location, physical date, quantity or environmental outcome is promoted.", "Source dates remain separate from physical milestones and the retained status field." ], "sources": [ { "url": "https://aligneddc.com/pataskala-oh-data-center/", "host": "aligneddc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact named code or campus text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Pataskala · Licking · Source context reviewed", "status_scope": "Aligned current Pataskala page describes a proposed campus and proposed site plan. Operator listed development describes that proposal only. Cooling, jobs and dedicated power infrastructure are company plans or commitments, not measured effects, delivered utility capacity, completed construction or operation. No exact construction start, current permit or opening day is established.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "aligned-conesville-oh", "state": "oh", "kind": "facility", "name": "Aligned Data Centers - Conesville Industrial Park", "group": "proposed", "status": "Operator-announced development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Coshocton" ], "city": "Conesville", "address": "", "who": "Aligned Data Centers", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Multi-billion wording supplies no exact investment amount; no MW in release. Past target does not establish delivered. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. TIF is not no taxes; future capacity/opening are not delivered. Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://aligneddc.com/press-release/aligned-data-centers-expands-in-ohio-with-new-mega-scale-ai-campus/", "host": "aligneddc.com", "date": "2025-07-24", "published": "2025-07-24", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://athensindependent.com/data-centers-across-appalachian-ohio/", "host": "athensindependent.com", "date": "2026-08-06", "published": "2026-08-06", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 40.30172, "lng": -81.92013, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "remaining-operators-review-round5-2026-10-14.json", "scope": "named operator source", "fields": { "planned_development_acres": 197, "initial_capacity_delivery_target": "mid2026", "initial_customer_status": "foundational customer secured at announcement" }, "notes": [ "Multi-billion wording supplies no exact investment amount; no MW in release. Past target does not establish delivered.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://aligneddc.com/press-release/aligned-data-centers-expands-in-ohio-with-new-mega-scale-ai-campus/", "host": "aligneddc.com", "date": "2025-07-24", "published": "2025-07-24", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Conesville Aligned Data Centers project described separately, including tax-increment arrangement and future opening.", "independently_verified_current_operating_status": null }, "notes": [ "TIF is not no taxes; future capacity/opening are not delivered.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://athensindependent.com/data-centers-across-appalachian-ohio/", "host": "athensindependent.com", "date": "2026-08-06", "published": "2026-08-06", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "status-continuation-2026-10-19", "scope": "Aligned announces planned development of a data center campus inside Conesville Industrial Park.", "fields": { "current_stage_evidence": { "outcome": "operator_announced_development", "scope": "Aligned announces planned development of a data center campus inside Conesville Industrial Park." } }, "notes": [ "The original delivery target has passed, but a target is not a completion report. Current commissioning and an exact physical-stage date remain unestablished." ], "sources": [ { "url": "https://aligneddc.com/press-release/aligned-data-centers-expands-in-ohio-with-new-mega-scale-ai-campus/", "host": "aligneddc.com", "published": "2025-07-24", "date": "2025-07-24", "checked": "2026-10-19", "label": "Original source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Company role source check 13, October 23, 2026", "scope": "Aligned Data Centers describes development of this named campus in its own source. Developer is the attributed provider brand relationship, not proof of current construction, completed works, operating service, legal ownership or a confirmed parcel. No status, location, physical date, quantity or environmental outcome is promoted. The July 24, 2025 announcement reports planned development and a mid 2026 target. The target is not adopted as an event that happened or a current service date.", "fields": { "company_association": { "name": "Aligned Data Centers", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Aligned Data Centers describes development of this named campus in its own source. Developer is the attributed provider brand relationship, not proof of current construction, completed works, operating service, legal ownership or a confirmed parcel. No status, location, physical date, quantity or environmental outcome is promoted. The July 24, 2025 announcement reports planned development and a mid 2026 target. The target is not adopted as an event that happened or a current service date." }, "provider_role": "developer" }, "notes": [ "Aligned Data Centers describes development of this named campus in its own source. Developer is the attributed provider brand relationship, not proof of current construction, completed works, operating service, legal ownership or a confirmed parcel. No status, location, physical date, quantity or environmental outcome is promoted. The July 24, 2025 announcement reports planned development and a mid 2026 target. The target is not adopted as an event that happened or a current service date.", "Source dates remain separate from physical milestones and the retained status field." ], "sources": [ { "url": "https://aligneddc.com/press-release/aligned-data-centers-expands-in-ohio-with-new-mega-scale-ai-campus/", "host": "aligneddc.com", "published": "2025-07-24", "date": "2025-07-24", "checked": "2026-10-23", "label": "First party exact named code or campus text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Conesville · Coshocton · Source context reviewed", "status_scope": "Aligned announces planned development of a data center campus inside Conesville Industrial Park.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39031" } }, { "id": "aligned-chillicothe-ross-oh", "state": "oh", "kind": "facility", "name": "Aligned HPC Campus at Former Pixelle Paper Mill (Chillicothe)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Ross" ], "city": "Chillicothe", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Canonical operator identity stays unresolved; no transfer of Aligned Data Centers portfolio facts. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Company announcement; partner name does not establish identity as Aligned Data Centers.. Glove and aircraft jobs/revenues belong to other proposed campus activities. No final tenant, construction, AMD supply contract or current operations independently established.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://athensindependent.com/data-centers-across-appalachian-ohio/", "host": "athensindependent.com", "date": "2026-08-06", "published": "2026-08-06", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://members.chillicotheohio.com/news/Details/u-s-paper-mill-plans-to-turn-former-pixelle-site-into-multi-industry-hub-341762", "host": "members.chillicotheohio.com", "date": "2026-07-02", "published": "2026-07-02", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 39.33745, "lng": -83.05742, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "operator_identity_hold": true, "verified_operator_name": null, "reported_context": "Publisher August12 correction says Chillicothe company named Aligned is not Aligned Data Centers.", "independently_verified_current_operating_status": null }, "notes": [ "Canonical operator identity stays unresolved; no transfer of Aligned Data Centers portfolio facts.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://athensindependent.com/data-centers-across-appalachian-ohio/", "host": "athensindependent.com", "date": "2026-08-06", "published": "2026-08-06", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Company announcement; partner name does not establish identity as Aligned Data Centers.", "fields": { "announcement_date": "2026-07-02", "publisher_author": "US Paper Mill Company LLC via chamber", "anticipated_hpc_investment_usd": 1500000000, "named_computing_partner": "Aligned", "verified_legal_operator_identity": null }, "notes": [ "Glove and aircraft jobs/revenues belong to other proposed campus activities. No final tenant, construction, AMD supply contract or current operations independently established.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://members.chillicotheohio.com/news/Details/u-s-paper-mill-plans-to-turn-former-pixelle-site-into-multi-industry-hub-341762", "host": "members.chillicotheohio.com", "date": "2026-07-02", "published": "2026-07-02", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Chillicothe · Ross · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39141" } }, { "id": "aligned-neo-01-oh", "state": "oh", "kind": "facility", "name": "Aligned NEO-01", "group": "operating", "status": "Operator-listed service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Erie" ], "city": "Sandusky (Perkins Township)", "address": "", "who": "Aligned Data Centers", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. The same page separately describes 197-acre CMH-02 in Conesville. Generator 3 MW and UPS 2 MW are component ratings, not campus power. Design standard is not verified Uptime certification. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://aligneddc.com/northeast-ohio-data-centers/", "host": "aligneddc.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2509+Hayes+Ave.%2C+Sandusky%2C+OH+44870&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Calculated Census street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-82.72051682205779%2C41.42728173355953%2C-82.71212989822621%2C41.43356991178447&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Aerial setting only, acquisition date unknown" } ], "loc": { "lng": -82.716323360142, "lat": 41.430425822672, "precision": "address", "basis": "Published Aligned facility address 2509 Hayes Ave., Sandusky, OH 44870 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "published_address": "2509 Hayes Ave., Sandusky, OH 44870", "campus_acres": 129, "advertised_design": "Tier III standards" }, "notes": [ "The same page separately describes 197-acre CMH-02 in Conesville. Generator 3 MW and UPS 2 MW are component ratings, not campus power. Design standard is not verified Uptime certification.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://aligneddc.com/northeast-ohio-data-centers/", "host": "aligneddc.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 10", "scope": "The current Aligned page lists NEO01 as a named data center with continuous access and service features. Operator listed service describes this current commercial offering. It does not certify all capacity, tenant occupancy, an opening day or the performance of every other facility listed on the regional page.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_service", "scope": "The current Aligned page lists NEO01 as a named data center with continuous access and service features. Operator listed service describes this current commercial offering. It does not certify all capacity, tenant occupancy, an opening day or the performance of every other facility listed on the regional page." } }, "notes": [ "The current Aligned page lists NEO01 as a named data center with continuous access and service features. Operator listed service describes this current commercial offering. It does not certify all capacity, tenant occupancy, an opening day or the performance of every other facility listed on the regional page.", "No campus total, service offer or approval is converted into an observed operating capacity, exact site point or verified opening day." ], "sources": [ { "url": "https://aligneddc.com/northeast-ohio-data-centers/", "host": "aligneddc.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 19, October 23, 2026", "scope": "Current official facility street reference only. Native protected facts and canonical address remain exact.", "fields": { "location_review_decision": { "location": { "lng": -82.716323360142, "lat": 41.430425822672, "precision": "address", "basis": "Published Aligned facility address 2509 Hayes Ave., Sandusky, OH 44870 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "2509 Hayes Ave., Sandusky, OH 44870", "county_fips": [ "39043" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named official numeric facility section binds the service address to this existing research record. Corporate offices, related facility cards and embedded map coordinates are excluded.", "The unique Census calculated street range agrees with the retained state and county. Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. The reference does not locate a surveyed roof, parcel, full campus, legal owner, floor or suite.", "All canonical address, status, physical dates, quantity, role, identity and jurisdiction wrappers remain exact. The retained Census method source keeps its actual October 22 date; new captures are dated October 23." ], "sources": [ { "url": "https://aligneddc.com/northeast-ohio-data-centers/", "host": "aligneddc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Official named NEO-01 numeric facility address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=2509+Hayes+Ave.%2C+Sandusky%2C+OH+44870&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Calculated Census street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-82.72051682205779%2C41.42728173355953%2C-82.71212989822621%2C41.43356991178447&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Aerial setting only, acquisition date unknown" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check 13, October 23, 2026", "scope": "Aligned Data Centers explicitly lists this named code or campus in its own location portfolio. Operator is the attributed provider brand relationship, not an independently established legal entity, property owner or commissioning finding for every phase. Listed availability, design standards and service guarantees do not prove delivered power or current operation. No status, location, physical date, technical quantity or environmental outcome is promoted. Only the NEO-01 section supports this relationship; the separate CMH-02 Conesville campus is not merged or transferred.", "fields": { "company_association": { "name": "Aligned Data Centers", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Aligned Data Centers explicitly lists this named code or campus in its own location portfolio. Operator is the attributed provider brand relationship, not an independently established legal entity, property owner or commissioning finding for every phase. Listed availability, design standards and service guarantees do not prove delivered power or current operation. No status, location, physical date, technical quantity or environmental outcome is promoted. Only the NEO-01 section supports this relationship; the separate CMH-02 Conesville campus is not merged or transferred." }, "provider_role": "operator" }, "notes": [ "Aligned Data Centers explicitly lists this named code or campus in its own location portfolio. Operator is the attributed provider brand relationship, not an independently established legal entity, property owner or commissioning finding for every phase. Listed availability, design standards and service guarantees do not prove delivered power or current operation. No status, location, physical date, technical quantity or environmental outcome is promoted. Only the NEO-01 section supports this relationship; the separate CMH-02 Conesville campus is not merged or transferred.", "Source dates remain separate from physical milestones and the retained status field." ], "sources": [ { "url": "https://aligneddc.com/northeast-ohio-data-centers/", "host": "aligneddc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact named code or campus text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Sandusky (Perkins Township) · Erie · Source context reviewed", "status_scope": "The current Aligned page lists NEO01 as a named data center with continuous access and service features. Operator listed service describes this current commercial offering. It does not certify all capacity, tenant occupancy, an opening day or the performance of every other facility listed on the regional page." }, { "id": "amazon-perry-township-stark-oh", "state": "oh", "kind": "facility", "name": "Amazon Perry Township Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Stark" ], "city": "Canton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. IdeastreamApr15,2026originalreportnamesPanattoni240MWundefinedproposalFaircrestSW/KropfPerryTownshipStarkCounty100+ac. Openhouseeventnotapproval;noAmazontenantidentifiedinthissource.16qualifiedsmallbusinessesnot16permanentjobs. Health/noiseconcernsandquietestneighborpledgenotmeasuredcausality/compliance. Petitionseeking>25MWstateban notenactedlaw. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations. News5June25,2026report saysStarkRegionalPlanningCommissionapprovedPerryTownshipsite;scopeofapprovaloriginalnotreadanddoesnotprovebuildingpermit/RFS. SeparateCantonTownshipmoratoriumandCantonCityMillerton/Orchardviewproposals notsamejurisdiction/site. RelatedPerryVILLAGE/LakeCountyarticleisdistinct.18000signaturecomforttargetnotactualcollectedsignatures;ballotinitiativefuture,notcurrentstateban. Amazonidentitynotestablishedhere.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.ideastream.org/environment-energy/2026-04-15/some-stark-county-residents-skeptical-of-developers-answers-on-data-center-project", "host": "ideastream.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.news5cleveland.com/news/local-news/we-follow-through/as-data-center-proposals-spread-across-stark-county-neighbors-fear-whats-next", "host": "news5cleveland.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.perrytwp.com/Documents/Departments/Administration/FAQs%20Data%20Center%20April%202026.pdf?t=202604211620460", "host": "www.perrytwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.perrytwp.com/Documents/Departments/Administration/Newsletters/PerryNewsSpring_proof3.pdf?t=202605012050560", "host": "www.perrytwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.81385, "lng": -81.36534, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "IdeastreamApr15,2026originalreportnamesPanattoni240MWundefinedproposalFaircrestSW/KropfPerryTownshipStarkCounty100+ac. Openhouseeventnotapproval;noAmazontenantidentifiedinthissource.16qualifiedsmallbusinessesnot16permanentjobs. Health/noiseconcernsandquietestneighborpledgenotmeasuredcausality/compliance. Petitionseeking>25MWstateban notenactedlaw." }, "notes": [ "IdeastreamApr15,2026originalreportnamesPanattoni240MWundefinedproposalFaircrestSW/KropfPerryTownshipStarkCounty100+ac. Openhouseeventnotapproval;noAmazontenantidentifiedinthissource.16qualifiedsmallbusinessesnot16permanentjobs. Health/noiseconcernsandquietestneighborpledgenotmeasuredcausality/compliance. Petitionseeking>25MWstateban notenactedlaw.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.ideastream.org/environment-energy/2026-04-15/some-stark-county-residents-skeptical-of-developers-answers-on-data-center-project", "host": "ideastream.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "News5June25,2026report saysStarkRegionalPlanningCommissionapprovedPerryTownshipsite;scopeofapprovaloriginalnotreadanddoesnotprovebuildingpermit/RFS. SeparateCantonTownshipmoratoriumandCantonCityMillerton/Orchardviewproposals notsamejurisdiction/site. RelatedPerryVILLAGE/LakeCountyarticleisdistinct.18000signaturecomforttargetnotactualcollectedsignatures;ballotinitiativefuture,notcurrentstateban. Amazonidentitynotestablishedhere." }, "notes": [ "News5June25,2026report saysStarkRegionalPlanningCommissionapprovedPerryTownshipsite;scopeofapprovaloriginalnotreadanddoesnotprovebuildingpermit/RFS. SeparateCantonTownshipmoratoriumandCantonCityMillerton/Orchardviewproposals notsamejurisdiction/site. RelatedPerryVILLAGE/LakeCountyarticleisdistinct.18000signaturecomforttargetnotactualcollectedsignatures;ballotinitiativefuture,notcurrentstateban. Amazonidentitynotestablishedhere.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.news5cleveland.com/news/local-news/we-follow-through/as-data-center-proposals-spread-across-stark-county-neighbors-fear-whats-next", "host": "news5cleveland.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The official Township FAQ and newsletter describe a Panattoni data center proposal and community questions. The selected originals do not identify an Amazon or Microsoft tenant, so their proposed use and administrative discussion are not a verified exact identity crosswalk for the inherited Amazon labeled record. Neither a Township open house nor a JEDD arrangement is commissioned computing. Institutional references to resident concern are retained as source context without a new facility concern whose subject match is unresolved. No provider name, role, geography or status is changed.", "fields": { "current_stage_evidence": { "outcome": "township_proposal_identity_crosswalk_held", "scope": "The official Township FAQ and newsletter describe a Panattoni data center proposal and community questions. The selected originals do not identify an Amazon or Microsoft tenant, so their proposed use and administrative discussion are not a verified exact identity crosswalk for the inherited Amazon labeled record. Neither a Township open house nor a JEDD arrangement is commissioned computing. Institutional references to resident concern are retained as source context without a new facility concern whose subject match is unresolved. No provider name, role, geography or status is changed." }, "source_read_scope": { "faq_selected_text_page": 1, "newsletter_selected_data_center_sections": true, "tenant_identity_not_certified": true, "source_file_month_not_exact_publication_day": true, "technical_and_financial_quantity_fields_not_exported": true } }, "notes": [ "The official Township FAQ and newsletter describe a Panattoni data center proposal and community questions. The selected originals do not identify an Amazon or Microsoft tenant, so their proposed use and administrative discussion are not a verified exact identity crosswalk for the inherited Amazon labeled record. Neither a Township open house nor a JEDD arrangement is commissioned computing. Institutional references to resident concern are retained as source context without a new facility concern whose subject match is unresolved. No provider name, role, geography or status is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.perrytwp.com/Documents/Departments/Administration/FAQs%20Data%20Center%20April%202026.pdf?t=202604211620460", "host": "www.perrytwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.perrytwp.com/Documents/Departments/Administration/Newsletters/PerryNewsSpring_proof3.pdf?t=202605012050560", "host": "www.perrytwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Canton · Stark · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39151" } }, { "id": "ardent-technologies-wilmington-clinton-oh", "state": "oh", "kind": "facility", "name": "Ardent Technologies Wilmington Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Clinton" ], "city": "Wilmington", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. No opening or construction result established. Planned referendum is not a filed or successful referendum; two developments are not one campus. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.whio.com/news/local/another-500-acres-land-zoned-second-data-center-wilmington/KXXP722G6ZD4LMQV2Z6U4UJUQE/", "host": "whio.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.41495, "lng": -83.80843, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "WHIO reports Wilmington council approved Ardent land rezoning five-two, separate from earlier Amazon rezoning.", "independently_verified_current_operating_status": null }, "notes": [ "No opening or construction result established. Planned referendum is not a filed or successful referendum; two developments are not one campus.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.whio.com/news/local/another-500-acres-land-zoned-second-data-center-wilmington/KXXP722G6ZD4LMQV2Z6U4UJUQE/", "host": "whio.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Wilmington · Clinton · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39027" } }, { "id": "ark-data-centers-akron-i-summit-county-oh", "state": "oh", "kind": "facility", "name": "Ark Data Centers Akron I (fka Involta)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Summit" ], "city": "Akron", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Relevant named facility/specification/article body, not all footer stories, linked contracts, certificates or all historical events.. SignalAkron original March5,2026 names BOTH Akron facilities at191E.Miller and Independence at7300E.PleasantValleyRoad; explicitly identifies Involta2024rebrand toark. Caption saysMillerRoad whereas bodyMillerAve; exactsuffix unresolved by this report. TwoAkronfacilities together exceed52,000sf, not52,000each;300racks each are notITMW. More than4.5Mestimated50%sales/usetaxbreak10years is reportedapproval, not cashpayment or totaltaxexemptionforever. 136M investment,10newjobs/1.1Mannualnewpayroll and27retainedjobs concern Akron+Independence expansion scope, not eachfacility. Min13yroperation and end2028investment/hiring obligations are conditions/forecasts, not observedcompletion. Viking150MWstatement is about a DIFFERENTcompany/site; notarkload. State127Mtaxcost/sevendatacenter/twohundredstatecounts are unverifiedsecondarycontext, not adoptedcensus. UnderlyingTaxCreditAuthorityawardnotread. Source classes and project/date/power/water/financial-scope limitations apply. Not all-field or current-site certification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://signalakron.org/4-5-million-tax-credit-will-help-data-center-expand-in-akron/", "host": "signalakron.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://dam.assets.ohio.gov/image/upload/development.ohio.gov/business/stateincentives/Meeting_Minutes_TCA_3.2.2026_pn7x3l.pdf", "host": "dam.assets.ohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.12588, "lng": -81.53219, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "border-states-and-named-operator-review-round53-2026-10-15.json", "scope": "Relevant named facility/specification/article body, not all footer stories, linked contracts, certificates or all historical events.", "fields": {}, "notes": [ "SignalAkron original March5,2026 names BOTH Akron facilities at191E.Miller and Independence at7300E.PleasantValleyRoad; explicitly identifies Involta2024rebrand toark. Caption saysMillerRoad whereas bodyMillerAve; exactsuffix unresolved by this report.", "TwoAkronfacilities together exceed52,000sf, not52,000each;300racks each are notITMW. More than4.5Mestimated50%sales/usetaxbreak10years is reportedapproval, not cashpayment or totaltaxexemptionforever.", "136M investment,10newjobs/1.1Mannualnewpayroll and27retainedjobs concern Akron+Independence expansion scope, not eachfacility. Min13yroperation and end2028investment/hiring obligations are conditions/forecasts, not observedcompletion.", "Viking150MWstatement is about a DIFFERENTcompany/site; notarkload. State127Mtaxcost/sevendatacenter/twohundredstatecounts are unverifiedsecondarycontext, not adoptedcensus. UnderlyingTaxCreditAuthorityawardnotread.", "Source classes and project/date/power/water/financial-scope limitations apply. Not all-field or current-site certification." ], "sources": [ { "url": "https://signalakron.org/4-5-million-tax-credit-will-help-data-center-expand-in-akron/", "host": "signalakron.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The original March 2, 2026 Tax Credit Authority minutes record a three to one approval for an Ark employment tax exemption project spanning Akron and Independence. The earlier four to zero vote in the same document approves prior minutes, not this Ark action. The multi city employment commitment and tax period are not exact current service or construction in each Akron building. Selected current provider hosts had unavailable robots and their bodies were not requested. No incentive value, payroll or technology quantity is transferred to a building.", "fields": { "current_stage_evidence": { "outcome": "multi_city_tax_action_not_exact_current_service", "scope": "The original March 2, 2026 Tax Credit Authority minutes record a three to one approval for an Ark employment tax exemption project spanning Akron and Independence. The earlier four to zero vote in the same document approves prior minutes, not this Ark action. The multi city employment commitment and tax period are not exact current service or construction in each Akron building. Selected current provider hosts had unavailable robots and their bodies were not requested. No incentive value, payroll or technology quantity is transferred to a building." }, "source_read_scope": { "minutes_selected_text_pages": [ 1 ], "ark_vote_three_to_one_not_prior_minutes_vote": true, "multi_city_to_two_buildings_crosswalk_unresolved": true, "current_provider_original_source_holds_retained": true } }, "notes": [ "The original March 2, 2026 Tax Credit Authority minutes record a three to one approval for an Ark employment tax exemption project spanning Akron and Independence. The earlier four to zero vote in the same document approves prior minutes, not this Ark action. The multi city employment commitment and tax period are not exact current service or construction in each Akron building. Selected current provider hosts had unavailable robots and their bodies were not requested. No incentive value, payroll or technology quantity is transferred to a building.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://dam.assets.ohio.gov/image/upload/development.ohio.gov/business/stateincentives/Meeting_Minutes_TCA_3.2.2026_pn7x3l.pdf", "host": "dam.assets.ohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Akron · Summit · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39153" } }, { "id": "ark-data-centers-akron-ii-summit-county-oh", "state": "oh", "kind": "facility", "name": "Ark Data Centers Akron II (fka Involta)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Summit" ], "city": "Akron", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Relevant named facility/specification/article body, not all footer stories, linked contracts, certificates or all historical events.. SignalAkron original March5,2026 names BOTH Akron facilities at191E.Miller and Independence at7300E.PleasantValleyRoad; explicitly identifies Involta2024rebrand toark. Caption saysMillerRoad whereas bodyMillerAve; exactsuffix unresolved by this report. TwoAkronfacilities together exceed52,000sf, not52,000each;300racks each are notITMW. More than4.5Mestimated50%sales/usetaxbreak10years is reportedapproval, not cashpayment or totaltaxexemptionforever. 136M investment,10newjobs/1.1Mannualnewpayroll and27retainedjobs concern Akron+Independence expansion scope, not eachfacility. Min13yroperation and end2028investment/hiring obligations are conditions/forecasts, not observedcompletion. Viking150MWstatement is about a DIFFERENTcompany/site; notarkload. State127Mtaxcost/sevendatacenter/twohundredstatecounts are unverifiedsecondarycontext, not adoptedcensus. UnderlyingTaxCreditAuthorityawardnotread. Source classes and project/date/power/water/financial-scope limitations apply. Not all-field or current-site certification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://signalakron.org/4-5-million-tax-credit-will-help-data-center-expand-in-akron/", "host": "signalakron.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://dam.assets.ohio.gov/image/upload/development.ohio.gov/business/stateincentives/Meeting_Minutes_TCA_3.2.2026_pn7x3l.pdf", "host": "dam.assets.ohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.1359, "lng": -81.54313, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "border-states-and-named-operator-review-round53-2026-10-15.json", "scope": "Relevant named facility/specification/article body, not all footer stories, linked contracts, certificates or all historical events.", "fields": {}, "notes": [ "SignalAkron original March5,2026 names BOTH Akron facilities at191E.Miller and Independence at7300E.PleasantValleyRoad; explicitly identifies Involta2024rebrand toark. Caption saysMillerRoad whereas bodyMillerAve; exactsuffix unresolved by this report.", "TwoAkronfacilities together exceed52,000sf, not52,000each;300racks each are notITMW. More than4.5Mestimated50%sales/usetaxbreak10years is reportedapproval, not cashpayment or totaltaxexemptionforever.", "136M investment,10newjobs/1.1Mannualnewpayroll and27retainedjobs concern Akron+Independence expansion scope, not eachfacility. Min13yroperation and end2028investment/hiring obligations are conditions/forecasts, not observedcompletion.", "Viking150MWstatement is about a DIFFERENTcompany/site; notarkload. State127Mtaxcost/sevendatacenter/twohundredstatecounts are unverifiedsecondarycontext, not adoptedcensus. UnderlyingTaxCreditAuthorityawardnotread.", "Source classes and project/date/power/water/financial-scope limitations apply. Not all-field or current-site certification." ], "sources": [ { "url": "https://signalakron.org/4-5-million-tax-credit-will-help-data-center-expand-in-akron/", "host": "signalakron.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The original March 2, 2026 Tax Credit Authority minutes record a three to one approval for an Ark employment tax exemption project spanning Akron and Independence. The earlier four to zero vote in the same document approves prior minutes, not this Ark action. The multi city employment commitment and tax period are not exact current service or construction in each Akron building. Selected current provider hosts had unavailable robots and their bodies were not requested. No incentive value, payroll or technology quantity is transferred to a building.", "fields": { "current_stage_evidence": { "outcome": "multi_city_tax_action_not_exact_current_service", "scope": "The original March 2, 2026 Tax Credit Authority minutes record a three to one approval for an Ark employment tax exemption project spanning Akron and Independence. The earlier four to zero vote in the same document approves prior minutes, not this Ark action. The multi city employment commitment and tax period are not exact current service or construction in each Akron building. Selected current provider hosts had unavailable robots and their bodies were not requested. No incentive value, payroll or technology quantity is transferred to a building." }, "source_read_scope": { "minutes_selected_text_pages": [ 1 ], "ark_vote_three_to_one_not_prior_minutes_vote": true, "multi_city_to_two_buildings_crosswalk_unresolved": true, "current_provider_original_source_holds_retained": true } }, "notes": [ "The original March 2, 2026 Tax Credit Authority minutes record a three to one approval for an Ark employment tax exemption project spanning Akron and Independence. The earlier four to zero vote in the same document approves prior minutes, not this Ark action. The multi city employment commitment and tax period are not exact current service or construction in each Akron building. Selected current provider hosts had unavailable robots and their bodies were not requested. No incentive value, payroll or technology quantity is transferred to a building.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://dam.assets.ohio.gov/image/upload/development.ohio.gov/business/stateincentives/Meeting_Minutes_TCA_3.2.2026_pn7x3l.pdf", "host": "dam.assets.ohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Akron · Summit · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39153" } }, { "id": "ark-data-centers-independence-cuyahoga-county-oh", "state": "oh", "kind": "facility", "name": "Ark Data Centers Independence (fka Involta)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Cuyahoga" ], "city": "Independence", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Relevant named facility/specification/article body, not all footer stories, linked contracts, certificates or all historical events.. Undated City of Independence page describes a newly opened25,000sf Involta multi-tenant facility and a fiber connection to Akron. It is historical/local opening context, not an exact opening date or whole2026 operating audit. 6800BrecksvilleRoad is the CITY contact/footer address, not the data-center premises. Do not copy it into the map. City historical count of five facilities includes an operations-management agreement elsewhere; not five owned buildings or present national footprint. Current rebrand identity is separately supported by March2026 SignalAkron reporting. Source classes and project/date/power/water/financial-scope limitations apply. Not all-field or current-site certification. SignalAkron original March5,2026 names BOTH Akron facilities at191E.Miller and Independence at7300E.PleasantValleyRoad; explicitly identifies Involta2024rebrand toark. Caption saysMillerRoad whereas bodyMillerAve; exactsuffix unresolved by this report. TwoAkronfacilities together exceed52,000sf, not52,000each;300racks each are notITMW. More than4.5Mestimated50%sales/usetaxbreak10years is reportedapproval, not cashpayment or totaltaxexemptionforever. 136M investment,10newjobs/1.1Mannualnewpayroll and27retainedjobs concern Akron+Independence expansion scope, not eachfacility. Min13yroperation and end2028investment/hiring obligations are conditions/forecasts, not observedcompletion. Viking150MWstatement is about a DIFFERENTcompany/site; notarkload. State127Mtaxcost/sevendatacenter/twohundredstatecounts are unverifiedsecondarycontext, not adoptedcensus. UnderlyingTaxCreditAuthorityawardnotread.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.independenceohio.org/business_resources/featured_project.php", "host": "independenceohio.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://signalakron.org/4-5-million-tax-credit-will-help-data-center-expand-in-akron/", "host": "signalakron.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 41.42429, "lng": -81.65863, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "border-states-and-named-operator-review-round53-2026-10-15.json", "scope": "Relevant named facility/specification/article body, not all footer stories, linked contracts, certificates or all historical events.", "fields": {}, "notes": [ "Undated City of Independence page describes a newly opened25,000sf Involta multi-tenant facility and a fiber connection to Akron. It is historical/local opening context, not an exact opening date or whole2026 operating audit.", "6800BrecksvilleRoad is the CITY contact/footer address, not the data-center premises. Do not copy it into the map.", "City historical count of five facilities includes an operations-management agreement elsewhere; not five owned buildings or present national footprint. Current rebrand identity is separately supported by March2026 SignalAkron reporting.", "Source classes and project/date/power/water/financial-scope limitations apply. Not all-field or current-site certification." ], "sources": [ { "url": "https://www.independenceohio.org/business_resources/featured_project.php", "host": "independenceohio.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "border-states-and-named-operator-review-round53-2026-10-15.json", "scope": "Relevant named facility/specification/article body, not all footer stories, linked contracts, certificates or all historical events.", "fields": {}, "notes": [ "SignalAkron original March5,2026 names BOTH Akron facilities at191E.Miller and Independence at7300E.PleasantValleyRoad; explicitly identifies Involta2024rebrand toark. Caption saysMillerRoad whereas bodyMillerAve; exactsuffix unresolved by this report.", "TwoAkronfacilities together exceed52,000sf, not52,000each;300racks each are notITMW. More than4.5Mestimated50%sales/usetaxbreak10years is reportedapproval, not cashpayment or totaltaxexemptionforever.", "136M investment,10newjobs/1.1Mannualnewpayroll and27retainedjobs concern Akron+Independence expansion scope, not eachfacility. Min13yroperation and end2028investment/hiring obligations are conditions/forecasts, not observedcompletion.", "Viking150MWstatement is about a DIFFERENTcompany/site; notarkload. State127Mtaxcost/sevendatacenter/twohundredstatecounts are unverifiedsecondarycontext, not adoptedcensus. UnderlyingTaxCreditAuthorityawardnotread.", "Source classes and project/date/power/water/financial-scope limitations apply. Not all-field or current-site certification." ], "sources": [ { "url": "https://signalakron.org/4-5-million-tax-credit-will-help-data-center-expand-in-akron/", "host": "signalakron.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 10", "scope": "The municipal featured project page is an undated Involta branded opening account for Independence. Current operator and rebrand source requests were held. The old opening report does not establish a current Ark code crosswalk, current services or an exact opening day. No closure, new ownership or present capacity is inferred.", "fields": { "current_stage_evidence": { "outcome": "undated_historical_opening_current_brand_stage_held", "scope": "The municipal featured project page is an undated Involta branded opening account for Independence. Current operator and rebrand source requests were held. The old opening report does not establish a current Ark code crosswalk, current services or an exact opening day. No closure, new ownership or present capacity is inferred." }, "historical_source_context": { "reported_brand": "Involta", "opening_day_established": false, "current_brand_crosswalk_verified": false, "page_first_publication_date": null } }, "notes": [ "The municipal featured project page is an undated Involta branded opening account for Independence. Current operator and rebrand source requests were held. The old opening report does not establish a current Ark code crosswalk, current services or an exact opening day. No closure, new ownership or present capacity is inferred.", "No campus total, service offer or approval is converted into an observed operating capacity, exact site point or verified opening day." ], "sources": [ { "url": "https://www.independenceohio.org/business_resources/featured_project.php", "host": "www.independenceohio.org", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed government record" } ], "checked": "2026-10-22", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Independence · Cuyahoga · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39035" } }, { "id": "aws-cosgray-hilliard-oh", "state": "oh", "kind": "facility", "name": "AWS Cosgray Road Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Hilliard", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Preferred city FAQ concerns the Scioto Darby Creek Road campus at 4186 Scioto Darby Creek Road. Do not assign its fuel-cell capacity, incentives or area to this different Hilliard record. Correct-site crosswalk required. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.96955, "lng": -83.00956, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": {}, "notes": [ "Preferred city FAQ concerns the Scioto Darby Creek Road campus at 4186 Scioto Darby Creek Road. Do not assign its fuel-cell capacity, incentives or area to this different Hilliard record. Correct-site crosswalk required.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "encore-2026-10-17-batch1", "scope": "Limited source identity and stage review; not whole-record certification, parcel verification or a physical-site census.", "fields": { "current_stage_evidence": { "outcome": "unresolved", "scope": "Hilliard’s fuel-cell FAQ concerns Amazon’s Scioto Darby Creek Road campus, not an independently matched Cosgray project. Its 72.9 MW is proposed generation context; approval and forecast dates do not establish current commissioning or this record’s IT capacity." } }, "notes": [ "Hilliard’s fuel-cell FAQ concerns Amazon’s Scioto Darby Creek Road campus, not an independently matched Cosgray project. Its 72.9 MW is proposed generation context; approval and forecast dates do not establish current commissioning or this record’s IT capacity." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed primary source" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "The current City fuel cell FAQ explicitly concerns Scioto Darby Creek Road. That separate campus project does not establish the individual current phase of this inherited Hilliard component. General AWS operations, utility generation approvals and municipality level accounts are not transferred between Cosgray, Hayden Run and Scioto Darby. Exact physical phase remains unclear.", "fields": { "current_stage_evidence": { "outcome": "separate_scioto_darby_source_does_not_resolve_this_hilliard_component", "scope": "The current City fuel cell FAQ explicitly concerns Scioto Darby Creek Road. That separate campus project does not establish the individual current phase of this inherited Hilliard component. General AWS operations, utility generation approvals and municipality level accounts are not transferred between Cosgray, Hayden Run and Scioto Darby. Exact physical phase remains unclear." } }, "notes": [ "The current City fuel cell FAQ explicitly concerns Scioto Darby Creek Road. That separate campus project does not establish the individual current phase of this inherited Hilliard component. General AWS operations, utility generation approvals and municipality level accounts are not transferred between Cosgray, Hayden Run and Scioto Darby. Exact physical phase remains unclear.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hilliard · Franklin · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39049" } }, { "id": "aws-crosby-court-franklin-county-oh", "state": "oh", "kind": "facility", "name": "AWS Crosby Court Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Plain City", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D'275-000010'&outFields=PARCELID,SITEADDRESS,OWNERNME1,CLASSDSCRP,BLDGAREA,ACRES&returnCentroid=true&outSR=4326&f=json", "host": "gis.franklincountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.98131, "lng": -83.02239, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PARCELID": "275-000010", "SITEADDRESS": "6685 - 6685 CROSBY CT", "OWNERNME1": "VADATA INC", "BLDGAREA": 768498, "ACRES": 66.82486614 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D'275-000010'&outFields=PARCELID,SITEADDRESS,OWNERNME1,CLASSDSCRP,BLDGAREA,ACRES&returnCentroid=true&outSR=4326&f=json", "host": "gis.franklincountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Plain City · Franklin · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39049" } }, { "id": "aws-jefferson-township-fayette-oh", "state": "oh", "kind": "facility", "name": "AWS Fayette County (Jefferson Township)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Fayette" ], "city": "Jeffersonville", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Stakeholder account is not signed CRA agreement or observed start. County investment is within larger Ohio program, not additive to every statewide announcement; construction jobs are temporary. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://columbusconstruction.org/amazon-web-services-to-build-new-datacenter-campus-in-fayette-county/", "host": "columbusconstruction.org", "date": "2025-01-30", "published": "2025-01-30", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 39.55998, "lng": -83.45609, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Building trades council describes planned Fayette County AWS campus, reported CRA exemption and anticipated early-2025 construction.", "independently_verified_current_operating_status": null }, "notes": [ "Stakeholder account is not signed CRA agreement or observed start. County investment is within larger Ohio program, not additive to every statewide announcement; construction jobs are temporary.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://columbusconstruction.org/amazon-web-services-to-build-new-datacenter-campus-in-fayette-county/", "host": "columbusconstruction.org", "date": "2025-01-30", "published": "2025-01-30", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Jeffersonville · Fayette · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39047" } }, { "id": "aws-hayden-run-hilliard-oh", "state": "oh", "kind": "facility", "name": "AWS Hayden Run Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Hilliard", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Preferred city FAQ concerns the Scioto Darby Creek Road campus at 4186 Scioto Darby Creek Road. Do not assign its fuel-cell capacity, incentives or area to this different Hilliard record. Correct-site crosswalk required. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.94503, "lng": -83.0074, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": {}, "notes": [ "Preferred city FAQ concerns the Scioto Darby Creek Road campus at 4186 Scioto Darby Creek Road. Do not assign its fuel-cell capacity, incentives or area to this different Hilliard record. Correct-site crosswalk required.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "encore-2026-10-17-batch1", "scope": "Limited source identity and stage review; not whole-record certification, parcel verification or a physical-site census.", "fields": { "current_stage_evidence": { "outcome": "unresolved", "scope": "Hilliard’s fuel-cell FAQ identifies a separate Scioto Darby Creek Road project. Its fuel cells, schedule and tax agreement are not independently matched to Hayden Run. No facility-specific stage, incentive or MW is transferred." } }, "notes": [ "Hilliard’s fuel-cell FAQ identifies a separate Scioto Darby Creek Road project. Its fuel cells, schedule and tax agreement are not independently matched to Hayden Run. No facility-specific stage, incentive or MW is transferred." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-17", "label": "Reviewed primary source" } ], "checked": "2026-10-17", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "The current City fuel cell FAQ explicitly concerns Scioto Darby Creek Road. That separate campus project does not establish the individual current phase of this inherited Hilliard component. General AWS operations, utility generation approvals and municipality level accounts are not transferred between Cosgray, Hayden Run and Scioto Darby. Exact physical phase remains unclear.", "fields": { "current_stage_evidence": { "outcome": "separate_scioto_darby_source_does_not_resolve_this_hilliard_component", "scope": "The current City fuel cell FAQ explicitly concerns Scioto Darby Creek Road. That separate campus project does not establish the individual current phase of this inherited Hilliard component. General AWS operations, utility generation approvals and municipality level accounts are not transferred between Cosgray, Hayden Run and Scioto Darby. Exact physical phase remains unclear." } }, "notes": [ "The current City fuel cell FAQ explicitly concerns Scioto Darby Creek Road. That separate campus project does not establish the individual current phase of this inherited Hilliard component. General AWS operations, utility generation approvals and municipality level accounts are not transferred between Cosgray, Hayden Run and Scioto Darby. Exact physical phase remains unclear.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hilliard · Franklin · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39049" } }, { "id": "aws-industrial-parkway-jerome-township-oh", "state": "oh", "kind": "facility", "name": "AWS Industrial Parkway Campus (Jerome Township)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Union" ], "city": "Plain City", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Union County Amazon Industrial Parkway cadastral context. Repeated joined feature rows are not three buildings. Distinct area/year attributes may represent improvements or joined assessment records; do not sum or label exact production opening. Appraised building value is tax-assessment context, not construction capex/transaction/incentive. Geometry is EPSG3857 meters, not lat/lon. No operating status or ITMW proven. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www7.co.union.oh.us/unioncountyohio/rest/services/ParcelAllSaleinfoBuildingInfo/MapServer/1/query?where=ParcelNo%3D'1500220390010'&outFields=ParcelNo,DeedOwner,Address,city,township,Acreage,classDescription,yearBuilt,TotalBuildingArea,AppraisedBuildValue&f=json", "host": "www7.co.union.oh.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.29938, "lng": -83.37152, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Union County Amazon Industrial Parkway cadastral context", "fields": { "agency": "Union County Ohio parcel service", "parcel": "1500220390010", "deed_owner_as_listed": "AMAZON DATA SERVICES INC", "situs_address": "8565 Industrial Parkway", "postal_city": "Plain City", "township": "Jerome", "parcel_acres": 86.18, "returned_feature_rows": 3, "distinct_attribute_rows": 2, "assessment_build_years": [ 2024, 2025 ], "assessment_building_area_values_sqft": [ 151305, 215144 ] }, "notes": [ "Repeated joined feature rows are not three buildings. Distinct area/year attributes may represent improvements or joined assessment records; do not sum or label exact production opening. Appraised building value is tax-assessment context, not construction capex/transaction/incentive. Geometry is EPSG3857 meters, not lat/lon. No operating status or ITMW proven.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www7.co.union.oh.us/unioncountyohio/rest/services/ParcelAllSaleinfoBuildingInfo/MapServer/1/query?where=ParcelNo%3D'1500220390010'&outFields=ParcelNo,DeedOwner,Address,city,township,Acreage,classDescription,yearBuilt,TotalBuildingArea,AppraisedBuildValue&f=json", "host": "www7.co.union.oh.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Plain City · Union · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39159" } }, { "id": "aws-2550-beech-road-new-albany-oh", "state": "oh", "kind": "facility", "name": "AWS New Albany (2550 Beech Road)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Assessed improvements/abatements are property records, not investment or incentive payments. Official Licking County parcel query returns ownership/location. It does not demonstrate commissioned servers or operating load. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'095-111744-00.000'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.10383, "lng": -82.49647, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "field-verification-2026-10-14.json", "scope": "Field or source context only", "fields": { "parcel": "095-111744-00.000", "parcel_owner": "VADATA INC", "parcel_site_address": "2550 BEECH RD NW", "tax_acres": 67.27, "county": "Licking" }, "notes": [ "Assessed improvements/abatements are property records, not investment or incentive payments.", "Official Licking County parcel query returns ownership/location. It does not demonstrate commissioned servers or operating load.", "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'095-111744-00.000'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "fields": { "current_stage_evidence": { "outcome": "broader_new_albany_market_not_exact_component_stage", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed." }, "source_read_scope": { "selected_section": "August 7, 2025 AWS data centers in New Albany", "current_rolling_source_not_all_articles_read": true, "regional_service_not_transferred_to_every_building": true, "no_site_event_from_broader_market_publication": true } }, "notes": [ "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "aws-3180-beech-road-new-albany-oh", "state": "oh", "kind": "facility", "name": "AWS New Albany (3180 Beech Road)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Assessed improvements/abatements are property records, not investment or incentive payments. 3180 street number is not present in this queried parcel. Official Licking County parcel query returns ownership/location. It does not demonstrate commissioned servers or operating load. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'095-111618-04.000'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.06593, "lng": -82.48081, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "field-verification-2026-10-14.json", "scope": "Field or source context only", "fields": { "parcel": "095-111618-04.000", "parcel_owner": "AMAZON DATA SERVICES INC", "parcel_site_address": "BEECH RD NW", "tax_acres": 106.41, "county": "Licking" }, "notes": [ "Assessed improvements/abatements are property records, not investment or incentive payments.", "3180 street number is not present in this queried parcel.", "Official Licking County parcel query returns ownership/location. It does not demonstrate commissioned servers or operating load.", "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'095-111618-04.000'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "fields": { "current_stage_evidence": { "outcome": "broader_new_albany_market_not_exact_component_stage", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed." }, "source_read_scope": { "selected_section": "August 7, 2025 AWS data centers in New Albany", "current_rolling_source_not_all_articles_read": true, "regional_service_not_transferred_to_every_building": true, "no_site_event_from_broader_market_publication": true } }, "notes": [ "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "aws-beech-road-new-albany-oh", "state": "oh", "kind": "facility", "name": "AWS New Albany (Beech/Miller Road Campus)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=UPPER(OwnerName)+LIKE+'%25AMAZON%25'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.11654, "lng": -82.4639, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 8, "cadastral_error": null, "parcel_assertions": [ { "PID": 93672, "Parcel": "093-106422-00.004", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "2575 NEWTON CT ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 1.64 }, { "PID": 96925, "Parcel": "095-111408-00.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "BEECH RD ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 199.81 }, { "PID": 93874, "Parcel": "095-111618-04.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "BEECH RD NW", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 106.41 }, { "PID": 96928, "Parcel": "095-111648-00.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "MILLER RD NW", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 67.68 }, { "PID": 96932, "Parcel": "095-111870-00.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "BEECH RD NW", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 0.27 }, { "PID": 90304, "Parcel": "095-112074-00.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "2575 NEWTON CT ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 92.69 }, { "PID": 96936, "Parcel": "095-112248-00.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "13757 MILLER RD ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 12.9 }, { "PID": 96941, "Parcel": "095-112248-00.001", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "BEECH RD ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 71.3 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=UPPER(OwnerName)+LIKE+'%25AMAZON%25'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "fields": { "current_stage_evidence": { "outcome": "broader_new_albany_market_not_exact_component_stage", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed." }, "source_read_scope": { "selected_section": "August 7, 2025 AWS data centers in New Albany", "current_rolling_source_not_all_articles_read": true, "regional_service_not_transferred_to_every_building": true, "no_site_event_from_broader_market_publication": true } }, "notes": [ "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "aws-newton-court-new-albany-oh", "state": "oh", "kind": "facility", "name": "AWS New Albany (Newton Court)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'095-112074-00.000'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.08521, "lng": -82.51888, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PID": 90304, "Parcel": "095-112074-00.000", "OwnerName": "AMAZON DATA SERVICES INC", "SiteAddress": "2575 NEWTON CT ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 92.69 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'095-112074-00.000'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "fields": { "current_stage_evidence": { "outcome": "broader_new_albany_market_not_exact_component_stage", "scope": "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed." }, "source_read_scope": { "selected_section": "August 7, 2025 AWS data centers in New Albany", "current_rolling_source_not_all_articles_read": true, "regional_service_not_transferred_to_every_building": true, "no_site_event_from_broader_market_publication": true } }, "notes": [ "The retained original Amazon locations news page contains an August 7, 2025 New Albany market and community investment account. It does not individually identify this inherited street or campus component as currently commissioned computing. Market investment, general jobs and community programs do not certify service in every building or establish a separate campus identity. Exact physical stage remains held and no street, parcel, provider role, component count or quantity is changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/amazon-data-centers-locations-news", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "aws-project-cosmos-marysville-oh", "state": "oh", "kind": "facility", "name": "AWS Project Cosmos", "group": "building", "status": "City-reported site preparation", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Union" ], "city": "Marysville", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Marysville two distinct data-center projects and approval chronology. Two separate city projects; do not label Anadonna as AWS without tenant proof. First reading not final adoption day; city reports CRA approved but actual signed terms not read here. Approximate annual4Mpayroll per project not jobs count or investment. Atleast50fulltimejobs plural FAQ scope ambiguous; not assigned each. No numeric ITMW or observed commissioning. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://marysvilleohio.org/772/Data-Center-FAQs", "host": "marysvilleohio.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.31227, "lng": -83.38558, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Marysville two distinct data-center projects and approval chronology", "fields": { "agency": "City of Marysville, Ohio", "named_projects": [ { "operator": "AWS", "project": "US33 Innovation Park", "address": "14684 Industrial Parkway", "site_acres_approx": 55, "estimated_building_sqft_approx": 500000, "estimated_investment_usd_approx": 1000000000, "agency_reported_site_readiness_start": "early2026", "construction_forecast_through_year": 2027 }, { "applicant": "Anadonna LLC", "project": "Marysville South", "site_acres_approx": 600, "estimated_building_sqft_range": [ 750000, 1000000 ], "estimated_investment_usd_min_inclusive_approx": 1000000000, "pud_rezoning_month": "2024-08", "cra_donation_agreement_first_reading_date": "2025-11-10" } ] }, "notes": [ "Two separate city projects; do not label Anadonna as AWS without tenant proof. First reading not final adoption day; city reports CRA approved but actual signed terms not read here. Approximate annual4Mpayroll per project not jobs count or investment. Atleast50fulltimejobs plural FAQ scope ambiguous; not assigned each. No numeric ITMW or observed commissioning.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://marysvilleohio.org/772/Data-Center-FAQs", "host": "marysvilleohio.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "county-status-2026-10-19", "scope": "Marysville reports that site readiness work for its AWS US 33 Innovation Park project began in early 2026.", "fields": { "current_stage_evidence": { "outcome": "city_reported_site_preparation", "scope": "Marysville reports that site readiness work for its AWS US 33 Innovation Park project began in early 2026." } }, "notes": [ "The city distinguishes this AWS project from the separate Anadonna / Marysville South development. Site preparation does not establish completed halls or operation. Construction through 2027 remains a forecast, and the early 2026 reference gives no exact start day." ], "sources": [ { "url": "https://marysvilleohio.org/772/Data-Center-FAQs", "host": "marysvilleohio.org", "published": "", "date": "", "checked": "2026-10-19", "label": "Original county or city record for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Marysville · Union · Source context reviewed", "status_scope": "Marysville reports that site readiness work for its AWS US 33 Innovation Park project began in early 2026.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39159" } }, { "id": "aws-galaxy-sidney-oh", "state": "oh", "kind": "facility", "name": "AWS Project Galaxy - Sidney, OH", "group": "building", "status": "City-reported site preparation", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Shelby" ], "city": "Sidney", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Advocacy/commerciallead-product tracker is not an independently examined cityagreement.180 to 350 millionforegonetax and 2.4 to 4.6 millionperjob are tracker estimates over 30 years, not cashaward/currentcost;50 millionPILOTis 15 yearcumulative, not annualreceivedrevenue. Generic 300 gpmexample is NOTGalaxywaterdemand. Source says utility/tariff undisclosed then guessesAEP 85 percentapplies; do not adopt supplier or tariff.80/100 risk is proprietary editorialscore, not measuredtechnicalrisk. January 2026 construction/2030 target are attributed and currentoperationunknown. NoMW, executedESAoractualincentiveverified. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://stopohiodatacenters.org/shelby-county", "host": "stopohiodatacenters.org", "date": "2026-04-26", "published": "2026-04-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.sidneyoh.com/526/Sidney-Data-Center-FAQ", "host": "www.sidneyoh.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Original county or city record for the qualified stage" } ], "loc": { "lat": 40.33151, "lng": -84.20458, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "StopOhioDataCenters’ ShelbyCounty tracker describes ProjectGalaxy atSidney and reports 30 yearreal-propertyabatement/PILOT/constructionterms drawn from other reporting and cityFAQ.", "independently_verified_current_operating_status": null }, "notes": [ "Advocacy/commerciallead-product tracker is not an independently examined cityagreement.180 to 350 millionforegonetax and 2.4 to 4.6 millionperjob are tracker estimates over 30 years, not cashaward/currentcost;50 millionPILOTis 15 yearcumulative, not annualreceivedrevenue. Generic 300 gpmexample is NOTGalaxywaterdemand. Source says utility/tariff undisclosed then guessesAEP 85 percentapplies; do not adopt supplier or tariff.80/100 risk is proprietary editorialscore, not measuredtechnicalrisk. January 2026 construction/2030 target are attributed and currentoperationunknown. NoMW, executedESAoractualincentiveverified.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://stopohiodatacenters.org/shelby-county", "host": "stopohiodatacenters.org", "date": "2026-04-26", "published": "2026-04-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "county-status-2026-10-19", "scope": "Sidney describes tree felling and test-pit work at its AWS Project Galaxy/Rey development.", "fields": { "current_stage_evidence": { "outcome": "city_reported_site_preparation", "scope": "Sidney describes tree felling and test-pit work at its AWS Project Galaxy/Rey development." } }, "notes": [ "The city describes tree-clearing work in the week of March 2, 2026. This supports early site work only, not completed halls or operation. Its October 5 update label is not the first-publication date or a physical-stage day. Reported company plans do not establish measured environmental effects." ], "sources": [ { "url": "https://www.sidneyoh.com/526/Sidney-Data-Center-FAQ", "host": "www.sidneyoh.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Original county or city record for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Sidney · Shelby · Source context reviewed", "status_scope": "Sidney describes tree felling and test-pit work at its AWS Project Galaxy/Rey development.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39149" } }, { "id": "aws-scioto-darby-hilliard-oh", "state": "oh", "kind": "facility", "name": "AWS Scioto Darby Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Hilliard", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Fuel-cell generation is behind-the-meter supply, not data-center critical IT capacity. City FAQ reports a construction target, not a verified start. CRA campus scope and executed agreement need separate matching. Parcel service address 4120 differs from city fuel-cell address 4186; do not move the campus pin or overwrite the parcel address.", "date": "", "events": [ [ "2026-09-15", "Hilliard published its fuel cell permit appeal withdrawal account September 15, 2026. This records the City publication and reported case action, not an independently verified ERAC filing day, data hall opening or endorsement of every project impact." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D'050-002806'&outFields=*&f=json&returnGeometry=true&outSR=4326", "host": "gis.franklincountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://hilliardohio.gov/city-of-hilliard-ends-fuel-cell-permit-appeal-calls-for-stronger-local-input/", "host": "hilliardohio.gov", "published": "2026-09-15", "date": "2026-09-15", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://hilliardohio.gov/wp-content/uploads/2022/07/BZA-AGENDA-PACKET-7-21-22-amended.pdf", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actual viewed 2022 public filing names Amazon site and includes exact retained parcel" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D%27050-002806%27&outFields=%2A&f=json&returnGeometry=true&outSR=4326&resultRecordCount=100", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "One exact retained county reference parcel and numeric situs" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.13025493775973%2C40.01445844412504%2C-83.11852506224028%2C40.02344155587495&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting only, acquisition date unknown" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0?f=pjson", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact county layer fields and reference mapping" }, { "url": "https://hilliardohio.gov/wp-content/uploads/2025/11/25-7227-Notice-of-Appeal.pdf", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actual viewed 2025 filed notice spells the complete Scioto Darby Creek street" } ], "loc": { "lng": -83.12439, "lat": 40.01895, "precision": "approximate", "basis": "Approximate mathematical center of the exact Franklin County Auditor GIS reference parcel 050-002806 at 4120 Scioto Darby Creek Road, Hilliard, Ohio. Actual viewed public filings independently name this site and the exact retained parcel. One of six historically filed parcels only, not a complete campus boundary. County reference mapping only, not a surveyed boundary, legal title, roof or completed full campus. Aerial date is unknown and may predate development. Existing native status remains unknown." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PARCELID": "050-002806", "ACRES": 143.33342767, "SITEADDRESS": "4120 SCIOTO DARBY CRK", "OWNERNME1": "AMAZON DATA SERVICES INC", "BLDGAREA": 695120 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D'050-002806'&outFields=*&f=json&returnGeometry=true&outSR=4326", "host": "gis.franklincountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "fuel_cell_generation_mw": 72.9, "fuel_cell_site_address": "4186 Scioto Darby Creek Road", "fuel_cell_site_acres_approx": 6.4, "city_described_data_center_campus_acres": 142, "fuel_cell_approval_date": "2025-09-22", "fuel_cell_operation_target": "2027-09", "city_described_cra_investment_requirement_usd": 200000000, "cra_investment_requirement_deadline": "2026-12-31" }, "notes": [ "Fuel-cell generation is behind-the-meter supply, not data-center critical IT capacity. City FAQ reports a construction target, not a verified start. CRA campus scope and executed agreement need separate matching. Parcel service address 4120 differs from city fuel-cell address 4186; do not move the campus pin or overwrite the parcel address.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "Hilliard September 15, 2026 release reports withdrawal of its ERAC appeal of the AEP fuel cell permit at the AWS Scioto Darby campus and describes modeled impacts and later monitoring plans. The FAQ discusses a separate fuel cell project and forecast. Power generation approval or construction and an appeal withdrawal do not establish the current individual data hall operating phase. No projected emissions, health threshold, water or power quantity is adopted as measured site performance. The existing concern item is already marked withdrawn and is not added again.", "fields": { "current_stage_evidence": { "outcome": "fuel_cell_permit_appeal_followup_not_individual_compute_phase", "scope": "Hilliard September 15, 2026 release reports withdrawal of its ERAC appeal of the AEP fuel cell permit at the AWS Scioto Darby campus and describes modeled impacts and later monitoring plans. The FAQ discusses a separate fuel cell project and forecast. Power generation approval or construction and an appeal withdrawal do not establish the current individual data hall operating phase. No projected emissions, health threshold, water or power quantity is adopted as measured site performance. The existing concern item is already marked withdrawn and is not added again." }, "concern_followup": { "concern_id": "concern:oh-hilliard-fuel-cell-permit-appeal-withdrawal-2026", "scope": "The existing current documented item already reports the same City withdrawal account. This capture rechecks that source without duplicating the concern or changing its original chronology. Its native concern review date is not renewed by this site context review.", "duplicate_added": false } }, "notes": [ "Hilliard September 15, 2026 release reports withdrawal of its ERAC appeal of the AEP fuel cell permit at the AWS Scioto Darby campus and describes modeled impacts and later monitoring plans. The FAQ discusses a separate fuel cell project and forecast. Power generation approval or construction and an appeal withdrawal do not establish the current individual data hall operating phase. No projected emissions, health threshold, water or power quantity is adopted as measured site performance. The existing concern item is already marked withdrawn and is not added again.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://hilliardohio.gov/fuel-cells/", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://hilliardohio.gov/city-of-hilliard-ends-fuel-cell-permit-appeal-calls-for-stronger-local-input/", "host": "hilliardohio.gov", "published": "2026-09-15", "date": "2026-09-15", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 40, October 23, 2026", "scope": "Approximate remains approximate. One bounded county reference parcel only, not a complete campus. Existing native status remains unknown.", "fields": { "location_review_decision": { "location": { "lng": -83.12439, "lat": 40.01895, "precision": "approximate", "basis": "Approximate mathematical center of the exact Franklin County Auditor GIS reference parcel 050-002806 at 4120 Scioto Darby Creek Road, Hilliard, Ohio. Actual viewed public filings independently name this site and the exact retained parcel. One of six historically filed parcels only, not a complete campus boundary. County reference mapping only, not a surveyed boundary, legal title, roof or completed full campus. Aerial date is unknown and may predate development. Existing native status remains unknown." }, "reference_method": "Approximate county reference parcel center", "reference_parcel": { "identifier": "050-002806", "identifier_field": "PARCELID", "objectid": 463565, "agency": "Franklin County Auditor GIS", "reference_method": "calculated_polygon_centroid", "not_survey_quality": true, "legal_title_verified": false, "independent_building_identity": false, "full_campus_verified": false, "operator_ownership_verified": false, "county_codes_inferred": false, "filed_reference_ids": [ "050-003336", "050-002806", "050-003210", "050-0002427", "050-002299", "050-002301" ], "complete_filed_set_adopted": false }, "operator_coordinates_adopted": false, "census_range_adopted": false } }, "notes": [ "The actually viewed City of Hilliard July 21, 2022 staff report PDF page 41 names the Amazon data center at 4120 Scioto Darby Road and explicitly lists 050-002806 among six parcel references. The actually viewed November 7, 2025 filed notice PDF page 1 spells 4120 Scioto Darby Creek Road for the AWS site. The current exact Franklin County parcel 050-002806 has numeric situs 4120 SCIOTO DARBY CRK. This independently joins the retained exact parcel association to the named site without selecting a neighboring owner parcel or adopting project status. Only this bounded county reference parcel is admitted, not all six parcels or a complete campus. The historical list raw 050-0002427 spelling is preserved and not silently corrected.", "Approximate remains approximate. One bounded county reference parcel only, not a complete campus. Existing native status remains unknown.", "Actually viewed wooded and open ground, streets, highway and nearby commercial forms. Acquisition date is unknown and may predate development. No new construction, absence, completed campus, future roof or present operating finding is adopted." ], "sources": [ { "url": "https://hilliardohio.gov/wp-content/uploads/2022/07/BZA-AGENDA-PACKET-7-21-22-amended.pdf", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actual viewed 2022 public filing names Amazon site and includes exact retained parcel" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D%27050-002806%27&outFields=%2A&f=json&returnGeometry=true&outSR=4326&resultRecordCount=100", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "One exact retained county reference parcel and numeric situs" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.13025493775973%2C40.01445844412504%2C-83.11852506224028%2C40.02344155587495&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting only, acquisition date unknown" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0?f=pjson", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact county layer fields and reference mapping" }, { "url": "https://hilliardohio.gov/wp-content/uploads/2025/11/25-7227-Notice-of-Appeal.pdf", "host": "hilliardohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actual viewed 2025 filed notice spells the complete Scioto Darby Creek street" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Approximate county reference parcel, not a confirmed building or full campus", "summary": "Hilliard · Franklin · Source context reviewed", "event_evidence": [ { "date": "2026-09-15", "text": "Hilliard published its fuel cell permit appeal withdrawal account September 15, 2026. This records the City publication and reported case action, not an independently verified ERAC filing day, data hall opening or endorsement of every project impact.", "kind": "announced", "sources": [ { "url": "https://hilliardohio.gov/city-of-hilliard-ends-fuel-cell-permit-appeal-calls-for-stronger-local-input/", "host": "hilliardohio.gov", "published": "2026-09-15", "date": "2026-09-15", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ] }, { "id": "aws-sprigg-township-adams-county-oh", "state": "oh", "kind": "facility", "name": "AWS Sprigg Township Data Center Campus (Buck Canyon)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Adams" ], "city": "Manchester", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Undated county project FAQ. These are proposed-project forecasts, not actual water use or jobs. The page includes separate statewide jobs and unrelated restoration water benefits; excluded. Cooling circuit and consumption versus withdrawal basis need primary engineering permits. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://amazon.adamscountyoh.gov/", "host": "amazon.adamscountyoh.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 38.84551, "lng": -83.47206, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "planned_investment_usd_minimum": 10000000000, "forecast_long_term_jobs_minimum": 500, "forecast_cooling_water_gallons_per_year_approx": 19700000, "advertised_cooling_water_source": "Ohio River", "developer_stage_as_described": "due diligence; general contractor not yet determined" }, "notes": [ "Undated county project FAQ. These are proposed-project forecasts, not actual water use or jobs. The page includes separate statewide jobs and unrelated restoration water benefits; excluded. Cooling circuit and consumption versus withdrawal basis need primary engineering permits.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://amazon.adamscountyoh.gov/", "host": "amazon.adamscountyoh.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "The County current Amazon page describes evaluation, due diligence and future building plans, with initial earthwork expected during 2026. It does not expressly identify Sprigg Township, Buck Canyon or the inherited parcel component. This broader county development account remains context until the exact proposal crosswalk is established. No expired or current year earthwork forecast, industrial site activity or wetland permit is promoted into actual data center construction, entitlement or operation.", "fields": { "current_stage_evidence": { "outcome": "county_amazon_development_context_without_exact_buck_canyon_component_crosswalk", "scope": "The County current Amazon page describes evaluation, due diligence and future building plans, with initial earthwork expected during 2026. It does not expressly identify Sprigg Township, Buck Canyon or the inherited parcel component. This broader county development account remains context until the exact proposal crosswalk is established. No expired or current year earthwork forecast, industrial site activity or wetland permit is promoted into actual data center construction, entitlement or operation." } }, "notes": [ "The County current Amazon page describes evaluation, due diligence and future building plans, with initial earthwork expected during 2026. It does not expressly identify Sprigg Township, Buck Canyon or the inherited parcel component. This broader county development account remains context until the exact proposal crosswalk is established. No expired or current year earthwork forecast, industrial site activity or wetland permit is promoted into actual data center construction, entitlement or operation.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://amazon.adamscountyoh.gov/", "host": "amazon.adamscountyoh.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Manchester · Adams · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39001" } }, { "id": "aws-trenton-madison-st-clair-butler-oh", "state": "oh", "kind": "facility", "name": "AWS Trenton / Madison-St. Clair Township Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Butler" ], "city": "Trenton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. TIF redirects tax increments; it is not automatically tax forgiveness. Competing proposed distributions are not actual receipts or final annexation; 141-acre and 600-acre schemes remain distinct. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wcpo.com/news/local-news/in-your-community/butler-county/townships-move-to-capture-future-data-center-tax-revenue-as-trenton-pursues-annexation", "host": "wcpo.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.4386, "lng": -84.57549, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Journal-News reporting via WCPO describes competing township and Trenton TIF/annexation approaches for AWS land.", "independently_verified_current_operating_status": null }, "notes": [ "TIF redirects tax increments; it is not automatically tax forgiveness. Competing proposed distributions are not actual receipts or final annexation; 141-acre and 600-acre schemes remain distinct.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.wcpo.com/news/local-news/in-your-community/butler-county/townships-move-to-capture-future-data-center-tax-revenue-as-trenton-pursues-annexation", "host": "wcpo.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Trenton · Butler · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39017" } }, { "id": "aws-warner-road-jerome-township-oh", "state": "oh", "kind": "facility", "name": "AWS Warner Road Campus (Jerome Township)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Union" ], "city": "Plain City", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Union County Warner Road cadastral duplicates and historical improvements. 24joinedfeaturesand7distinctattributesnot24or7independentbuildings. Repeated215k-likeareas acrossyears may be same improvement; no summed area/count. YearBuiltassessmentnotfirst data service. Appraised value not actual investment or incentives. Geometry EPSG3857notlat/lon. No current operating status or ITMW. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www7.co.union.oh.us/unioncountyohio/rest/services/ParcelAllSaleinfoBuildingInfo/MapServer/1/query?where=ParcelNo%3D'1500300200000'&outFields=ParcelNo,DeedOwner,Address,city,township,Acreage,classDescription,yearBuilt,TotalBuildingArea,AppraisedBuildValue&f=json", "host": "www7.co.union.oh.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.27252, "lng": -83.36916, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Union County Warner Road cadastral duplicates and historical improvements", "fields": { "agency": "Union County Ohio parcel service", "parcel": "1500300200000", "deed_owner_as_listed": "AMAZON DATA SERVICES INC", "situs_address": "8567 Warner Road", "postal_city": "Plain City", "township": "Jerome", "parcel_acres": 92.77, "returned_feature_rows": 24, "distinct_attribute_rows": 7, "assessment_build_years": [ 2023, 2024 ], "assessment_area_values_sqft_unique": [ 900, 13851, 156826, 214097, 214507 ] }, "notes": [ "24joinedfeaturesand7distinctattributesnot24or7independentbuildings. Repeated215k-likeareas acrossyears may be same improvement; no summed area/count. YearBuiltassessmentnotfirst data service. Appraised value not actual investment or incentives. Geometry EPSG3857notlat/lon. No current operating status or ITMW.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www7.co.union.oh.us/unioncountyohio/rest/services/ParcelAllSaleinfoBuildingInfo/MapServer/1/query?where=ParcelNo%3D'1500300200000'&outFields=ParcelNo,DeedOwner,Address,city,township,Acreage,classDescription,yearBuilt,TotalBuildingArea,AppraisedBuildValue&f=json", "host": "www7.co.union.oh.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Plain City · Union · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39159" } }, { "id": "aws-wilmington-clinton-oh", "state": "oh", "kind": "facility", "name": "AWS Wilmington Data Center Campus", "group": "proposed", "status": "Agency listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Clinton" ], "city": "Wilmington", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Wilmington official project site and separate annexation petition. Separate545acJanuary15,2026annexation petition by four owners not automatically this471acAWSsite. Developer infrastructure25Mplus forecast not actual completed upgrades or money paid to county. Entitlement/annexation not energization. Nine planned data buildings not operational building census. Quoted current code requirements from FAQ not independent signed ordinance inspection. No ITMW or exact customer service date adopted. School compensation approval reported by agency, but executed signed agreement not independently read. Promised upfront/annual payments not actual receipts. Water6M is ANNUAL, not daily, and not guaranteed peak demand. One-million-gallon PUBLIC water tower is storage capacity, not annual DC consumption. State tax award reported but underlying award not inspected; no local CRA percentage/term guessed from first reading. Distribution/transmission assurances explicitly do not cover generation rates. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2025-08-07", "The Port Authority FAQ reports City Council approval of project site annexation August 7, 2025. This is its bounded government account of that municipal action, not approval or operation of the data center, certification of every annexed parcel or a change to Atlas jurisdiction fields." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.chooseclintoncountyoh.org/news/data-center-faqs", "host": "chooseclintoncountyoh.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.42665, "lng": -83.8212, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Wilmington official project site and separate annexation petition", "fields": { "publisher_role": "Clinton County Port Authority economic-development FAQ", "project_operator": "AWS", "address": "1488 SouthUS68, Wilmington, Ohio45177", "project_site_acres": 471, "planned_principal_data_center_buildings": 9, "total_planned_building_sqft": 1920299, "individual_building_sqft_range": [ 162787, 219689 ], "agency_reported_annexation_approval_date": "2025-08-07", "agency_reported_light_industrial_zoning_approval_date": "2025-08-07", "agency_reported_dc_code_requirements_approval_date": "2025-07-17", "faq_location_zoning_updated_date": "2026-03-25", "developer_paid_public_infrastructure_capex_usd_min_exclusive": 25000000, "minimum_expected_permanent_jobs": 100, "expected_construction_jobs_min_exclusive": 200, "construction_duration_years_min_inclusive": 5, "expected_school_annual_revenue_usd": 1000000, "agency_reported_school_compensation_approval_date": "2025-11-19", "promised_upfront_city_payment_usd": 1500000, "separate_port_authority_payment_usd": 350000, "expected_annual_city_pilot_plus_income_tax_usd_min_exclusive": 1000000, "estimated_annual_water_gallons": 6000000, "water_basis": "developer projection quoted in FAQ, not metered actual", "water_service_agreement_stage": "being pursued", "city_public_water_tower_planned_gallons": 1000000 }, "notes": [ "Separate545acJanuary15,2026annexation petition by four owners not automatically this471acAWSsite. Developer infrastructure25Mplus forecast not actual completed upgrades or money paid to county. Entitlement/annexation not energization. Nine planned data buildings not operational building census. Quoted current code requirements from FAQ not independent signed ordinance inspection. No ITMW or exact customer service date adopted.", "School compensation approval reported by agency, but executed signed agreement not independently read. Promised upfront/annual payments not actual receipts. Water6M is ANNUAL, not daily, and not guaranteed peak demand. One-million-gallon PUBLIC water tower is storage capacity, not annual DC consumption. State tax award reported but underlying award not inspected; no local CRA percentage/term guessed from first reading. Distribution/transmission assurances explicitly do not cover generation rates.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.chooseclintoncountyoh.org/news/data-center-faqs", "host": "chooseclintoncountyoh.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "The Port Authority current FAQ explicitly names the AWS Wilmington campus proposal and the South US 68 project site, separately distinguishing other land petitions and their unidentified prospective end users. Agency listed proposal is limited to the named AWS account. Its August 7, 2025 annexation statement is not data center commissioning, individual site plan approval or a new jurisdiction edit. Water use, utility effects and community benefits remain attributed design estimates and explanations, not measured outcomes. A future design or service agreement is not delivered infrastructure.", "fields": { "current_stage_evidence": { "outcome": "named_aws_wilmington_proposal_separate_from_other_land_petitions", "scope": "The Port Authority current FAQ explicitly names the AWS Wilmington campus proposal and the South US 68 project site, separately distinguishing other land petitions and their unidentified prospective end users. Agency listed proposal is limited to the named AWS account. Its August 7, 2025 annexation statement is not data center commissioning, individual site plan approval or a new jurisdiction edit. Water use, utility effects and community benefits remain attributed design estimates and explanations, not measured outcomes. A future design or service agreement is not delivered infrastructure." } }, "notes": [ "The Port Authority current FAQ explicitly names the AWS Wilmington campus proposal and the South US 68 project site, separately distinguishing other land petitions and their unidentified prospective end users. Agency listed proposal is limited to the named AWS account. Its August 7, 2025 annexation statement is not data center commissioning, individual site plan approval or a new jurisdiction edit. Water use, utility effects and community benefits remain attributed design estimates and explanations, not measured outcomes. A future design or service agreement is not delivered infrastructure.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://www.chooseclintoncountyoh.org/news/data-center-faqs", "host": "www.chooseclintoncountyoh.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Wilmington · Clinton · Source context reviewed", "status_scope": "The Port Authority current FAQ explicitly names the AWS Wilmington campus proposal and the South US 68 project site, separately distinguishing other land petitions and their unidentified prospective end users. Agency listed proposal is limited to the named AWS account. Its August 7, 2025 annexation statement is not data center commissioning, individual site plan approval or a new jurisdiction edit. Water use, utility effects and community benefits remain attributed design estimates and explanations, not measured outcomes. A future design or service agreement is not delivered infrastructure.", "event_evidence": [ { "date": "2025-08-07", "text": "The Port Authority FAQ reports City Council approval of project site annexation August 7, 2025. This is its bounded government account of that municipal action, not approval or operation of the data center, certification of every annexed parcel or a change to Atlas jurisdiction fields.", "kind": "approved", "sources": [ { "url": "https://www.chooseclintoncountyoh.org/news/data-center-faqs", "host": "www.chooseclintoncountyoh.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39027" } }, { "id": "bit-mining-viking-akron-summit-county-oh", "state": "oh", "kind": "facility", "name": "BIT Mining / Viking Data Centers - Akron", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Summit" ], "city": "Akron", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Viking Ohio platform and Seiberling redevelopment. Ohio-basedfacilities/portfolio scope not securely oneAkronbuilding. Power not explicit IT or observed metered load. No exactstreetmunicipality/parcelcrosswalkorcurrentBITMiningownershipproof. MarketingtransitiontoAIcapabilitynotexecutedAItenantlease. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.vikingdata.io/about-us", "host": "vikingdata.io", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 41.10497, "lng": -81.53036, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "Viking Ohio platform and Seiberling redevelopment", "fields": { "operator": "Viking Data Centers", "published_ohio_capacity_mw": 150, "historical_capacity_mw_2021": 20, "published_capacity_year": 2024, "named_redevelopment": "428 Seiberling", "operator_described_activity": "actively mining available capacity" }, "notes": [ "Ohio-basedfacilities/portfolio scope not securely oneAkronbuilding. Power not explicit IT or observed metered load. No exactstreetmunicipality/parcelcrosswalkorcurrentBITMiningownershipproof. MarketingtransitiontoAIcapabilitynotexecutedAItenantlease.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.vikingdata.io/about-us", "host": "vikingdata.io", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The current provider account describes Ohio facilities and active mining, then separately markets a Seiberling redevelopment. The plural platform scope and unnamed facility in the mining statement do not independently certify the inherited single Akron record as an exact computing building. AI ready language does not establish an executed AI tenant lease or active AI workloads. Current BIT Mining ownership, exact role and parcel crosswalk remain unverified and unchanged.", "fields": { "current_stage_evidence": { "outcome": "current_platform_mining_not_exact_building_crosswalk", "scope": "The current provider account describes Ohio facilities and active mining, then separately markets a Seiberling redevelopment. The plural platform scope and unnamed facility in the mining statement do not independently certify the inherited single Akron record as an exact computing building. AI ready language does not establish an executed AI tenant lease or active AI workloads. Current BIT Mining ownership, exact role and parcel crosswalk remain unverified and unchanged." }, "source_read_scope": { "selected_sections": [ "Company Overview active mining statement", "428 Seiberling transformation", "Infrastructure service claims" ], "plural_facilities_not_one_certified_building": true, "ai_readiness_not_active_ai_compute": true } }, "notes": [ "The current provider account describes Ohio facilities and active mining, then separately markets a Seiberling redevelopment. The plural platform scope and unnamed facility in the mining statement do not independently certify the inherited single Akron record as an exact computing building. AI ready language does not establish an executed AI tenant lease or active AI workloads. Current BIT Mining ownership, exact role and parcel crosswalk remain unverified and unchanged.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.vikingdata.io/about-us", "host": "www.vikingdata.io", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Akron · Summit · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39153" } }, { "id": "bitdeer-massillon-stark-county-oh", "state": "oh", "kind": "facility", "name": "Bitdeer Massillon Facility", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Stark" ], "city": "Massillon", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. White Tail Creek LLC affiliation/tenancy with Bitdeer is not established by this response. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://scgisa.starkcountyohio.gov/arcgis/rest/services/Auditor/StarkCountyParcels/MapServer/0/query?where=PIN%3D%2710018541%27&outFields=*&f=json", "host": "scgisa.starkcountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.82582, "lng": -81.3784, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PIN": "10018541", "SITE_ADDRESS": " 1115 INDUSTRIAL AVE SW MASSILLON OH 44647 ", "ACRES": 29.64, "OWNER": "WHITE TAIL CREEK LLC" } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "White Tail Creek LLC affiliation/tenancy with Bitdeer is not established by this response.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://scgisa.starkcountyohio.gov/arcgis/rest/services/Auditor/StarkCountyParcels/MapServer/0/query?where=PIN%3D%2710018541%27&outFields=*&f=json", "host": "scgisa.starkcountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Massillon · Stark · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39151" } }, { "id": "bitdeer-shalersville-portage-county-oh", "state": "oh", "kind": "facility", "name": "Bitdeer Shalersville Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Portage" ], "city": "Shalersville Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Relevant named facility/specification/article body, not all footer stories, linked contracts, certificates or all historical events.. Original News5 interviews, metadata published May28,2026, identify Bitdeer contract to buy approximately257ac at Geis TurnpikeCommerceCenter Shalersville. Contract is not closedlandpurchase. Initial150MW/potential750MW have undefinedbasis and are nested, not900MWtotal. Fifteen-building concept includes two initial halls and office plus12later halls; not15built facilities or existing750MWIT. Reported350gpdwater is firstgroup projection, not full-campus actual usage. More than300Mconstruction excludes computer equipment.30 to 50initialjobs/150 to 200ultimate and2.17Mannualpropertytax with offeredshortfallmakeup are forecasts/promises, not paidtaxes/executedagreement. Reported mora until earlyNovember needs exact adoptedinstrument; no legal enddate certified. June16publicmeeting scheduled from Mayreport is historical, not a newly scheduledOctobermeeting/outcome. No currentapproval inferred. Massillon31ac/26buildings/Octobercompletiontarget refers to OTHERsite. Source classes and project/date/power/water/financial-scope limitations apply. Not all-field or current-site certification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.news5cleveland.com/news/local-news/local-developer-global-tech-firm-plan-major-data-center-project-in-portage-county", "host": "news5cleveland.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 41.16773, "lng": -81.19745, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "border-states-and-named-operator-review-round53-2026-10-15.json", "scope": "Relevant named facility/specification/article body, not all footer stories, linked contracts, certificates or all historical events.", "fields": {}, "notes": [ "Original News5 interviews, metadata published May28,2026, identify Bitdeer contract to buy approximately257ac at Geis TurnpikeCommerceCenter Shalersville. Contract is not closedlandpurchase.", "Initial150MW/potential750MW have undefinedbasis and are nested, not900MWtotal. Fifteen-building concept includes two initial halls and office plus12later halls; not15built facilities or existing750MWIT.", "Reported350gpdwater is firstgroup projection, not full-campus actual usage. More than300Mconstruction excludes computer equipment.30 to 50initialjobs/150 to 200ultimate and2.17Mannualpropertytax with offeredshortfallmakeup are forecasts/promises, not paidtaxes/executedagreement.", "Reported mora until earlyNovember needs exact adoptedinstrument; no legal enddate certified. June16publicmeeting scheduled from Mayreport is historical, not a newly scheduledOctobermeeting/outcome. No currentapproval inferred. Massillon31ac/26buildings/Octobercompletiontarget refers to OTHERsite.", "Source classes and project/date/power/water/financial-scope limitations apply. Not all-field or current-site certification." ], "sources": [ { "url": "https://www.news5cleveland.com/news/local-news/local-developer-global-tech-firm-plan-major-data-center-project-in-portage-county", "host": "news5cleveland.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Shalersville Township · Portage · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39133" } }, { "id": "bristolville-25-lordstown-oh", "state": "oh", "kind": "facility", "name": "Bristolville 25", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Trumbull" ], "city": "Lordstown", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Originaloperator/localreporter orvisibleoriginalregulatorycopy, stage/date/numericalscopeexplicit.. DanOBrien/BusinessJournalDaily November14,2025 original report says Bristolville25DeveloperLLC/BHGHProperties petitioned OhioSupremeCourt to compel Lordstown site-plan review. Petitioners allegationsof proceduralfailure and village response about missing stormwater/utility/wetlandmaterials are opposingpositions, not a court ruling. Originaldocket/currentjudgment unread. ReportedNov3council6 to 0future-data-centerban withDec3effective date describes2025sequence; not verifiedcurrentordinance or all-later-moratorium outcome. Oct20submissionbeforeban doesnotbyitself establish vestedrights/approval. $3.6B/roughly130acres nearRoute45/ReutherDrive are proposal figures; partinJacksonTownshipMahoningCounty, not entirelyLordstown. SeparatefromSoftBank/FoxconnStargateproject. Notallfield/currentoperatingcensus/fullyexecutedcontract/actualpaymentorimpactcertification.", "date": "", "events": [ [ "2026-10-20", "The Supreme Court of Ohio decided case 2025 1497 on October 20, 2026 and denied Bristolville request for a mandamus writ compelling Lordstown site plan review. This is a denial of requested judicial relief about review duties, not a finding of physical closure or computing operation, and not a completed final construction permit decision." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://businessjournaldaily.com/developers-petition-ohio-supreme-court-in-lordstown-data-center-project/", "host": "businessjournaldaily.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://courtnewsohio.gov/cases/2026/SCO/1020/251497.asp", "host": "courtnewsohio.gov", "published": "2026-10-20", "date": "2026-10-20", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.supremecourt.ohio.gov/rod/docs/pdf/0/2026/2026-Ohio-4073.pdf", "host": "www.supremecourt.ohio.gov", "published": "2026-10-20", "date": "2026-10-20", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.32945, "lng": -80.7748, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "border-state-permit-execution-and-capacity-scope-review-round71-2026-10-15.json", "scope": "Originaloperator/localreporter orvisibleoriginalregulatorycopy, stage/date/numericalscopeexplicit.", "fields": {}, "notes": [ "DanOBrien/BusinessJournalDaily November14,2025 original report says Bristolville25DeveloperLLC/BHGHProperties petitioned OhioSupremeCourt to compel Lordstown site-plan review. Petitioners allegationsof proceduralfailure and village response about missing stormwater/utility/wetlandmaterials are opposingpositions, not a court ruling. Originaldocket/currentjudgment unread.", "ReportedNov3council6 to 0future-data-centerban withDec3effective date describes2025sequence; not verifiedcurrentordinance or all-later-moratorium outcome. Oct20submissionbeforeban doesnotbyitself establish vestedrights/approval. $3.6B/roughly130acres nearRoute45/ReutherDrive are proposal figures; partinJacksonTownshipMahoningCounty, not entirelyLordstown. SeparatefromSoftBank/FoxconnStargateproject.", "Notallfield/currentoperatingcensus/fullyexecutedcontract/actualpaymentorimpactcertification." ], "sources": [ { "url": "https://businessjournaldaily.com/developers-petition-ohio-supreme-court-in-lordstown-data-center-project/", "host": "businessjournaldaily.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The October 20, 2026 original Supreme Court slip opinion in case 2025 1497 denies the Bristolville mandamus writ seeking continued site plan review under the prior ordinances. Selected paragraphs identify the named developer project, the moratorium and the legal basis for denying compelled review. This is a specific judicial outcome about a review duty, not independent certification of the campus physical stage, computing operation, a denied final construction permit or permanent closure. The information office summary is read alongside the actual selected opinion rather than substituted for the holding.", "fields": { "current_stage_evidence": { "outcome": "original_current_mandamus_outcome_physical_stage_held", "scope": "The October 20, 2026 original Supreme Court slip opinion in case 2025 1497 denies the Bristolville mandamus writ seeking continued site plan review under the prior ordinances. Selected paragraphs identify the named developer project, the moratorium and the legal basis for denying compelled review. This is a specific judicial outcome about a review duty, not independent certification of the campus physical stage, computing operation, a denied final construction permit or permanent closure. The information office summary is read alongside the actual selected opinion rather than substituted for the holding." }, "source_read_scope": { "opinion_selected_text_pages": [ 1, 2, 7, 19 ], "opinion_selected_paragraphs": [ 1, 2, 3, 16, 17, 48, 49 ], "full_opinion_not_claimed_read": true, "official_information_summary_read_with_selected_actual_holding": true, "temporary_moratorium_not_permanent_project_cancellation": true } }, "notes": [ "The October 20, 2026 original Supreme Court slip opinion in case 2025 1497 denies the Bristolville mandamus writ seeking continued site plan review under the prior ordinances. Selected paragraphs identify the named developer project, the moratorium and the legal basis for denying compelled review. This is a specific judicial outcome about a review duty, not independent certification of the campus physical stage, computing operation, a denied final construction permit or permanent closure. The information office summary is read alongside the actual selected opinion rather than substituted for the holding.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://courtnewsohio.gov/cases/2026/SCO/1020/251497.asp", "host": "courtnewsohio.gov", "published": "2026-10-20", "date": "2026-10-20", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.supremecourt.ohio.gov/rod/docs/pdf/0/2026/2026-Ohio-4073.pdf", "host": "www.supremecourt.ohio.gov", "published": "2026-10-20", "date": "2026-10-20", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lordstown · Trumbull · Source context reviewed", "event_evidence": [ { "date": "2026-10-20", "text": "The Supreme Court of Ohio decided case 2025 1497 on October 20, 2026 and denied Bristolville request for a mandamus writ compelling Lordstown site plan review. This is a denial of requested judicial relief about review duties, not a finding of physical closure or computing operation, and not a completed final construction permit decision.", "kind": "denied", "sources": [ { "url": "https://courtnewsohio.gov/cases/2026/SCO/1020/251497.asp", "host": "courtnewsohio.gov", "published": "2026-10-20", "date": "2026-10-20", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.supremecourt.ohio.gov/rod/docs/pdf/0/2026/2026-Ohio-4073.pdf", "host": "www.supremecourt.ohio.gov", "published": "2026-10-20", "date": "2026-10-20", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39155" } }, { "id": "cipher-digital-ulysses-center-township-morgan-oh", "state": "oh", "kind": "facility", "name": "Cipher Digital Ulysses", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Morgan" ], "city": "", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.. Two-hundred MW is secured power-site capacity, not verified critical IT or operating supply. Purchase price and intended initial workload undisclosed. Original utility agreements not reviewed. Subsequent original decisions and current operator disclosures take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://theenergymag.com/news/2025-12-23/cipher-ohio-hpc-pjm", "host": "theenergymag.com", "date": "2025-12-23", "published": "2025-12-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 39.62053, "lng": -81.85381, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round24-2026-10-14.json", "scope": "Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.", "fields": { "reported_context": "EnergyMag reports Cipher Ulysses Ohio land/power-site acquisition and Q42027 energization target.", "independently_verified_current_operating_status": null }, "notes": [ "Two-hundred MW is secured power-site capacity, not verified critical IT or operating supply. Purchase price and intended initial workload undisclosed. Original utility agreements not reviewed.", "Subsequent original decisions and current operator disclosures take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://theenergymag.com/news/2025-12-23/cipher-ohio-hpc-pjm", "host": "theenergymag.com", "date": "2025-12-23", "published": "2025-12-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Morgan · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39115" } }, { "id": "cogent-akron-summit-county-oh", "state": "oh", "kind": "facility", "name": "Cogent Data Center Akron", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Summit" ], "city": "Akron", "address": "", "who": "Cogent Communications", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. RegionalpagealsoincludesCleveland1621Euclid5000andCleveland22650Rockefeller5804; thosearenotAkronareaoraddresses. Spacebasisnotexplicitwhitefloor. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.cogentco.com/en/cogent-cleveland/471-akron-dc", "host": "cogentco.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=120+N+Broadway+St%2C+Akron%2C+OH+44304&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Calculated Census street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-81.51751167230587%2C41.08409136039453%2C-81.50916870262613%2C41.090379538619466&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Aerial setting only, acquisition date unknown" }, { "url": "https://www.cogentco.com/en/network/service-locations?action=search&continent=&country=United+States&metro=&site_type=CDC&state=", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact named facility CDC row, separate from network presence" }, { "url": "https://www.cogentco.com/en/network/cogent-data-centers", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Provider explanation of Cogent data center and colocation relationships" } ], "loc": { "lng": -81.513340187466, "lat": 41.087235449507, "precision": "address", "basis": "Published Cogent Communications facility address 120 N Broadway St, Akron, OH 44304 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "published_address": "120 N Broadway St, Akron, OH44304", "operator_labeled_space_sqft": 50747 }, "notes": [ "RegionalpagealsoincludesCleveland1621Euclid5000andCleveland22650Rockefeller5804; thosearenotAkronareaoraddresses. Spacebasisnotexplicitwhitefloor.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.cogentco.com/en/cogent-cleveland/471-akron-dc", "host": "cogentco.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "Cogent lists current cabinets, connectivity and controlled data-center access for the named Akron facility, separate from two Cleveland facilities. Other on-net office buildings are excluded. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "Cogent lists current cabinets, connectivity and controlled data-center access for the named Akron facility, separate from two Cleveland facilities. Other on-net office buildings are excluded. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "Cogent lists current cabinets, connectivity and controlled data-center access for the named Akron facility, separate from two Cleveland facilities. Other on-net office buildings are excluded." ], "sources": [ { "url": "https://www.cogentco.com/en/cogent-cleveland/471-akron-dc", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 16, October 23, 2026", "scope": "Current official facility street reference only. Native protected facts and canonical address remain exact.", "fields": { "location_review_decision": { "location": { "lng": -81.513340187466, "lat": 41.087235449507, "precision": "address", "basis": "Published Cogent Communications facility address 120 N Broadway St, Akron, OH 44304 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, full campus, floor, suite or ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "120 N Broadway St, Akron, OH 44304", "county_fips": [ "39153" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named official numeric facility section binds the service address to this existing research record. Corporate offices, related facility cards and embedded map coordinates are excluded.", "The unique Census calculated street range agrees with the retained state and county. Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. The reference does not locate a surveyed roof, parcel, full campus, legal owner, floor or suite.", "All canonical address, status, physical dates, quantity, role, identity and jurisdiction wrappers remain exact. The retained Census method source keeps its actual October 22 date; new captures are dated October 23." ], "sources": [ { "url": "https://www.cogentco.com/en/cogent-cleveland/471-akron-dc", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Official named Akron Data Center numeric facility address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=120+N+Broadway+St%2C+Akron%2C+OH+44304&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Calculated Census street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-81.51751167230587%2C41.08409136039453%2C-81.50916870262613%2C41.090379538619466&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Aerial setting only, acquisition date unknown" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check 28, October 23, 2026", "scope": "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes.", "fields": { "company_association": { "name": "Cogent Communications", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes." }, "provider_role": "operator" }, "notes": [ "Cogent lists the named retained facility in its own CDC provider listing. Operator per source records its provider brand relationship, not legal property title, sole operation of a shared building or a separate legal entity. The source separates its data centers from other network connected buildings. No new physical site, identity merger, stage, opening date, street, county, coordinate, capacity or certification finding is adopted. Source publication dates remain unknown. Advertised service features are not independently measured outcomes." ], "sources": [ { "url": "https://www.cogentco.com/en/cogent-cleveland/471-akron-dc", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Named facility section and separate service street context" }, { "url": "https://www.cogentco.com/en/network/service-locations?action=search&continent=&country=United+States&metro=&site_type=CDC&state=", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact named facility CDC row, separate from network presence" }, { "url": "https://www.cogentco.com/en/network/cogent-data-centers", "host": "www.cogentco.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Provider explanation of Cogent data center and colocation relationships" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Akron · Summit · Source context reviewed", "status_scope": "Cogent lists current cabinets, connectivity and controlled data-center access for the named Akron facility, separate from two Cleveland facilities. Other on-net office buildings are excluded. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "cologix-col1-columbus-oh", "state": "oh", "kind": "facility", "name": "Cologix COL1 (Columbus)", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Columbus", "address": "", "who": "Cologix", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Cologix four named Columbus sites and regional context. Regional uptime/network counts not independent measured performance of each site. COL3 operator certification claim not independently checked in certifier register. Preleasing COL7/COL8 in Johnstown does not establish operations or new base records; COL5 distinct not assigned to these four IDs. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://cologix.com/data-centers/columbus/", "host": "cologix.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://cologix.com/data-centers/columbus/col1/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=535+Scherers+Court%2C+Columbus%2C+OH&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPImagery/ImageServer/exportImage?bbox=-83.0057486687349%2C40.11380955704903%2C-82.9987006570191%2C40.11919942409897&bboxSR=4326&imageSR=4326&size=1000%2C1000&format=jpg&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Aerial setting context only, acquisition date not established" } ], "loc": { "lat": 40.116504490574, "lng": -83.002224662877, "precision": "address", "basis": "Published Cologix facility address 535 Scherers Court, Columbus, Ohio matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "operator-discovery-review-round8-2026-10-14.json", "scope": "Cologix four named Columbus sites and regional context", "fields": { "named_sites": [ { "code": "COL1", "address": "535 Scherers Court, Columbus, Ohio" }, { "code": "COL2", "address": "555 Scherers Court, Columbus, Ohio" }, { "code": "COL3", "address": "585 Scherers Court, Columbus, Ohio", "published_area_sqft": 160000, "advertised_capacity_mw_min_exclusive": 18, "power_basis": "not explicit critical IT" }, { "code": "COL4", "address": "7500 Alta View, Columbus, Ohio" } ] }, "notes": [ "Regional uptime/network counts not independent measured performance of each site. COL3 operator certification claim not independently checked in certifier register. Preleasing COL7/COL8 in Johnstown does not establish operations or new base records; COL5 distinct not assigned to these four IDs.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/", "host": "cologix.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "Cologix describes COL1 as an owned and operated colocation data center with cabinets, cages and private suites available. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "Cologix describes COL1 as an owned and operated colocation data center with cabinets, cages and private suites available. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "Cologix describes COL1 as an owned and operated colocation data center with cabinets, cages and private suites available." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col1/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 12, October 22, 2026", "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 40.116504490574, "lng": -83.002224662877, "precision": "address", "basis": "Published Cologix facility address 535 Scherers Court, Columbus, Ohio matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "535 Scherers Court, Columbus, Ohio", "county_fips": [ "39049" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The current official numeric facility section identifies this existing research record. All prior native address and status wrappers remain exact. Corporate headquarters, related facility cards and operator map coordinates are excluded.", "The numeric street, name, type and directions are explicitly matched to the single Census result. State and existing county agree. The image center is on or beside a street in an industrial or office setting. Nearby housing is not selected as a facility reference. No roof, parcel or title is identified from appearance.", "Official USGS aerial setting context was visually reviewed. The acquisition date is not established and may predate construction. No aerial coordinate, commissioning date, current operation, property ownership, surveyed roof or full campus is adopted.", "The source writes the state name in full while the Census query uses its postal abbreviation. The source has no published postal code in this address section; no returned Census postal code is claimed as operator published. Related location cards are excluded.", "COL1, COL2 and COL3 publish distinct street numbers along Scherers Court. Their calculated street points are close together and do not establish three independently located roofs or a physical building count." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col1/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named COL1 numeric street section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=535+Scherers+Court%2C+Columbus%2C+OH&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPImagery/ImageServer/exportImage?bbox=-83.0057486687349%2C40.11380955704903%2C-82.9987006570191%2C40.11919942409897&bboxSR=4326&imageSR=4326&size=1000%2C1000&format=jpg&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Aerial setting context only, acquisition date not established" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 16, October 23, 2026", "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The operator role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The exact COL code and separate street are retained. A shared campus and fiber network do not merge COL1, COL2, COL3 or their power scopes. Marketing and specification quantities are not treated as measurements.", "fields": { "company_association": { "name": "Cologix", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The operator role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The exact COL code and separate street are retained. A shared campus and fiber network do not merge COL1, COL2, COL3 or their power scopes. Marketing and specification quantities are not treated as measurements." }, "provider_role": "operator" }, "notes": [ "Cologix explicitly identifies the retained named code or grouped campus in its own source. The operator role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The exact COL code and separate street are retained. A shared campus and fiber network do not merge COL1, COL2, COL3 or their power scopes. Marketing and specification quantities are not treated as measurements.", "Publication dates, retrieval dates, targets and physical milestones stay separate. Raw response hashes remain original; gzip text derivatives are retained separately." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col1/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact code or campus text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Columbus · Franklin · Source context reviewed", "status_scope": "Cologix describes COL1 as an owned and operated colocation data center with cabinets, cages and private suites available. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "cologix-col2-columbus-oh", "state": "oh", "kind": "facility", "name": "Cologix COL2 (Columbus)", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Columbus", "address": "", "who": "Cologix", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Cologix four named Columbus sites and regional context. Regional uptime/network counts not independent measured performance of each site. COL3 operator certification claim not independently checked in certifier register. Preleasing COL7/COL8 in Johnstown does not establish operations or new base records; COL5 distinct not assigned to these four IDs. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://cologix.com/data-centers/columbus/", "host": "cologix.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://cologix.com/data-centers/columbus/col2/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=555+Scherers+Court%2C+Columbus%2C+OH&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPImagery/ImageServer/exportImage?bbox=-83.00557420800102%2C40.11380238129303%2C-82.99852619702897%2C40.11919224834297&bboxSR=4326&imageSR=4326&size=1000%2C1000&format=jpg&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Aerial setting context only, acquisition date not established" } ], "loc": { "lat": 40.116497314818, "lng": -83.002050202515, "precision": "address", "basis": "Published Cologix facility address 555 Scherers Court, Columbus, Ohio matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "operator-discovery-review-round8-2026-10-14.json", "scope": "Cologix four named Columbus sites and regional context", "fields": { "named_sites": [ { "code": "COL1", "address": "535 Scherers Court, Columbus, Ohio" }, { "code": "COL2", "address": "555 Scherers Court, Columbus, Ohio" }, { "code": "COL3", "address": "585 Scherers Court, Columbus, Ohio", "published_area_sqft": 160000, "advertised_capacity_mw_min_exclusive": 18, "power_basis": "not explicit critical IT" }, { "code": "COL4", "address": "7500 Alta View, Columbus, Ohio" } ] }, "notes": [ "Regional uptime/network counts not independent measured performance of each site. COL3 operator certification claim not independently checked in certifier register. Preleasing COL7/COL8 in Johnstown does not establish operations or new base records; COL5 distinct not assigned to these four IDs.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/", "host": "cologix.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "Cologix states that COL2 provides colocation services to clients and identifies the facility as owned and operated. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "Cologix states that COL2 provides colocation services to clients and identifies the facility as owned and operated. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "Cologix states that COL2 provides colocation services to clients and identifies the facility as owned and operated." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col2/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 12, October 22, 2026", "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 40.116497314818, "lng": -83.002050202515, "precision": "address", "basis": "Published Cologix facility address 555 Scherers Court, Columbus, Ohio matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "555 Scherers Court, Columbus, Ohio", "county_fips": [ "39049" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The current official numeric facility section identifies this existing research record. All prior native address and status wrappers remain exact. Corporate headquarters, related facility cards and operator map coordinates are excluded.", "The numeric street, name, type and directions are explicitly matched to the single Census result. State and existing county agree. The image center is on or beside a street in an industrial or office setting. Nearby housing is not selected as a facility reference. No roof, parcel or title is identified from appearance.", "Official USGS aerial setting context was visually reviewed. The acquisition date is not established and may predate construction. No aerial coordinate, commissioning date, current operation, property ownership, surveyed roof or full campus is adopted.", "The source writes the state name in full while the Census query uses its postal abbreviation. The source has no published postal code in this address section; no returned Census postal code is claimed as operator published. Related location cards are excluded.", "COL1, COL2 and COL3 publish distinct street numbers along Scherers Court. Their calculated street points are close together and do not establish three independently located roofs or a physical building count." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col2/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named COL2 numeric street section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=555+Scherers+Court%2C+Columbus%2C+OH&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPImagery/ImageServer/exportImage?bbox=-83.00557420800102%2C40.11380238129303%2C-82.99852619702897%2C40.11919224834297&bboxSR=4326&imageSR=4326&size=1000%2C1000&format=jpg&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Aerial setting context only, acquisition date not established" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 16, October 23, 2026", "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The operator role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The exact COL code and separate street are retained. A shared campus and fiber network do not merge COL1, COL2, COL3 or their power scopes. Marketing and specification quantities are not treated as measurements.", "fields": { "company_association": { "name": "Cologix", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The operator role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The exact COL code and separate street are retained. A shared campus and fiber network do not merge COL1, COL2, COL3 or their power scopes. Marketing and specification quantities are not treated as measurements." }, "provider_role": "operator" }, "notes": [ "Cologix explicitly identifies the retained named code or grouped campus in its own source. The operator role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The exact COL code and separate street are retained. A shared campus and fiber network do not merge COL1, COL2, COL3 or their power scopes. Marketing and specification quantities are not treated as measurements.", "Publication dates, retrieval dates, targets and physical milestones stay separate. Raw response hashes remain original; gzip text derivatives are retained separately." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col2/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact code or campus text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Columbus · Franklin · Source context reviewed", "status_scope": "Cologix states that COL2 provides colocation services to clients and identifies the facility as owned and operated. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "cologix-col3-columbus-oh", "state": "oh", "kind": "facility", "name": "Cologix COL3 (Columbus)", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Columbus", "address": "", "who": "Cologix", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Cologix four named Columbus sites and regional context. Regional uptime/network counts not independent measured performance of each site. COL3 operator certification claim not independently checked in certifier register. Preleasing COL7/COL8 in Johnstown does not establish operations or new base records; COL5 distinct not assigned to these four IDs. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://cologix.com/data-centers/columbus/", "host": "cologix.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://cologix.com/data-centers/columbus/col3/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=585+Scherers+Court%2C+Columbus%2C+OH&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPImagery/ImageServer/exportImage?bbox=-83.00531251690022%2C40.11379161765803%2C-82.99826450704377%2C40.11918148470797&bboxSR=4326&imageSR=4326&size=800%2C800&format=jpg&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Aerial setting context only, acquisition date not established" } ], "loc": { "lat": 40.116486551183, "lng": -83.001788511972, "precision": "address", "basis": "Published Cologix facility address 585 Scherers Court, Columbus, Ohio matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "operator-discovery-review-round8-2026-10-14.json", "scope": "Cologix four named Columbus sites and regional context", "fields": { "named_sites": [ { "code": "COL1", "address": "535 Scherers Court, Columbus, Ohio" }, { "code": "COL2", "address": "555 Scherers Court, Columbus, Ohio" }, { "code": "COL3", "address": "585 Scherers Court, Columbus, Ohio", "published_area_sqft": 160000, "advertised_capacity_mw_min_exclusive": 18, "power_basis": "not explicit critical IT" }, { "code": "COL4", "address": "7500 Alta View, Columbus, Ohio" } ] }, "notes": [ "Regional uptime/network counts not independent measured performance of each site. COL3 operator certification claim not independently checked in certifier register. Preleasing COL7/COL8 in Johnstown does not establish operations or new base records; COL5 distinct not assigned to these four IDs.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/", "host": "cologix.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "Cologix describes COL3 as an owned and operated constructed facility offering scalable colocation services. Its power and certification claims are not independently certified by this review. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "Cologix describes COL3 as an owned and operated constructed facility offering scalable colocation services. Its power and certification claims are not independently certified by this review. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "Cologix describes COL3 as an owned and operated constructed facility offering scalable colocation services. Its power and certification claims are not independently certified by this review." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col3/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 12, October 22, 2026", "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 40.116486551183, "lng": -83.001788511972, "precision": "address", "basis": "Published Cologix facility address 585 Scherers Court, Columbus, Ohio matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "585 Scherers Court, Columbus, Ohio", "county_fips": [ "39049" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The current official numeric facility section identifies this existing research record. All prior native address and status wrappers remain exact. Corporate headquarters, related facility cards and operator map coordinates are excluded.", "The numeric street, name, type and directions are explicitly matched to the single Census result. State and existing county agree. The image center is on or beside a street in an industrial or office setting. Nearby housing is not selected as a facility reference. No roof, parcel or title is identified from appearance.", "Official USGS aerial setting context was visually reviewed. The acquisition date is not established and may predate construction. No aerial coordinate, commissioning date, current operation, property ownership, surveyed roof or full campus is adopted.", "The source writes the state name in full while the Census query uses its postal abbreviation. The source has no published postal code in this address section; no returned Census postal code is claimed as operator published. Related location cards are excluded.", "COL1, COL2 and COL3 publish distinct street numbers along Scherers Court. Their calculated street points are close together and do not establish three independently located roofs or a physical building count." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col3/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named COL3 numeric street section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=585+Scherers+Court%2C+Columbus%2C+OH&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPImagery/ImageServer/exportImage?bbox=-83.00531251690022%2C40.11379161765803%2C-82.99826450704377%2C40.11918148470797&bboxSR=4326&imageSR=4326&size=800%2C800&format=jpg&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Aerial setting context only, acquisition date not established" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 16, October 23, 2026", "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The operator role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The exact COL code and separate street are retained. A shared campus and fiber network do not merge COL1, COL2, COL3 or their power scopes. Marketing and specification quantities are not treated as measurements.", "fields": { "company_association": { "name": "Cologix", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The operator role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The exact COL code and separate street are retained. A shared campus and fiber network do not merge COL1, COL2, COL3 or their power scopes. Marketing and specification quantities are not treated as measurements." }, "provider_role": "operator" }, "notes": [ "Cologix explicitly identifies the retained named code or grouped campus in its own source. The operator role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The exact COL code and separate street are retained. A shared campus and fiber network do not merge COL1, COL2, COL3 or their power scopes. Marketing and specification quantities are not treated as measurements.", "Publication dates, retrieval dates, targets and physical milestones stay separate. Raw response hashes remain original; gzip text derivatives are retained separately." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col3/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact code or campus text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Columbus · Franklin · Source context reviewed", "status_scope": "Cologix describes COL3 as an owned and operated constructed facility offering scalable colocation services. Its power and certification claims are not independently certified by this review. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "cologix-col4-columbus-oh", "state": "oh", "kind": "facility", "name": "Cologix COL4 (Columbus)", "group": "proposed", "status": "Operator-listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Columbus", "address": "", "who": "Cologix", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Preferred source is a Columbus market page. Current text does not establish COL4 site capacity or status; linked site-specific specification needs a separate review. Corporate financing headlines are unrelated. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Cologix four named Columbus sites and regional context. Regional uptime/network counts not independent measured performance of each site. COL3 operator certification claim not independently checked in certifier register. Preleasing COL7/COL8 in Johnstown does not establish operations or new base records; COL5 distinct not assigned to these four IDs.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://cologix.com/data-centers/columbus/", "host": "cologix.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://cologix.com/data-centers/columbus/col4/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID+IN+%28%27610-207094%27%2C%27610207094%27%29&outFields=OBJECTID%2CPARCELID%2CLOWPARCELID%2CSITEADDRESS%2CZIPCD&returnGeometry=true&outSR=4326&f=json", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Official reference tax parcel polygon and exact address identifier" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.00355144026356%2C40.115015910887536%2C-82.99532855973645%2C40.12130408911247&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting context only, acquisition date unknown" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/Addressing/LBRS/FeatureServer/0/query?where=ADDR_NUM%3D%277500%27+AND+UPPER%28STR_NAME%29+LIKE+%27%25ALTA%25VIEW%25%27&outFields=OBJECTID%2CADDR_NUM%2CPRE_DIR%2CSTR_NAME%2CSTR_TYPE%2CSUF_DIR%2CCITY%2CUSPS_CITY%2CCOUNTY%2CSTATE%2CZIP%2CPID%2CGIS_MAINT_AUTH%2CSOURCE&returnGeometry=true&outSR=4326&f=json", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Official reference parcel method, address corroboration or dataset limits" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0?f=pjson", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Official reference parcel method, address corroboration or dataset limits" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/Addressing/LBRS/FeatureServer/0?f=pjson", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Official reference parcel method, address corroboration or dataset limits" }, { "url": "https://cologix.com/news/cologix-first-colocation-provider-to-complete-ai-ready-data-center-columbus/", "host": "cologix.com", "published": "2024-05-23", "date": "2024-05-23", "checked": "2026-10-23", "label": "First party exact code or campus text, scoped provider relationship reviewed" } ], "loc": { "lng": -82.99944, "lat": 40.11816, "precision": "approximate", "basis": "Approximate reference parcel center for the published Cologix address 7500 Alta View, Columbus, Ohio. Official tax map reference 610-207094 only, not a roof, surveyed title, tenant floor or full campus. Aerial acquisition date is unknown and may predate construction. Existing native status remains proposed." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": {}, "notes": [ "Preferred source is a Columbus market page. Current text does not establish COL4 site capacity or status; linked site-specific specification needs a separate review. Corporate financing headlines are unrelated.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/", "host": "cologix.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "operator-discovery-review-round8-2026-10-14.json", "scope": "Cologix four named Columbus sites and regional context", "fields": { "named_sites": [ { "code": "COL1", "address": "535 Scherers Court, Columbus, Ohio" }, { "code": "COL2", "address": "555 Scherers Court, Columbus, Ohio" }, { "code": "COL3", "address": "585 Scherers Court, Columbus, Ohio", "published_area_sqft": 160000, "advertised_capacity_mw_min_exclusive": 18, "power_basis": "not explicit critical IT" }, { "code": "COL4", "address": "7500 Alta View, Columbus, Ohio" } ] }, "notes": [ "Regional uptime/network counts not independent measured performance of each site. COL3 operator certification claim not independently checked in certifier register. Preleasing COL7/COL8 in Johnstown does not establish operations or new base records; COL5 distinct not assigned to these four IDs.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/", "host": "cologix.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "Cologix lists COL4 as a development whose capacity will be offered. Current support boilerplate does not establish physical construction or commissioning. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_development", "scope": "Cologix lists COL4 as a development whose capacity will be offered. Current support boilerplate does not establish physical construction or commissioning. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "Cologix lists COL4 as a development whose capacity will be offered. Current support boilerplate does not establish physical construction or commissioning." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col4/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 20, October 23, 2026", "scope": "Approximate remains approximate. This is a reference to the published service address and county tax map parcel only. No legal title, property ownership, independent roof, complete campus, tenant unit, floor or current operation is certified. Existing native status remains proposed.", "fields": { "location_review_decision": { "location": { "lng": -82.99944, "lat": 40.11816, "precision": "approximate", "basis": "Approximate reference parcel center for the published Cologix address 7500 Alta View, Columbus, Ohio. Official tax map reference 610-207094 only, not a roof, surveyed title, tenant floor or full campus. Aerial acquisition date is unknown and may predate construction. Existing native status remains proposed." }, "reference_method": "Approximate county reference parcel center", "reference_parcel": { "identifier": "610-207094", "objectid": 438186, "agency": "Franklin County Auditor and Engineer", "reference_method": "calculated_polygon_centroid", "not_survey_quality": true, "legal_title_verified": false, "independent_building_identity": false, "full_campus_verified": false, "operator_ownership_verified": false }, "operator_coordinates_adopted": false, "census_range_adopted": false } }, "notes": [ "The current named operator address is joined to an exact official government reference parcel address and identifier. The reference remains approximate; county map geometry is not a legal survey or a completed project finding.", "Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. No operator template coordinate, Census street range coordinate, residential roof, tenant suite or floor is selected.", "All original identity, status, physical dates, quantity, roles, canonical address and jurisdiction wrappers remain exact. All inherited location and source history remains retained. Raw parcel geometry is not exported.", "The operator publishes 7500 Alta View without a street type. A single official county physical address explicitly gives 7500 Alta View Boulevard, Columbus, Ohio 43085 and parcel PID 610-207094. That physical address point is inside the exact same county parcel. The parcel area center is used only as an approximate reference. The earlier ambiguous street matches remain excluded. Existing native status remains proposed; no opening or current operation is inferred." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col4/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Current named official facility service address" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID+IN+%28%27610-207094%27%2C%27610207094%27%29&outFields=OBJECTID%2CPARCELID%2CLOWPARCELID%2CSITEADDRESS%2CZIPCD&returnGeometry=true&outSR=4326&f=json", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Official reference tax parcel polygon and exact address identifier" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-83.00355144026356%2C40.115015910887536%2C-82.99532855973645%2C40.12130408911247&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting context only, acquisition date unknown" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/Addressing/LBRS/FeatureServer/0/query?where=ADDR_NUM%3D%277500%27+AND+UPPER%28STR_NAME%29+LIKE+%27%25ALTA%25VIEW%25%27&outFields=OBJECTID%2CADDR_NUM%2CPRE_DIR%2CSTR_NAME%2CSTR_TYPE%2CSUF_DIR%2CCITY%2CUSPS_CITY%2CCOUNTY%2CSTATE%2CZIP%2CPID%2CGIS_MAINT_AUTH%2CSOURCE&returnGeometry=true&outSR=4326&f=json", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Official reference parcel method, address corroboration or dataset limits" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0?f=pjson", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Official reference parcel method, address corroboration or dataset limits" }, { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/Addressing/LBRS/FeatureServer/0?f=pjson", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Official reference parcel method, address corroboration or dataset limits" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check 16, October 23, 2026", "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The developer role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The May 23, 2024 announcement explicitly reports Cologix development completion of COL4. Only that dated developer relationship is adopted; the current specification retains future capacity wording and different quantities. No new completion event, operating stage or delivered power is asserted.", "fields": { "company_association": { "name": "Cologix", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The developer role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The May 23, 2024 announcement explicitly reports Cologix development completion of COL4. Only that dated developer relationship is adopted; the current specification retains future capacity wording and different quantities. No new completion event, operating stage or delivered power is asserted." }, "provider_role": "developer" }, "notes": [ "Cologix explicitly identifies the retained named code or grouped campus in its own source. The developer role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The May 23, 2024 announcement explicitly reports Cologix development completion of COL4. Only that dated developer relationship is adopted; the current specification retains future capacity wording and different quantities. No new completion event, operating stage or delivered power is asserted.", "Publication dates, retrieval dates, targets and physical milestones stay separate. Raw response hashes remain original; gzip text derivatives are retained separately." ], "sources": [ { "url": "https://cologix.com/news/cologix-first-colocation-provider-to-complete-ai-ready-data-center-columbus/", "host": "cologix.com", "published": "2024-05-23", "date": "2024-05-23", "checked": "2026-10-23", "label": "First party exact code or campus text, scoped provider relationship reviewed" }, { "url": "https://cologix.com/data-centers/columbus/col4/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact code or campus text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Approximate reference parcel, not a surveyed building, status remains proposed", "summary": "Columbus · Franklin · Source context reviewed", "status_scope": "Cologix lists COL4 as a development whose capacity will be offered. Current support boilerplate does not establish physical construction or commissioning. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "cologix-col5-orange-township-delaware-county-oh", "state": "oh", "kind": "facility", "name": "Cologix COL5", "group": "proposed", "status": "Operator-listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Delaware" ], "city": "Lewis Center", "address": "", "who": "Cologix", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Cologix COL5 county-hosted secondary report. Countyhostingdoesnotmakethisprimarypermit/engineeringrecord. Newspaperreportquotescompanyforecasts;notactualspent,currentRFSorcurrenttenantlease.120MWcampusnotperbuilding. Separate154acJohnstownandfourpriorColumbuscentersotherprojects. DelawareCOUNTYOhio notDelawarestate. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://regionalplanning.co.delaware.oh.us/wp-content/uploads/sites/17/2025/06/ORA-Cologix-starts-work-06.18.25.pdf", "host": "regionalplanning.co.delaware.oh.us", "date": "2025-06-18", "published": "2025-06-18", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://cologix.com/data-centers/columbus/col5/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "loc": { "lat": 40.27844, "lng": -83.00484, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Cologix COL5 county-hosted secondary report", "fields": { "publisher_role": "Columbus Dispatch newspaper article hosted by county planning agency", "article_author": "Jim Weiker", "article_updated_date": "2025-06-18", "project": "Cologix COL5", "locality": "Green MeadowsDrive and HomeRoad, Orange Township, Delaware County, Ohio", "reported_site_acres": 28, "reported_planned_investment_usd": 1000000000, "reported_eventual_capacity_mw": 120, "power_basis": "reported capacity, not explicitly critical IT", "reported_initial_phase_sqft": 135000, "reported_initial_phase_completion_target": "fall2026" }, "notes": [ "Countyhostingdoesnotmakethisprimarypermit/engineeringrecord. Newspaperreportquotescompanyforecasts;notactualspent,currentRFSorcurrenttenantlease.120MWcampusnotperbuilding. Separate154acJohnstownandfourpriorColumbuscentersotherprojects. DelawareCOUNTYOhio notDelawarestate.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://regionalplanning.co.delaware.oh.us/wp-content/uploads/sites/17/2025/06/ORA-Cologix-starts-work-06.18.25.pdf", "host": "regionalplanning.co.delaware.oh.us", "date": "2025-06-18", "published": "2025-06-18", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "Cologix lists COL5 with an expected ready-for-service target of the third quarter of 2026 and future service wording. That elapsed target is not proof of commissioning; actual operation remains unverified. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_development", "scope": "Cologix lists COL5 with an expected ready-for-service target of the third quarter of 2026 and future service wording. That elapsed target is not proof of commissioning; actual operation remains unverified. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "Cologix lists COL5 with an expected ready-for-service target of the third quarter of 2026 and future service wording. That elapsed target is not proof of commissioning; actual operation remains unverified." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col5/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Company role source check 16, October 23, 2026", "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The developer role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. Current COL5 text forecasts service in the third quarter of 2026. That elapsed target does not establish actual delivery or operation. The proposed additional facility and current COL7 or COL8 marketing are not transferred to this record.", "fields": { "company_association": { "name": "Cologix", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The developer role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. Current COL5 text forecasts service in the third quarter of 2026. That elapsed target does not establish actual delivery or operation. The proposed additional facility and current COL7 or COL8 marketing are not transferred to this record." }, "provider_role": "developer" }, "notes": [ "Cologix explicitly identifies the retained named code or grouped campus in its own source. The developer role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. Current COL5 text forecasts service in the third quarter of 2026. That elapsed target does not establish actual delivery or operation. The proposed additional facility and current COL7 or COL8 marketing are not transferred to this record.", "Publication dates, retrieval dates, targets and physical milestones stay separate. Raw response hashes remain original; gzip text derivatives are retained separately." ], "sources": [ { "url": "https://cologix.com/data-centers/columbus/col5/", "host": "cologix.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact code or campus text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lewis Center · Delaware · Source context reviewed", "status_scope": "Cologix lists COL5 with an expected ready-for-service target of the third quarter of 2026 and future service wording. That elapsed target is not proof of commissioning; actual operation remains unverified. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39041" } }, { "id": "cologix-johnstown-oh", "state": "oh", "kind": "facility", "name": "Cologix Johnstown AI-Ready Campus", "group": "proposed", "status": "Announced development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "Johnstown", "address": "", "who": "Cologix", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Potential800MWnot energized. ExistingColumbus500k/80MWportfolio not Johnstowncampus.525Msecuritizationnav not siteinvestment. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2024-11-20", "Cologix published its Johnstown land acquisition and planned campus release on November 20, 2024. The anticipated 2025 first phase development remains a forecast in that source. This is the release date, not an exact construction start, power delivery or opening." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://cologix.com/news/cologix-expands-central-ohio-footprint-with-land-acquisition-for-new-ai-ready-800mw-data-center-campus/", "host": "cologix.com", "date": "2024-11-20", "published": "2024-11-20", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 40.06972, "lng": -82.44875, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "remaining-operators-review-round5-2026-10-14.json", "scope": "named operator source", "fields": { "planned_investment_usd_min_exclusive": 7000000000, "land_acres_approx": 154, "full_build_planned_buildings": 8, "potential_campus_capacity_mw": 800, "power_basis": "potential capacity, not explicitlyIT", "planned_campus_area_sqft": 2000000, "first_phase_development_start_target_year": 2025 }, "notes": [ "Potential800MWnot energized. ExistingColumbus500k/80MWportfolio not Johnstowncampus.525Msecuritizationnav not siteinvestment.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://cologix.com/news/cologix-expands-central-ohio-footprint-with-land-acquisition-for-new-ai-ready-800mw-data-center-campus/", "host": "cologix.com", "date": "2024-11-20", "published": "2024-11-20", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 19", "scope": "Cologix November 20, 2024 release announces a Johnstown land acquisition and planned data center campus. Announced development describes that dated proposal. Its anticipated 2025 first phase development is a forecast, not evidence that construction occurred. Existing Columbus operations and facilities completed elsewhere are separate. The current Johnstown physical stage and operation remain unverified.", "fields": { "current_stage_evidence": { "outcome": "dated_johnstown_acquisition_not_current_columbus_operation", "scope": "Cologix November 20, 2024 release announces a Johnstown land acquisition and planned data center campus. Announced development describes that dated proposal. Its anticipated 2025 first phase development is a forecast, not evidence that construction occurred. Existing Columbus operations and facilities completed elsewhere are separate. The current Johnstown physical stage and operation remain unverified." }, "source_read_scope": { "raw_response_gzip_decoded_locally": true, "decode_receipt": "cohort-19-captures/cologix.com/c19-johnstown-f53d5bbc.decode-receipt.json", "original_capture_preserved": true, "columbus_existing_service_not_johnstown_operation": true } }, "notes": [ "Cologix November 20, 2024 release announces a Johnstown land acquisition and planned data center campus. Announced development describes that dated proposal. Its anticipated 2025 first phase development is a forecast, not evidence that construction occurred. Existing Columbus operations and facilities completed elsewhere are separate. The current Johnstown physical stage and operation remain unverified.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://cologix.com/news/cologix-expands-central-ohio-footprint-with-land-acquisition-for-new-ai-ready-800mw-data-center-campus/", "host": "cologix.com", "published": "2024-11-20", "date": "2024-11-20", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check 16, October 23, 2026", "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The developer role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The November 20, 2024 company announcement names land acquisition and planned Johnstown campus development. Its 2025 start target, eight building plan, potential capacity and seller identity do not establish actual current construction, legal title, complete boundaries or equivalence with COL7 and COL8.", "fields": { "company_association": { "name": "Cologix", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Cologix explicitly identifies the retained named code or grouped campus in its own source. The developer role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The November 20, 2024 company announcement names land acquisition and planned Johnstown campus development. Its 2025 start target, eight building plan, potential capacity and seller identity do not establish actual current construction, legal title, complete boundaries or equivalence with COL7 and COL8." }, "provider_role": "developer" }, "notes": [ "Cologix explicitly identifies the retained named code or grouped campus in its own source. The developer role is an attributed provider brand relationship, not independently established legal ownership, whole building control or current operation of every phase. No status, location, address, physical date, capacity, water figure, safety finding, certification, environmental outcome or incentive eligibility is promoted. The November 20, 2024 company announcement names land acquisition and planned Johnstown campus development. Its 2025 start target, eight building plan, potential capacity and seller identity do not establish actual current construction, legal title, complete boundaries or equivalence with COL7 and COL8.", "Publication dates, retrieval dates, targets and physical milestones stay separate. Raw response hashes remain original; gzip text derivatives are retained separately." ], "sources": [ { "url": "https://cologix.com/news/cologix-expands-central-ohio-footprint-with-land-acquisition-for-new-ai-ready-800mw-data-center-campus/", "host": "cologix.com", "published": "2024-11-20", "date": "2024-11-20", "checked": "2026-10-23", "label": "First party exact code or campus text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Johnstown · Licking · Source context reviewed", "status_scope": "Cologix November 20, 2024 release announces a Johnstown land acquisition and planned data center campus. Announced development describes that dated proposal. Its anticipated 2025 first phase development is a forecast, not evidence that construction occurred. Existing Columbus operations and facilities completed elsewhere are separate. The current Johnstown physical stage and operation remain unverified.", "event_evidence": [ { "date": "2024-11-20", "text": "Cologix published its Johnstown land acquisition and planned campus release on November 20, 2024. The anticipated 2025 first phase development remains a forecast in that source. This is the release date, not an exact construction start, power delivery or opening.", "kind": "announced", "sources": [ { "url": "https://cologix.com/news/cologix-expands-central-ohio-footprint-with-land-acquisition-for-new-ai-ready-800mw-data-center-campus/", "host": "cologix.com", "published": "2024-11-20", "date": "2024-11-20", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "cyrusone-cin2-cincinnati-oh", "state": "oh", "kind": "facility", "name": "CyrusOne CIN2 (Cincinnati)", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Hamilton" ], "city": "Cincinnati", "address": "", "who": "CyrusOne", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Operator specification, not measured consumption or an independently audited claim of zero water use. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.cyrusone.com/data-centers/north-america/cincinnati-ohio", "host": "cyrusone.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.19555, "lng": -84.54259, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "technical_it_space_sqft": 143778, "total_it_capacity_mw": 11, "cooling_design": "closed loop chilled water with redundant makeup feeds" }, "notes": [ "Operator specification, not measured consumption or an independently audited claim of zero water use.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.cyrusone.com/data-centers/north-america/cincinnati-ohio", "host": "cyrusone.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "CyrusOne lists production colocation, backup, recovery and business-continuity services, with staffed support at CIN2 in Cincinnati. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "CyrusOne lists production colocation, backup, recovery and business-continuity services, with staffed support at CIN2 in Cincinnati. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "CyrusOne lists production colocation, backup, recovery and business-continuity services, with staffed support at CIN2 in Cincinnati." ], "sources": [ { "url": "https://www.cyrusone.com/data-centers/north-america/cincinnati-ohio", "host": "www.cyrusone.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Company role source check 10, October 23, 2026", "scope": "CyrusOne presents this named facility or campus in its own service portfolio. Operator is the attributed provider brand role, not a separately established legal operating entity, property owner or finding that every building and phase is operating. No status, location, physical date, capacity, certification, resource use, current utility price or environmental outcome is promoted.", "fields": { "company_association": { "name": "CyrusOne", "role": "operator", "identity_scope": "provider_brand_only", "scope": "CyrusOne presents this named facility or campus in its own service portfolio. Operator is the attributed provider brand role, not a separately established legal operating entity, property owner or finding that every building and phase is operating. No status, location, physical date, capacity, certification, resource use, current utility price or environmental outcome is promoted." }, "provider_role": "operator" }, "notes": [ "CyrusOne presents this named facility or campus in its own service portfolio. Operator is the attributed provider brand role, not a separately established legal operating entity, property owner or finding that every building and phase is operating. No status, location, physical date, capacity, certification, resource use, current utility price or environmental outcome is promoted.", "Source dates remain separate from physical milestones and the retained status field." ], "sources": [ { "url": "https://www.cyrusone.com/data-centers/north-america/cincinnati-ohio", "host": "www.cyrusone.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party named facility portfolio or campus development source, scoped relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Cincinnati · Hamilton · Source context reviewed", "status_scope": "CyrusOne lists production colocation, backup, recovery and business-continuity services, with staffed support at CIN2 in Cincinnati. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39061" } }, { "id": "cyrusone-new-albany-col1-licking-county-oh", "state": "oh", "kind": "facility", "name": "CyrusOne New Albany COL-1", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "Johnstown", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Address-number query returns two different streets and owners. Only the Jug Street/C1 New Albany parcel is an identity candidate; do not merge the Johnstown-Utica property or add both acres. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=SiteAddress+LIKE+%27%2512181%25%27&outFields=*&returnGeometry=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.13456, "lng": -82.49463, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 2, "cadastral_error": null, "parcel_assertions": [ { "PID": 36887, "Parcel": "052-173028-00.000", "OwnerName": "SPHERE PROPERTIES LLC", "SiteAddress": "12181 JOHNSTOWN-UTICA RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 1.78 }, { "PID": 95785, "Parcel": "095-112236-00.000", "OwnerName": "C1 NEW ALBANY LLC", "SiteAddress": "12181 JUG STREET RD ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 89.81 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Address-number query returns two different streets and owners. Only the Jug Street/C1 New Albany parcel is an identity candidate; do not merge the Johnstown-Utica property or add both acres.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=SiteAddress+LIKE+%27%2512181%25%27&outFields=*&returnGeometry=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Johnstown · Licking · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "databank-cleveland-cle1-oh", "state": "oh", "kind": "facility", "name": "DataBank Cleveland (CLE1)", "group": "operating", "status": "Operator-listed service", "raw_status": "partly operating", "status_field": "current_status", "crypto": false, "type": "Colocation", "counties": [ "Cuyahoga" ], "city": "Cleveland", "address": "1255 Euclid Ave Suite #200 - Cleveland, OH 44115", "who": "DataBank", "end_user": "", "mw": null, "power": "", "power_note": "Operator-listed Critical IT Load for this facility code. The technical as-of date is not published. Advertised/design capacity does not establish current consumption, utilization or all phases energized.", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Catalog marketing establishes identity/specification; independently verify actual commissioning date and utilization. Carrier-hotel tenant suite; group with building, not whole-building metrics. Current operator card explicitly names this facility and separates its specification from the market/campus totals. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.databank.com/data-centers/cleveland/1255-euclid-ave/", "host": "databank.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.databank.com/data-centers/cleveland/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" }, { "url": "https://www.databank.com/data-centers/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1255+Euclid+Ave%2C+Cleveland%2C+OH+44115&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://storage.pardot.com/1103952/1786639670LBVc9HFL/CLE1_datasheet.pdf", "host": "storage.pardot.com", "published": "", "date": "", "checked": "2026-10-22", "label": "DataBank current facility datasheet, page 1 address" }, { "url": "https://go.databank.com/l/1103952/2026-02-18/8z6525/1103952/1771463698VzIsmigj/CLE1_datasheet.pdf", "host": "go.databank.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official datasheet PDF embed wrapper" } ], "loc": { "lat": 41.500748169232, "lng": -81.683703312291, "precision": "address", "basis": "Published DataBank facility datasheet address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite or property ownership finding." }, "reviewed_evidence": [ { "overlay": "field-verification-2026-10-14.json", "scope": "Field or source context only", "fields": { "facility_code": "CLE1", "street": "1255 Euclid Ave Suite200", "city": "Cleveland", "critical_it_capacity_mw": 0.4, "it_area_sqft": 7440, "power_basis": "operator advertised criticalIT specification, not measured consumption", "marketed_service": "colocation" }, "notes": [ "Catalog marketing establishes identity/specification; independently verify actual commissioning date and utilization.", "Carrier-hotel tenant suite; group with building, not whole-building metrics.", "Current operator card explicitly names this facility and separates its specification from the market/campus totals.", "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.databank.com/data-centers/cleveland/1255-euclid-ave/", "host": "databank.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "S4-DataBank-Existing-Depth-20261016", "scope": "Targeted existing-record DataBank code/service or project-stage, published-address and typed IT-capacity review. No admission, geocoding, physical-site certification or legal ownership finding.", "fields": { "operator_facility_code": "CLE1", "record_association_scope": "Existing research record associated by its DataBank facility code, state and named locality with the current operator page. The address is published service context, not independent parcel, municipal, ownership or physical-building identity verification.", "published_location_address": { "address": "1255 Euclid Ave Suite #200 - Cleveland, OH 44115", "scope": "Operator location heading as printed, including suite and postal text. No geocoding or point movement." }, "published_technical_specs": { "IT Square Feet": "7,440", "Critical IT Load": "0.4MW", "Power Design": "N+1", "Cooling Design": "N+1", "Cab Density Air": "5kW+" }, "technical_capacity_scope": "Critical IT Load is the named-code operator-listed capacity, not utility service, backup generation, current metered use or proof every advertised MW is energized. The page does not establish a technical as-of date. Floor area is labeled IT Square Feet, not gross building area; power/cooling designs and cabinet densities are descriptions, not water use or total IT demand.", "metro_campus_scope": "Metro/campus headline totals and future expansion envelopes are not assigned to this code or added to its capacity. Published street and postal locality do not independently resolve legal jurisdiction. SLA, certification and renewable-energy marketing are not verified operational outcomes.", "current_status_basis": "Current operator-listed CLE1 colocation service component, supported by its named facility page and current metro listing. The observation does not certify complete campus buildout, all advertised capacity energized, current availability, ownership or an exact opening day." }, "notes": [ "Partial field review only. Original name, point/precision, city/county/jurisdiction, opening field and legacy MW/financial values remain unchanged.", "Capacity is operator-listed Critical IT Load, not metered consumption or a utility/generator figure. No sum across overlapping code, campus or expansion envelopes is asserted." ], "sources": [ { "url": "https://www.databank.com/data-centers/cleveland/1255-euclid-ave/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" }, { "url": "https://www.databank.com/data-centers/cleveland/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" }, { "url": "https://www.databank.com/data-centers/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" } ], "checked": "2026-10-16", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 3, October 22, 2026", "scope": "Published operator street reference only. No status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 41.500748169232, "lng": -81.683703312291, "precision": "address", "basis": "Published DataBank facility datasheet address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "1255 Euclid Ave Suite #200 - Cleveland, OH 44115", "county_fips": [ "39035" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The official facility page links the retained PDF through its public PDF embed. The datasheet names the existing facility code and service address. Only address presentation punctuation is normalized for comparison; the canonical address remains unchanged.", "The datasheet version is retained as printed. No exact publication day is inferred from its quarter or version. Capacity, technical figures, source photographs and certifications are not adopted in this location review.", "Floors and suites remain address context. The Census reference is not a building, parcel boundary, legal title or exclusive occupancy finding. The response county and retained Census county geometry agree." ], "sources": [ { "url": "https://www.databank.com/data-centers/cleveland/1255-euclid-ave/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-22", "label": "DataBank official facility page and datasheet link" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1255+Euclid+Ave%2C+Cleveland%2C+OH+44115&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://storage.pardot.com/1103952/1786639670LBVc9HFL/CLE1_datasheet.pdf", "host": "storage.pardot.com", "published": "", "date": "", "checked": "2026-10-22", "label": "DataBank current facility datasheet, page 1 address" }, { "url": "https://go.databank.com/l/1103952/2026-02-18/8z6525/1103952/1771463698VzIsmigj/CLE1_datasheet.pdf", "host": "go.databank.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official datasheet PDF embed wrapper" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 33, October 23, 2026", "scope": "DataBank identifies the same named CLE1 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown.", "fields": { "company_association": { "name": "DataBank", "role": "operator", "identity_scope": "provider_brand_only", "scope": "DataBank identifies the same named CLE1 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." }, "provider_role": "operator" }, "notes": [ "DataBank identifies the same named CLE1 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." ], "sources": [ { "url": "https://www.databank.com/data-centers/cleveland/1255-euclid-ave/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Cleveland · Cuyahoga · Source context reviewed", "status_scope": "Current operator-listed CLE1 colocation service component, supported by its named facility page and current metro listing. The observation does not certify complete campus buildout, all advertised capacity energized, current availability, ownership or an exact opening day.", "typed_power_facts": [ { "measure": "it_capacity", "value": 0.4, "unit": "MW", "as_of": null, "as_of_basis": "not_published", "observed_on": "2026-10-16", "basis": "operator_reported_capacity", "scope": "Current named-code operator-listed Critical IT Load, not utility capacity, backup generation or measured consumption. Technical as-of date and energized/occupied share are not published.", "sources": [ "https://www.databank.com/data-centers/cleveland/1255-euclid-ave/" ] } ] }, { "id": "datayard-dayton-oh", "state": "oh", "kind": "facility", "name": "DataYard Dayton Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Montgomery" ], "city": "Dayton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. DataYard exact data-center versus office address. Explicitdatacenterversusofficeaddressesdistinct.0percent/0.000percentdynamiccountersuninitializednotrealzeroSLAorcustomersatisfaction. No numericITMWorarea. Do nottestnewsletter/webinarforms. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.datayard.us/contact/", "host": "datayard.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.75468, "lng": -84.29066, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "DataYard exact data-center versus office address", "fields": { "operator": "DataYard", "data_center_address": "130 WestSecondStreet, Suite250, Dayton, Ohio45402", "administrative_office_address": "31 SouthMainStreet, Suite356, Dayton, Ohio45402" }, "notes": [ "Explicitdatacenterversusofficeaddressesdistinct.0percent/0.000percentdynamiccountersuninitializednotrealzeroSLAorcustomersatisfaction. No numericITMWorarea. Do nottestnewsletter/webinarforms.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.datayard.us/contact/", "host": "datayard.us", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Dayton · Montgomery · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39113" } }, { "id": "lakeland-equity-east-55th-cleveland-oh", "state": "oh", "kind": "facility", "name": "East 55th Street Data Center (Slavic Village)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Cuyahoga" ], "city": "Cleveland", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Publication date conflicts between URL and malformed visible timestamp and stays unknown. The 1.6-billion-USD plan includes one billion in construction, not an additional billion. Google is an image credit, not a tenant. Permit application, possible river/tunnel water sources and legacy remediation clearance are not construction approval or water rights. A proposed ballot ban is not law. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://neo-trans.blog/2026/05/06/1-6b-data-center-planned-in-cleveland/", "host": "neo-trans.blog", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 41.43633, "lng": -81.67177, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round27-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "NEOtrans describes Lakeland Equity's proposed three-building East 55th Cleveland project, with about 300,000 square feet and 150 MW of unspecified basis.", "independently_verified_current_operating_status": null }, "notes": [ "Publication date conflicts between URL and malformed visible timestamp and stays unknown. The 1.6-billion-USD plan includes one billion in construction, not an additional billion. Google is an image credit, not a tenant. Permit application, possible river/tunnel water sources and legacy remediation clearance are not construction approval or water rights. A proposed ballot ban is not law.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://neo-trans.blog/2026/05/06/1-6b-data-center-planned-in-cleveland/", "host": "neo-trans.blog", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Cleveland · Cuyahoga · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39035" } }, { "id": "edgeconnex-mcn-new-albany-licking-county-oh", "state": "oh", "kind": "facility", "name": "EdgeConneX MCN New Albany (South Campus)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=UPPER(OwnerName)+LIKE+'%25EDGECONNEX%25'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.04885, "lng": -82.50524, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 17, "cadastral_error": null, "parcel_assertions": [ { "PID": 37146, "Parcel": "052-173658-00.000", "OwnerName": "EDGECONNEX MCN PIPER FARMS PROPERTY 8 LLC", "SiteAddress": "JOHNSTOWN-UTICA RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 35.2 }, { "PID": 37147, "Parcel": "052-173658-00.002", "OwnerName": "EDGECONNEX MCN PIPER FARMS PROPERTY 8 LLC", "SiteAddress": "JOHNSTOWN-UTICA RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 4.0 }, { "PID": 37148, "Parcel": "052-173658-00.003", "OwnerName": "EDGECONNEX MCN PIPER FARMS PROPERTY 8 LLC", "SiteAddress": "13490 GREEN CHAPEL RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 2.53 }, { "PID": 37149, "Parcel": "052-173658-00.004", "OwnerName": "EDGECONNEX MCN PIPER FARMS PROPERTY 8 LLC", "SiteAddress": "GREEN CHAPEL RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 2.53 }, { "PID": 37150, "Parcel": "052-173658-00.005", "OwnerName": "EDGECONNEX MCN PIPER FARMS PROPERTY 8 LLC", "SiteAddress": "GREEN CHAPEL RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 2.53 }, { "PID": 37151, "Parcel": "052-173658-00.006", "OwnerName": "EDGECONNEX MCN PIPER FARMS PROPERTY 8 LLC", "SiteAddress": "GREEN CHAPEL RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 1.33 }, { "PID": 37152, "Parcel": "052-173664-00.000", "OwnerName": "EDGECONNEX MCN PIPER FARMS PROPERTY 8 LLC", "SiteAddress": "13151 JOHNSTOWN-UTICA RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 79.86 }, { "PID": 37357, "Parcel": "052-174306-00.000", "OwnerName": "EDGECONNEX MCN PIPER FARMS PROPERTY 8 LLC", "SiteAddress": "13399 JOHNSTOWN-UTICA RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 0.75 }, { "PID": 37649, "Parcel": "052-176184-00.000", "OwnerName": "EDGECONNEX MCN PIPER FARMS PROPERTY 8 LLC", "SiteAddress": "13399 JOHNSTOWN-UTICA RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 1.0 }, { "PID": 37650, "Parcel": "052-176184-00.001", "OwnerName": "EDGECONNEX MCN PIPER FARMS PROPERTY 8 LLC", "SiteAddress": "GREEN CHAPEL RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 1.33 }, { "PID": 37651, "Parcel": "052-176184-00.002", "OwnerName": "EDGECONNEX MCN PIPER FARMS PROPERTY 8 LLC", "SiteAddress": "GREEN CHAPEL RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 1.33 }, { "PID": 37652, "Parcel": "052-176184-00.004", "OwnerName": "EDGECONNEX MCN PIPER FARMS PROPERTY 8 LLC", "SiteAddress": "JOHNSTOWN-UTICA RD ", "SitePostalCity": "JOHNSTOWN", "Jurisdiction": "Monroe Twp.", "Municipality": null, "Township": "Monroe", "TaxAcres": 3.99 }, { "PID": 95774, "Parcel": "093-107490-00.002", "OwnerName": "EDGECONNEX MCN NEW ALBANY SOUTH PROPCO 2 LLC", "SiteAddress": "INNOVATION CAMPUS WAY ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 14.78 }, { "PID": 96257, "Parcel": "095-111720-00.000", "OwnerName": "EDGECONNEX MCN NEW ALBANY NORTH PROPCO 1 LLC", "SiteAddress": "3356 CLOVER VALLEY RD NW", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 170.29 }, { "PID": 96920, "Parcel": "095-112056-00.006", "OwnerName": "EDGECONNEX MCN NEW ALBANY SOUTH PROPCO 2 LLC", "SiteAddress": "12525 JUG STREET RD ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 9.28 }, { "PID": 91103, "Parcel": "095-112080-02.001", "OwnerName": "EDGECONNEX MCN NEW ALBANY SOUTH PROPCO 2 LLC", "SiteAddress": "9850 INNOVATION CAMPUS WAY ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 33.86 }, { "PID": 95687, "Parcel": "095-112188-00.000", "OwnerName": "EDGECONNEX MCN NEW ALBANY SOUTH PROPCO 2 LLC", "SiteAddress": "2465 CLOVER VALLEY RD NW", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 39.61 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=UPPER(OwnerName)+LIKE+'%25EDGECONNEX%25'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "edged-columbus-new-albany-oh", "state": "oh", "kind": "facility", "name": "Edged Columbus", "group": "operating", "status": "Operator-announced opening", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "New Albany", "address": "", "who": "Edged", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. ReleaseSeptember11saysopeningyesterday. Criticalcapacityspecificationnotmeasuredload.92Mgallonswatersavingscomparedtoconventionaldesignnotactualwaterwithdrawal;1.15PUEportfolioaverage. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://edged.us/news/columbus-grand-opening", "host": "edged.us", "date": "2025-09-11", "published": "2025-09-11", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://edged.us/columbus", "host": "edged.us", "published": "", "date": "", "checked": "2026-10-23", "label": "First party named campus and scoped operator relationship" } ], "loc": { "lat": 39.99348, "lng": -82.99121, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "opening_event_date": "2025-09-10", "critical_capacity_mw": 24, "published_city": "New Albany, Ohio" }, "notes": [ "ReleaseSeptember11saysopeningyesterday. Criticalcapacityspecificationnotmeasuredload.92Mgallonswatersavingscomparedtoconventionaldesignnotactualwaterwithdrawal;1.15PUEportfolioaverage.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://edged.us/news/columbus-grand-opening", "host": "edged.us", "date": "2025-09-11", "published": "2025-09-11", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "Edged announced the opening of its New Albany facility in a September 11, 2025 release describing the previous day as the opening celebration. The opening is operator-reported; advertised load, water savings, measured use and all halls being energized are not independently certified. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_announced_opening", "scope": "Edged announced the opening of its New Albany facility in a September 11, 2025 release describing the previous day as the opening celebration. The opening is operator-reported; advertised load, water savings, measured use and all halls being energized are not independently certified. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "reported_stage_date": { "date": "2025-09-10", "basis": "operator_reported_opening", "status_label": "Operator-announced opening", "source_scope": "September 11 release explicitly describes the opening celebration as yesterday; independent commissioning and all halls are not certified." } } }, "notes": [ "Edged announced the opening of its New Albany facility in a September 11, 2025 release describing the previous day as the opening celebration. The opening is operator-reported; advertised load, water savings, measured use and all halls being energized are not independently certified." ], "sources": [ { "url": "https://edged.us/news/columbus-grand-opening", "host": "edged.us", "published": "2025-09-11", "date": "2025-09-11", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Company role source check25, October23,2026", "scope": "Edged presents this named facility or retained campus on its own website. The relationship is the attributed provider brand only, not legal property ownership or the identity of a legal operating entity. No status, location, street address, quantity, cooling consumption, emissions, permit, certification, tenant identity or completion date is changed. Marketing design and efficiency statements are not measured findings. Retrieval does not establish an opening date. The provider markets Columbus and explicitly names New Albany. The marketing city does not replace current city or county fields.", "fields": { "company_association": { "name": "Edged", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Edged presents this named facility or retained campus on its own website. The relationship is the attributed provider brand only, not legal property ownership or the identity of a legal operating entity. No status, location, street address, quantity, cooling consumption, emissions, permit, certification, tenant identity or completion date is changed. Marketing design and efficiency statements are not measured findings. Retrieval does not establish an opening date. The provider markets Columbus and explicitly names New Albany. The marketing city does not replace current city or county fields." }, "provider_role": "operator" }, "notes": [ "Edged presents this named facility or retained campus on its own website. The relationship is the attributed provider brand only, not legal property ownership or the identity of a legal operating entity. No status, location, street address, quantity, cooling consumption, emissions, permit, certification, tenant identity or completion date is changed. Marketing design and efficiency statements are not measured findings. Retrieval does not establish an opening date. The provider markets Columbus and explicitly names New Albany. The marketing city does not replace current city or county fields." ], "sources": [ { "url": "https://edged.us/columbus", "host": "edged.us", "published": "", "date": "", "checked": "2026-10-23", "label": "First party named campus and scoped operator relationship" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Franklin · Source context reviewed", "status_scope": "Edged announced the opening of its New Albany facility in a September 11, 2025 release describing the previous day as the opening celebration. The opening is operator-reported; advertised load, water savings, measured use and all halls being energized are not independently certified. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39049" } }, { "id": "expedient-cmh1-upper-arlington-oh", "state": "oh", "kind": "facility", "name": "Expedient CMH1 (Upper Arlington)", "group": "operating", "status": "Operating", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Upper Arlington", "address": "5000 Arlington Centre Blvd, Building One, Upper Arlington, OH 43220", "who": "Expedient", "end_user": "", "mw": null, "power": "", "power_note": "Operator-advertised CMH1 critical IT technical capacity, not measured consumption. The source calls it Critical IT Load in its facility specifications and gives no technical as-of date. Regional headlines, utility supply and generator capacity remain separate.", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Expedient Columbus three sites with explicit critical IT scope. 13.4MWis regional three-site total, not each building.10/6/3.5MWgenerators separate from IT. Published area categories not interchangeable; suite/building IDs need precise parcel crosswalk. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://expedient.com/data-centers/columbus/", "host": "expedient.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.expedient.com/data-centers/columbus/", "host": "www.expedient.com", "published": "", "date": "", "checked": "2026-10-15", "label": "Reviewed operator source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=5000+Arlington+Centre+Blvd%2C+Upper+Arlington%2C+OH+43220&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPImagery/ImageServer/exportImage?bbox=-83.08273475236511%2C40.05449252570203%2C-83.07569287946087%2C40.05988239275197&bboxSR=4326&imageSR=4326&size=1000%2C1000&format=jpg&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Aerial setting context only, acquisition date not established" } ], "loc": { "lat": 40.057187459227, "lng": -83.079213815913, "precision": "address", "basis": "Published Expedient facility address 5000 Arlington Centre Blvd Building One, Arlington Centre Blvd, Upper Arlington, OH 43220 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "operator-discovery-review-round8-2026-10-14.json", "scope": "Expedient Columbus three sites with explicit critical IT scope", "fields": { "sites": [ { "code": "CMH1", "address": "5000 Arlington Centre Boulevard, Building One, Upper Arlington, OH43220", "critical_it_mw": 1.6, "gross_sqft": 21591, "raised_floor_sqft": 9300 }, { "code": "CMH2", "address": "5700 Innovation Drive, Dublin, OH43016", "critical_it_mw": 4.8, "gross_sqft": 29208, "raised_floor_sqft": 10500 }, { "code": "CMH3", "address": "281 E Powell Road, Lewis Center, OH43035", "critical_it_mw": 7, "gross_sqft": 102000, "raised_floor_sqft": 39600 } ], "regional_critical_it_mw": 13.4 }, "notes": [ "13.4MWis regional three-site total, not each building.10/6/3.5MWgenerators separate from IT. Published area categories not interchangeable; suite/building IDs need precise parcel crosswalk.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://expedient.com/data-centers/columbus/", "host": "expedient.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Operator-Jurisdiction-20261015", "scope": "Current operator listing for named CMH1 facility at its published address; current services support operating status, not a dated opening or parcel verification.", "fields": { "facility_designation": "CMH1", "operator_published_address": "5000 Arlington Centre Blvd, Building One, Upper Arlington, OH 43220", "current_status": "operating", "status_basis": "Current operator facility listing, facility-specific services/technical specifications and tour information.", "operator_facility_critical_it_spec_mw": 1.6 }, "notes": [ "Only the named facility is supported. The current operator page is a primary source for its own advertised services, not an independent inspection, parcel survey or legal-ownership verification.", "Source publication and technical as-of dates are not published; the review date does not become an opening or measurement date.", "Published postal/locality names do not certify an incorporated municipality. Original map point and approximate precision remain unchanged.", "The regional 13.4 MW headline covers three facility specifications. It is not assigned to each facility or described as metered usage." ], "sources": [ { "url": "https://www.expedient.com/data-centers/columbus/", "host": "www.expedient.com", "published": "", "date": "", "checked": "2026-10-15", "label": "Reviewed operator source" } ], "checked": "2026-10-15", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 11, October 22, 2026", "scope": "Official facility street reference only. No canonical address, status, physical date, quantity, company role, jurisdiction, title, parcel, full campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 40.057187459227, "lng": -83.079213815913, "precision": "address", "basis": "Published Expedient facility address 5000 Arlington Centre Blvd Building One, Arlington Centre Blvd, Upper Arlington, OH 43220 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "5000 Arlington Centre Blvd Building One, Arlington Centre Blvd, Upper Arlington, OH 43220", "county_fips": [ "39049" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The current official numeric facility section identifies this existing record. All prior native address and status wrappers remain exact. Corporate headquarters, related facility cards and map coordinates are excluded.", "The unique Census street range and retained county boundary agree with the existing county. Numeric street identity is explicitly reviewed. The image center is on or beside a street in an industrial or office setting. No residential roof is selected. Nearby buildings are context only and no building, parcel or title is identified from appearance.", "Official USGS aerial setting context was visually reviewed. The acquisition date is not established and may predate construction. No aerial coordinate, commissioning date, current operation, property ownership, surveyed roof or full campus is adopted.", "The named CMH1 source repeats Arlington Centre Boulevard around Building One. The query uses the numeric street once and omits the building qualifier. No provider coordinate or provider page is used and no independent building identity is adopted." ], "sources": [ { "url": "https://expedient.com/data-centers/columbus/", "host": "expedient.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named CMH1 numeric street section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=5000+Arlington+Centre+Blvd%2C+Upper+Arlington%2C+OH+43220&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPImagery/ImageServer/exportImage?bbox=-83.08273475236511%2C40.05449252570203%2C-83.07569287946087%2C40.05988239275197&bboxSR=4326&imageSR=4326&size=1000%2C1000&format=jpg&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Aerial setting context only, acquisition date not established" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 19, October 23, 2026", "scope": "Expedient offers colocation and infrastructure service for this exact named facility on its own website. Operator describes the attributed provider brand relationship, not independent verification of the legal operating entity, property ownership or every building and phase. No stage, precise location, street evidence, date, capacity, water, emissions, safety, certifications or compliance is promoted. The Columbus market page explicitly lists CMH1 at Upper Arlington, CMH2 at Dublin and CMH3 at Lewis Center in separate sections. Shared market totals and critical IT load are not copied to individual records. Building One remains scoped to the existing CMH1 street reference.", "fields": { "company_association": { "name": "Expedient", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Expedient offers colocation and infrastructure service for this exact named facility on its own website. Operator describes the attributed provider brand relationship, not independent verification of the legal operating entity, property ownership or every building and phase. No stage, precise location, street evidence, date, capacity, water, emissions, safety, certifications or compliance is promoted. The Columbus market page explicitly lists CMH1 at Upper Arlington, CMH2 at Dublin and CMH3 at Lewis Center in separate sections. Shared market totals and critical IT load are not copied to individual records. Building One remains scoped to the existing CMH1 street reference." }, "provider_role": "operator" }, "notes": [ "Expedient offers colocation and infrastructure service for this exact named facility on its own website. Operator describes the attributed provider brand relationship, not independent verification of the legal operating entity, property ownership or every building and phase. No stage, precise location, street evidence, date, capacity, water, emissions, safety, certifications or compliance is promoted. The Columbus market page explicitly lists CMH1 at Upper Arlington, CMH2 at Dublin and CMH3 at Lewis Center in separate sections. Shared market totals and critical IT load are not copied to individual records. Building One remains scoped to the existing CMH1 street reference.", "First publication dates are not established. Awards, specifications, current retrieval and stated plans are not physical milestones." ], "sources": [ { "url": "https://expedient.com/data-centers/columbus/", "host": "expedient.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact building code and named service text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Upper Arlington · Franklin · Source context reviewed", "typed_power_facts": [ { "measure": "it_capacity", "value": 1.6, "unit": "MW", "as_of": null, "observed_on": "2026-10-15", "as_of_basis": "not_published", "basis": "operator_reported_capacity", "scope": "CMH1 facility-specific advertised critical IT technical specification. The operator labels it Critical IT Load; this is an offered design-capacity specification, not a dated meter reading, utility-service approval or regional total.", "sources": [ "https://www.expedient.com/data-centers/columbus/" ] } ] }, { "id": "expedient-cmh2-dublin-oh", "state": "oh", "kind": "facility", "name": "Expedient CMH2 (Dublin)", "group": "operating", "status": "Operating", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Dublin", "address": "5700 Innovation Drive, Dublin, OH 43016", "who": "Expedient", "end_user": "", "mw": null, "power": "", "power_note": "Operator-advertised CMH2 critical IT technical capacity, not measured consumption. The source calls it Critical IT Load in its facility specifications and gives no technical as-of date. Regional headlines, utility supply and generator capacity remain separate.", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Expedient Columbus three sites with explicit critical IT scope. 13.4MWis regional three-site total, not each building.10/6/3.5MWgenerators separate from IT. Published area categories not interchangeable; suite/building IDs need precise parcel crosswalk. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://expedient.com/data-centers/columbus/", "host": "expedient.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.expedient.com/data-centers/columbus/", "host": "www.expedient.com", "published": "", "date": "", "checked": "2026-10-15", "label": "Reviewed operator source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=5700+Innovation+Drive%2C+Dublin%2C+OH+43016&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" } ], "loc": { "lat": 40.091678338723, "lng": -83.144375116255, "precision": "address", "basis": "Published Expedient facility address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite, entire campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "operator-discovery-review-round8-2026-10-14.json", "scope": "Expedient Columbus three sites with explicit critical IT scope", "fields": { "sites": [ { "code": "CMH1", "address": "5000 Arlington Centre Boulevard, Building One, Upper Arlington, OH43220", "critical_it_mw": 1.6, "gross_sqft": 21591, "raised_floor_sqft": 9300 }, { "code": "CMH2", "address": "5700 Innovation Drive, Dublin, OH43016", "critical_it_mw": 4.8, "gross_sqft": 29208, "raised_floor_sqft": 10500 }, { "code": "CMH3", "address": "281 E Powell Road, Lewis Center, OH43035", "critical_it_mw": 7, "gross_sqft": 102000, "raised_floor_sqft": 39600 } ], "regional_critical_it_mw": 13.4 }, "notes": [ "13.4MWis regional three-site total, not each building.10/6/3.5MWgenerators separate from IT. Published area categories not interchangeable; suite/building IDs need precise parcel crosswalk.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://expedient.com/data-centers/columbus/", "host": "expedient.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Operator-Jurisdiction-20261015", "scope": "Current operator listing for named CMH2 facility at its published address; current services support operating status, not a dated opening or parcel verification.", "fields": { "facility_designation": "CMH2", "operator_published_address": "5700 Innovation Drive, Dublin, OH 43016", "current_status": "operating", "status_basis": "Current operator facility listing, facility-specific services/technical specifications and tour information.", "operator_facility_critical_it_spec_mw": 4.8 }, "notes": [ "Only the named facility is supported. The current operator page is a primary source for its own advertised services, not an independent inspection, parcel survey or legal-ownership verification.", "Source publication and technical as-of dates are not published; the review date does not become an opening or measurement date.", "Published postal/locality names do not certify an incorporated municipality. Original map point and approximate precision remain unchanged.", "The regional 13.4 MW headline covers three facility specifications. It is not assigned to each facility or described as metered usage." ], "sources": [ { "url": "https://www.expedient.com/data-centers/columbus/", "host": "www.expedient.com", "published": "", "date": "", "checked": "2026-10-15", "label": "Reviewed operator source" } ], "checked": "2026-10-15", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 4, October 22, 2026", "scope": "Published operator street reference only. No status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 40.091678338723, "lng": -83.144375116255, "precision": "address", "basis": "Published Expedient facility address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite, entire campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "5700 Innovation Drive, Dublin, OH 43016", "county_fips": [ "39049" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The current named operator facility page publishes the reviewed street address. This identifies an address reference for the existing research record, not a legal parcel or exclusive whole building use. Corporate headquarters and operator template coordinates are not used.", "The Census result and retained Census county polygon agree with the existing record county. The current operating status, physical milestones, quantities, company roles and jurisdiction wrappers remain unchanged." ], "sources": [ { "url": "https://expedient.com/data-centers/columbus/", "host": "expedient.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Current operator facility code and street address" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=5700+Innovation+Drive%2C+Dublin%2C+OH+43016&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 19, October 23, 2026", "scope": "Expedient offers colocation and infrastructure service for this exact named facility on its own website. Operator describes the attributed provider brand relationship, not independent verification of the legal operating entity, property ownership or every building and phase. No stage, precise location, street evidence, date, capacity, water, emissions, safety, certifications or compliance is promoted. The Columbus market page explicitly lists CMH1 at Upper Arlington, CMH2 at Dublin and CMH3 at Lewis Center in separate sections. Shared market totals and critical IT load are not copied to individual records. Building One remains scoped to the existing CMH1 street reference.", "fields": { "company_association": { "name": "Expedient", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Expedient offers colocation and infrastructure service for this exact named facility on its own website. Operator describes the attributed provider brand relationship, not independent verification of the legal operating entity, property ownership or every building and phase. No stage, precise location, street evidence, date, capacity, water, emissions, safety, certifications or compliance is promoted. The Columbus market page explicitly lists CMH1 at Upper Arlington, CMH2 at Dublin and CMH3 at Lewis Center in separate sections. Shared market totals and critical IT load are not copied to individual records. Building One remains scoped to the existing CMH1 street reference." }, "provider_role": "operator" }, "notes": [ "Expedient offers colocation and infrastructure service for this exact named facility on its own website. Operator describes the attributed provider brand relationship, not independent verification of the legal operating entity, property ownership or every building and phase. No stage, precise location, street evidence, date, capacity, water, emissions, safety, certifications or compliance is promoted. The Columbus market page explicitly lists CMH1 at Upper Arlington, CMH2 at Dublin and CMH3 at Lewis Center in separate sections. Shared market totals and critical IT load are not copied to individual records. Building One remains scoped to the existing CMH1 street reference.", "First publication dates are not established. Awards, specifications, current retrieval and stated plans are not physical milestones." ], "sources": [ { "url": "https://expedient.com/data-centers/columbus/", "host": "expedient.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact building code and named service text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Dublin · Franklin · Source context reviewed", "typed_power_facts": [ { "measure": "it_capacity", "value": 4.8, "unit": "MW", "as_of": null, "observed_on": "2026-10-15", "as_of_basis": "not_published", "basis": "operator_reported_capacity", "scope": "CMH2 facility-specific advertised critical IT technical specification. The operator labels it Critical IT Load; this is an offered design-capacity specification, not a dated meter reading, utility-service approval or regional total.", "sources": [ "https://www.expedient.com/data-centers/columbus/" ] } ] }, { "id": "expedient-cmh3-lewis-center-oh", "state": "oh", "kind": "facility", "name": "Expedient CMH3 (Lewis Center)", "group": "operating", "status": "Operating", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Delaware" ], "city": "Lewis Center", "address": "281 E. Powell Road, Lewis Center, OH 43035", "who": "Expedient", "end_user": "", "mw": null, "power": "", "power_note": "Operator-advertised CMH3 critical IT technical capacity, not measured consumption. The source calls it Critical IT Load in its facility specifications and gives no technical as-of date. Regional headlines, utility supply and generator capacity remain separate.", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Expedient Columbus three sites with explicit critical IT scope. 13.4MWis regional three-site total, not each building.10/6/3.5MWgenerators separate from IT. Published area categories not interchangeable; suite/building IDs need precise parcel crosswalk. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://expedient.com/data-centers/columbus/", "host": "expedient.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.expedient.com/data-centers/columbus/", "host": "www.expedient.com", "published": "", "date": "", "checked": "2026-10-15", "label": "Reviewed operator source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=281+E.+Powell+Road%2C+Lewis+Center%2C+OH+43035&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" } ], "loc": { "lat": 40.156950823306, "lng": -83.014315705643, "precision": "address", "basis": "Published Expedient facility address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite, entire campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "operator-discovery-review-round8-2026-10-14.json", "scope": "Expedient Columbus three sites with explicit critical IT scope", "fields": { "sites": [ { "code": "CMH1", "address": "5000 Arlington Centre Boulevard, Building One, Upper Arlington, OH43220", "critical_it_mw": 1.6, "gross_sqft": 21591, "raised_floor_sqft": 9300 }, { "code": "CMH2", "address": "5700 Innovation Drive, Dublin, OH43016", "critical_it_mw": 4.8, "gross_sqft": 29208, "raised_floor_sqft": 10500 }, { "code": "CMH3", "address": "281 E Powell Road, Lewis Center, OH43035", "critical_it_mw": 7, "gross_sqft": 102000, "raised_floor_sqft": 39600 } ], "regional_critical_it_mw": 13.4 }, "notes": [ "13.4MWis regional three-site total, not each building.10/6/3.5MWgenerators separate from IT. Published area categories not interchangeable; suite/building IDs need precise parcel crosswalk.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://expedient.com/data-centers/columbus/", "host": "expedient.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Operator-Jurisdiction-20261015", "scope": "Current operator listing for named CMH3 facility at its published address; current services support operating status, not a dated opening or parcel verification.", "fields": { "facility_designation": "CMH3", "operator_published_address": "281 E. Powell Road, Lewis Center, OH 43035", "current_status": "operating", "status_basis": "Current operator facility listing, facility-specific services/technical specifications and tour information.", "operator_facility_critical_it_spec_mw": 7 }, "notes": [ "Only the named facility is supported. The current operator page is a primary source for its own advertised services, not an independent inspection, parcel survey or legal-ownership verification.", "Source publication and technical as-of dates are not published; the review date does not become an opening or measurement date.", "Published postal/locality names do not certify an incorporated municipality. Original map point and approximate precision remain unchanged.", "The regional 13.4 MW headline covers three facility specifications. It is not assigned to each facility or described as metered usage." ], "sources": [ { "url": "https://www.expedient.com/data-centers/columbus/", "host": "www.expedient.com", "published": "", "date": "", "checked": "2026-10-15", "label": "Reviewed operator source" } ], "checked": "2026-10-15", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 4, October 22, 2026", "scope": "Published operator street reference only. No status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 40.156950823306, "lng": -83.014315705643, "precision": "address", "basis": "Published Expedient facility address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite, entire campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "281 E. Powell Road, Lewis Center, OH 43035", "county_fips": [ "39041" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The current named operator facility page publishes the reviewed street address. This identifies an address reference for the existing research record, not a legal parcel or exclusive whole building use. Corporate headquarters and operator template coordinates are not used.", "The Census result and retained Census county polygon agree with the existing record county. The current operating status, physical milestones, quantities, company roles and jurisdiction wrappers remain unchanged.", "The source prints Ohio. The saved address uses its postal abbreviation OH. This is an explicit presentation equivalence only.", "The prior point is expressly an inherited Compute Atlas general area reference with no verified street or parcel. The current named operator facility page publishes 281 E. Powell Road, Lewis Center, OH 43035. The independent Census street range matches that numbered address and lies inside the existing record county. The 4510.4 meter move replaces the unverified general area reference with a calculated address reference. It does not certify a roof, parcel, ownership or physical milestone." ], "sources": [ { "url": "https://expedient.com/data-centers/columbus/", "host": "expedient.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Current operator facility code and street address" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=281+E.+Powell+Road%2C+Lewis+Center%2C+OH+43035&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 19, October 23, 2026", "scope": "Expedient offers colocation and infrastructure service for this exact named facility on its own website. Operator describes the attributed provider brand relationship, not independent verification of the legal operating entity, property ownership or every building and phase. No stage, precise location, street evidence, date, capacity, water, emissions, safety, certifications or compliance is promoted. The Columbus market page explicitly lists CMH1 at Upper Arlington, CMH2 at Dublin and CMH3 at Lewis Center in separate sections. Shared market totals and critical IT load are not copied to individual records. Building One remains scoped to the existing CMH1 street reference.", "fields": { "company_association": { "name": "Expedient", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Expedient offers colocation and infrastructure service for this exact named facility on its own website. Operator describes the attributed provider brand relationship, not independent verification of the legal operating entity, property ownership or every building and phase. No stage, precise location, street evidence, date, capacity, water, emissions, safety, certifications or compliance is promoted. The Columbus market page explicitly lists CMH1 at Upper Arlington, CMH2 at Dublin and CMH3 at Lewis Center in separate sections. Shared market totals and critical IT load are not copied to individual records. Building One remains scoped to the existing CMH1 street reference." }, "provider_role": "operator" }, "notes": [ "Expedient offers colocation and infrastructure service for this exact named facility on its own website. Operator describes the attributed provider brand relationship, not independent verification of the legal operating entity, property ownership or every building and phase. No stage, precise location, street evidence, date, capacity, water, emissions, safety, certifications or compliance is promoted. The Columbus market page explicitly lists CMH1 at Upper Arlington, CMH2 at Dublin and CMH3 at Lewis Center in separate sections. Shared market totals and critical IT load are not copied to individual records. Building One remains scoped to the existing CMH1 street reference.", "First publication dates are not established. Awards, specifications, current retrieval and stated plans are not physical milestones." ], "sources": [ { "url": "https://expedient.com/data-centers/columbus/", "host": "expedient.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact building code and named service text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Lewis Center · Delaware · Source context reviewed", "typed_power_facts": [ { "measure": "it_capacity", "value": 7, "unit": "MW", "as_of": null, "observed_on": "2026-10-15", "as_of_basis": "not_published", "basis": "operator_reported_capacity", "scope": "CMH3 facility-specific advertised critical IT technical specification. The operator labels it Critical IT Load; this is an offered design-capacity specification, not a dated meter reading, utility-service approval or regional total.", "sources": [ "https://www.expedient.com/data-centers/columbus/" ] } ] }, { "id": "flexential-cincinnati-cin01-02-oh", "state": "oh", "kind": "facility", "name": "Flexential Cincinnati (CIN01/02)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Butler" ], "city": "West Chester Township", "address": "", "who": "Flexential", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.. Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2020-03/2019-type-2-SOC-3-final-report.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=5307+Muhlhauser+Road%2C+West+Chester+Township%2C+Ohio+45011&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-84.4560601577217%2C39.31140528853755%2C-84.44328784227831%2C39.321286711462456&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "loc": { "lng": -84.449674, "lat": 39.316346, "precision": "address", "basis": "Operator facility documents identify 5307 Muhlhauser Road, West Chester Township, Ohio 45011. One complete unique Census street range supports this calculated reference inside Butler County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round14-2026-10-14.json", "scope": "Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.", "fields": { "operator_named_facility": "Flexential Cincinnati (CIN01/02)", "publisher_reported_footprint_sqft": 43551, "publisher_reported_critical_power_mw": 3.8, "power_basis": "operator critical load UPS capacity; Douglasville sections call it critical power", "current_measured_demand_mw": null, "commissioning_date": null, "exact_address_verified_by_this_document": false }, "notes": [ "Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 64, 2026-10-24", "scope": "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "fields": { "location_review_decision": { "location": { "lng": -84.449674, "lat": 39.316346, "precision": "address", "basis": "Operator facility documents identify 5307 Muhlhauser Road, West Chester Township, Ohio 45011. One complete unique Census street range supports this calculated reference inside Butler County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "5307 Muhlhauser Road, West Chester Township, Ohio 45011", "county_fips": [ "39017" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "The inherited general area coordinate was not an independently reviewed computing street reference. The original operator published computing location documents and complete unique literal Census street evidence support this bounded reference inside the retained county. The measured correction is 49.5 metres. All original source wordings, dates, predecessor coordinates and versions remain retained. Existing status group unknown and every other fact stay unchanged. This is a reference correction without physical relocation, a new operation, selected roof, tenant floor, legal title or complete campus certification.", "A broad road separates wooded and residential areas to the north from large commercial roofs and parking toward the south. The setting does not identify specific halls or current computing activity." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2020-03/2019-type-2-SOC-3-final-report.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=5307+Muhlhauser+Road%2C+West+Chester+Township%2C+Ohio+45011&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-84.4560601577217%2C39.31140528853755%2C-84.44328784227831%2C39.321286711462456&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Company role source check64, October24,2026", "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 59 and 60. The Cincinnati profile identifies the retained named computing service context. It does not split the combined inventory into new buildings or convert service promises and compliance advertising into measured outcomes. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted.", "fields": { "company_association": { "name": "Flexential", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 59 and 60. The Cincinnati profile identifies the retained named computing service context. It does not split the combined inventory into new buildings or convert service promises and compliance advertising into measured outcomes. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted." }, "provider_role": "operator" }, "notes": [ "Flexential identifies the named location in the original fleet guide, PDF pages 59 and 60. The Cincinnati profile identifies the retained named computing service context. It does not split the combined inventory into new buildings or convert service promises and compliance advertising into measured outcomes. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Calculated street reference, not a roof or tenant floor", "summary": "West Chester Township · Butler · Source context reviewed" }, { "id": "google-lancaster-oh", "state": "oh", "kind": "facility", "name": "Google Lancaster Data Center", "group": "operating", "status": "Operating phase", "raw_status": "partly operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Fairfield" ], "city": "Lancaster", "address": "", "who": "Google", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "Calendar-year 2025 operator-reported location totals. Withdrawal, discharge and consumption are separate quantities; methodology permits estimates and does not establish today’s use.", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Ohio statewide page. 20B+state total cannot be copied to Lancaster and NewAlbany independently. Cloud region opening is a service region, not exact physical building commissioning. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Google 2026 quarterly performance table; named regional campus scope. Operator-reported period metrics, not an October operating inspection, current MW load or building-specific measurement. Regional values are not assigned to a separate expansion or street-address record. Blank TTM remains unknown. No status, location precision or whole-campus completion upgrade; publication date unknown.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://datacenters.google/locations/ohio/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://datacenters.google/efficiency/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.datacenters.google/locations/ohio/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google official location source" }, { "url": "https://www.datacenters.google/locations/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google official location source" }, { "url": "https://sustainability.google/files/google-2026-environmental-report.pdf", "host": "sustainability.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google 2026 Environmental Report" } ], "loc": { "lat": 39.75161, "lng": -82.63067, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "remaining-operators-review-round5-2026-10-14.json", "scope": "Ohio statewide page", "fields": { "new_albany_construction_start_year": 2019, "regional_investment_usd_min_exclusive": 20000000000, "investment_scope": "Ohio statewide; New Albany, Lancaster and Columbus" }, "notes": [ "20B+state total cannot be copied to Lancaster and NewAlbany independently. Cloud region opening is a service region, not exact physical building commissioning.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://datacenters.google/locations/ohio/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Atlas targeted primary-source follow-up", "scope": "Google 2026 quarterly performance table; named regional campus scope", "fields": { "operator_reported_pue_period": "2026-Q2", "operator_reported_campus_pue": [ { "source_campus_label": "Central Ohio (Lancaster), Ohio", "quarterly_pue": 1.04, "trailing_twelve_month_pue": 1.04 } ] }, "notes": [ "Operator-reported period metrics, not an October operating inspection, current MW load or building-specific measurement. Regional values are not assigned to a separate expansion or street-address record. Blank TTM remains unknown. No status, location precision or whole-campus completion upgrade; publication date unknown." ], "sources": [ { "url": "https://datacenters.google/efficiency/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://datacenters.google/locations/ohio/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "checked": "2026-10-15", "capture_sha256": "398f42d55ca9e2ebecd3b24e2dede307ad2d9d3b653469d1efebd135488f9c17", "events": [], "whole_record_certified": false }, { "overlay": "S4-Google-Locations-20261016", "scope": "Named Google location research context; regional campus and individual building identity remain separate.", "fields": { "operator_location_scope": "Lancaster, Ohio is named in Google’s current directory and linked location page. Regional entries can include several facilities; directory development flags alone do not establish an operating stage.", "record_association_scope": "The named operator location is associated with this existing research context by provider and named city/county. This is an explicit research association, not proof of a distinct physical site or an exact parcel.", "annual_water_reporting": { "source_location": "Lancaster, OH", "report_year": 2026, "reporting_year": 2025, "source_page": 97, "unit": "Million gallons", "withdrawal": 307.1, "discharge": 171.3, "consumption": 135.8 }, "water_method_scope": "Annual calendar-year 2025 figures for the reported location, not instantaneous use, a daily rate, an approved limit or one building. Google uses metered or invoiced values when available and can estimate missing data; the table does not identify each row’s metering completeness. Consumption is calculated as withdrawal minus discharge; values are rounded. Seawater and brackish water over 1,000 mg/L total dissolved solids are excluded. Unless otherwise specified, withdrawals are potable; Douglas County includes reclaimed wastewater. No litres or daily averages are calculated.", "water_location_association": "Lancaster, OH is associated with this regional campus research context only; no allocation to separate expansion/street-address records or individual buildings.", "current_status_basis": "An operating component is supported at Google’s named Lancaster, Ohio location by its current operator listing and 2025 operational reporting. This is regional campus scope, not verification that every expansion/building is complete, fully commissioned or operating at a stated MW. Annual reporting is historical, not an October operating inspection." }, "notes": [ "A partial operator/field review does not certify every fact or a whole state. No precise address, map point, current IT load or per-campus investment is inferred." ], "sources": [ { "url": "https://www.datacenters.google/locations/ohio/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google official location source" }, { "url": "https://www.datacenters.google/locations/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google official location source" }, { "url": "https://sustainability.google/files/google-2026-environmental-report.pdf", "host": "sustainability.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google 2026 Environmental Report" } ], "checked": "2026-10-16", "whole_record_certified": false }, { "overlay": "Company role source check57, October24,2026", "scope": "Google identifies the named Lancaster data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Ohio page separately names New Albany, Lancaster and Columbus. Neither statewide investment nor a Columbus cloud region establishes an exact Lancaster facility address, campus boundary or tenant list.", "fields": { "company_association": { "name": "Google", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Google identifies the named Lancaster data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Ohio page separately names New Albany, Lancaster and Columbus. Neither statewide investment nor a Columbus cloud region establishes an exact Lancaster facility address, campus boundary or tenant list." }, "provider_role": "operator" }, "notes": [ "Google identifies the named Lancaster data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Ohio page separately names New Albany, Lancaster and Columbus. Neither statewide investment nor a Columbus cloud region establishes an exact Lancaster facility address, campus boundary or tenant list." ], "sources": [ { "url": "https://datacenters.google/locations/ohio/", "host": "datacenters.google", "published": "", "date": "", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lancaster · Fairfield · Source context reviewed", "status_scope": "An operating component is supported at Google’s named Lancaster, Ohio location by its current operator listing and 2025 operational reporting. This is regional campus scope, not verification that every expansion/building is complete, fully commissioned or operating at a stated MW. Annual reporting is historical, not an October operating inspection.", "typed_water_facts": [ { "measure": "withdrawal", "value": 307.1, "unit": "million gallons", "as_of": null, "as_of_basis": "reporting_period", "reporting_period": { "label": "2025", "start": "2025-01-01", "end": "2025-12-31" }, "observed_on": "2026-10-16", "basis": "operator_reported_total", "scope": "Google 2026 Environmental Report p.97: Lancaster, OH, calendar year 2025 withdrawal; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.", "sources": [ "https://sustainability.google/files/google-2026-environmental-report.pdf" ] }, { "measure": "discharge", "value": 171.3, "unit": "million gallons", "as_of": null, "as_of_basis": "reporting_period", "reporting_period": { "label": "2025", "start": "2025-01-01", "end": "2025-12-31" }, "observed_on": "2026-10-16", "basis": "operator_reported_total", "scope": "Google 2026 Environmental Report p.97: Lancaster, OH, calendar year 2025 discharge; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.", "sources": [ "https://sustainability.google/files/google-2026-environmental-report.pdf" ] }, { "measure": "consumption", "value": 135.8, "unit": "million gallons", "as_of": null, "as_of_basis": "reporting_period", "reporting_period": { "label": "2025", "start": "2025-01-01", "end": "2025-12-31" }, "observed_on": "2026-10-16", "basis": "operator_reported_total", "scope": "Google 2026 Environmental Report p.97: Lancaster, OH, calendar year 2025 consumption; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.", "sources": [ "https://sustainability.google/files/google-2026-environmental-report.pdf" ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39045" } }, { "id": "google-new-albany-oh", "state": "oh", "kind": "facility", "name": "Google New Albany Data Center", "group": "operating", "status": "Operating phase", "raw_status": "partly operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "New Albany", "address": "", "who": "Google", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "Calendar-year 2025 operator-reported location totals. Withdrawal, discharge and consumption are separate quantities; methodology permits estimates and does not establish today’s use.", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Montauk Innovations LLC affiliation with Google is not established by this cadastral response. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Ohio statewide page. 20B+state total cannot be copied to Lancaster and NewAlbany independently. Cloud region opening is a service region, not exact physical building commissioning. Google 2026 quarterly performance table; named regional campus scope. Operator-reported period metrics, not an October operating inspection, current MW load or building-specific measurement. Regional values are not assigned to a separate expansion or street-address record. Blank TTM remains unknown. No status, location precision or whole-campus completion upgrade; publication date unknown.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D'222-004984'&outFields=*&f=json&returnGeometry=true&outSR=4326", "host": "gis.franklincountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://datacenters.google/locations/ohio/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://datacenters.google/efficiency/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.datacenters.google/locations/ohio/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google official location source" }, { "url": "https://www.datacenters.google/locations/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google official location source" }, { "url": "https://sustainability.google/files/google-2026-environmental-report.pdf", "host": "sustainability.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google 2026 Environmental Report" }, { "url": "https://treapropsearch.franklincountyohio.gov/Details.aspx?district=222&ext=00&parcel=004984", "host": "treapropsearch.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Matching tax reference identifier and location address, not billing address" }, { "url": "https://newalbanyohio.org/wp-content/uploads/2016/04/Council-Minutes-12-10-18-Regular-Meeting.pdf", "host": "newalbanyohio.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Historical council minutes identify the Montauk Innovations and Google data center alias only" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-82.77868882243699%2C40.05248097736256%2C-82.76343117756302%2C40.06415902263744&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Viewed parcel area setting, acquisition date unknown" } ], "loc": { "lng": -82.77106, "lat": 40.05832, "precision": "approximate", "basis": "Approximate mathematical center of Franklin County tax reference parcel 222-004984 at 5266 Babbitt Road, New Albany, Ohio. County situs and tax records agree, with historical city corroboration of the Google and Montauk data center alias. One reference parcel only, not a surveyed roof, legal title or complete Google campus." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PARCELID": "222-004984", "ACRES": 221.89582397, "SITEADDRESS": "5266 BABBITT RD", "OWNERNME1": "MONTAUK INNOVATIONS LLC", "BLDGAREA": 811338 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Montauk Innovations LLC affiliation with Google is not established by this cadastral response.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D'222-004984'&outFields=*&f=json&returnGeometry=true&outSR=4326", "host": "gis.franklincountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "remaining-operators-review-round5-2026-10-14.json", "scope": "Ohio statewide page", "fields": { "new_albany_construction_start_year": 2019, "regional_investment_usd_min_exclusive": 20000000000, "investment_scope": "Ohio statewide; New Albany, Lancaster and Columbus" }, "notes": [ "20B+state total cannot be copied to Lancaster and NewAlbany independently. Cloud region opening is a service region, not exact physical building commissioning.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://datacenters.google/locations/ohio/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Atlas targeted primary-source follow-up", "scope": "Google 2026 quarterly performance table; named regional campus scope", "fields": { "operator_reported_pue_period": "2026-Q2", "operator_reported_campus_pue": [ { "source_campus_label": "Central Ohio (New Albany), Ohio", "quarterly_pue": 1.08, "trailing_twelve_month_pue": 1.07 } ] }, "notes": [ "Operator-reported period metrics, not an October operating inspection, current MW load or building-specific measurement. Regional values are not assigned to a separate expansion or street-address record. Blank TTM remains unknown. No status, location precision or whole-campus completion upgrade; publication date unknown." ], "sources": [ { "url": "https://datacenters.google/efficiency/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://datacenters.google/locations/ohio/", "host": "datacenters.google", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "checked": "2026-10-15", "capture_sha256": "398f42d55ca9e2ebecd3b24e2dede307ad2d9d3b653469d1efebd135488f9c17", "events": [], "whole_record_certified": false }, { "overlay": "S4-Google-Locations-20261016", "scope": "Named Google location research context; regional campus and individual building identity remain separate.", "fields": { "operator_location_scope": "New Albany, Ohio is named in Google’s current directory and linked location page. Regional entries can include several facilities; directory development flags alone do not establish an operating stage.", "record_association_scope": "The named operator location is associated with this existing research context by provider and named city/county. This is an explicit research association, not proof of a distinct physical site or an exact parcel.", "annual_water_reporting": { "source_location": "New Albany, OH", "report_year": 2026, "reporting_year": 2025, "source_page": 97, "unit": "Million gallons", "withdrawal": 1008.1, "discharge": 172.4, "consumption": 835.7 }, "water_method_scope": "Annual calendar-year 2025 figures for the reported location, not instantaneous use, a daily rate, an approved limit or one building. Google uses metered or invoiced values when available and can estimate missing data; the table does not identify each row’s metering completeness. Consumption is calculated as withdrawal minus discharge; values are rounded. Seawater and brackish water over 1,000 mg/L total dissolved solids are excluded. Unless otherwise specified, withdrawals are potable; Douglas County includes reclaimed wastewater. No litres or daily averages are calculated.", "water_location_association": "New Albany, OH is associated with this regional campus research context only; no allocation to separate expansion/street-address records or individual buildings.", "current_status_basis": "An operating component is supported at Google’s named New Albany, Ohio location by its current operator listing and 2025 operational reporting. This is regional campus scope, not verification that every expansion/building is complete, fully commissioned or operating at a stated MW. Annual reporting is historical, not an October operating inspection." }, "notes": [ "A partial operator/field review does not certify every fact or a whole state. No precise address, map point, current IT load or per-campus investment is inferred." ], "sources": [ { "url": "https://www.datacenters.google/locations/ohio/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google official location source" }, { "url": "https://www.datacenters.google/locations/", "host": "www.datacenters.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google official location source" }, { "url": "https://sustainability.google/files/google-2026-environmental-report.pdf", "host": "sustainability.google", "published": "", "date": "", "checked": "2026-10-16", "label": "Google 2026 Environmental Report" } ], "checked": "2026-10-16", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 23, October 23, 2026", "scope": "One approximate Franklin County reference parcel only. Existing native status remains operating. No roof, legal title or complete campus certification.", "fields": { "location_review_decision": { "location": { "lng": -82.77106, "lat": 40.05832, "precision": "approximate", "basis": "Approximate mathematical center of Franklin County tax reference parcel 222-004984 at 5266 Babbitt Road, New Albany, Ohio. County situs and tax records agree, with historical city corroboration of the Google and Montauk data center alias. One reference parcel only, not a surveyed roof, legal title or complete Google campus." }, "reference_method": "Approximate county reference parcel center", "reference_parcel": { "identifier": "222-004984", "objectid": 366477, "source_system": "Franklin County public tax reference parcel", "agency_site_address": "5266 BABBITT RD", "postal_code": "43054", "agency_tax_name": "MONTAUK INNOVATIONS LLC", "not_survey_quality": true, "legal_title_verified": false, "independent_building_identity": false, "full_campus_certified": false }, "operator_coordinates_adopted": false, "census_range_adopted": false } }, "notes": [ "One exact county tax reference identifier binds the source geometry and situs to the existing Google New Albany research record. The county treasurer repeats 5266 Babbitt Road and the Montauk Innovations tax name. Its Scottsdale billing address is excluded.", "Actually viewed December 10, 2018 city council minutes page 3 identify Montauk Innovations as a Google subsidiary in the data center project. That historical alias corroboration does not certify present title, legal ownership, property area, incentive terms, quantity, operation or a complete campus boundary.", "The mathematical area center is inside the reference parcel and the retained Franklin County. It remains approximate. No house roof is selected, raw polygon is not exported, and no surveyed building or complete Google campus is certified. All native status, physical date, quantity, role, identity, jurisdiction and canonical address wrappers remain exact." ], "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=PARCELID%3D'222-004984'&outFields=*&f=json&returnGeometry=true&outSR=4326", "host": "gis.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact public tax reference parcel 222-004984 geometry and situs" }, { "url": "https://treapropsearch.franklincountyohio.gov/Details.aspx?district=222&ext=00&parcel=004984", "host": "treapropsearch.franklincountyohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Matching tax reference identifier and location address, not billing address" }, { "url": "https://newalbanyohio.org/wp-content/uploads/2016/04/Council-Minutes-12-10-18-Regular-Meeting.pdf", "host": "newalbanyohio.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Historical council minutes identify the Montauk Innovations and Google data center alias only" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-82.77868882243699%2C40.05248097736256%2C-82.76343117756302%2C40.06415902263744&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Viewed parcel area setting, acquisition date unknown" }, { "url": "https://datacenters.google/locations/ohio/", "host": "datacenters.google", "published": "", "date": "", "checked": "2026-10-23", "label": "Current Ohio locations name New Albany, no numeric address inferred" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check57, October24,2026", "scope": "Google identifies the named New Albany data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Ohio page separately identifies New Albany and its2019construction context. That milestone is not a new exact opening date or the date every phase began operating.", "fields": { "company_association": { "name": "Google", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Google identifies the named New Albany data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Ohio page separately identifies New Albany and its2019construction context. That milestone is not a new exact opening date or the date every phase began operating." }, "provider_role": "operator" }, "notes": [ "Google identifies the named New Albany data center community in the main body of its official data center location page. Operator per source records the Google provider brand for the retained campus only, without assigning a subsidiary, contractor, tenant, legal landowner or every building. These pages do not provide a new street or exact site. Any separately retained service street is identity context only and does not newly admit a location, parcel or roof. Existing who value and its complete source wrapper remain exact. Existing status, location, address, county, quantities, dates and component identity remain exact. Statewide investment, economic activity, training, philanthropy and volunteer totals are not individual campus costs, workforce figures or power demand. Sustainability, recycled water, energy and water project statements are not independent measurements or established environmental outcomes. The page publication date is unknown, distinct from year only milestones. The Ohio page separately identifies New Albany and its2019construction context. That milestone is not a new exact opening date or the date every phase began operating." ], "sources": [ { "url": "https://datacenters.google/locations/ohio/", "host": "datacenters.google", "published": "", "date": "", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Approximate county reference parcel, not a surveyed site or full campus", "summary": "New Albany · Franklin · Source context reviewed", "status_scope": "An operating component is supported at Google’s named New Albany, Ohio location by its current operator listing and 2025 operational reporting. This is regional campus scope, not verification that every expansion/building is complete, fully commissioned or operating at a stated MW. Annual reporting is historical, not an October operating inspection.", "typed_water_facts": [ { "measure": "withdrawal", "value": 1008.1, "unit": "million gallons", "as_of": null, "as_of_basis": "reporting_period", "reporting_period": { "label": "2025", "start": "2025-01-01", "end": "2025-12-31" }, "observed_on": "2026-10-16", "basis": "operator_reported_total", "scope": "Google 2026 Environmental Report p.97: New Albany, OH, calendar year 2025 withdrawal; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.", "sources": [ "https://sustainability.google/files/google-2026-environmental-report.pdf" ] }, { "measure": "discharge", "value": 172.4, "unit": "million gallons", "as_of": null, "as_of_basis": "reporting_period", "reporting_period": { "label": "2025", "start": "2025-01-01", "end": "2025-12-31" }, "observed_on": "2026-10-16", "basis": "operator_reported_total", "scope": "Google 2026 Environmental Report p.97: New Albany, OH, calendar year 2025 discharge; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.", "sources": [ "https://sustainability.google/files/google-2026-environmental-report.pdf" ] }, { "measure": "consumption", "value": 835.7, "unit": "million gallons", "as_of": null, "as_of_basis": "reporting_period", "reporting_period": { "label": "2025", "start": "2025-01-01", "end": "2025-12-31" }, "observed_on": "2026-10-16", "basis": "operator_reported_total", "scope": "Google 2026 Environmental Report p.97: New Albany, OH, calendar year 2025 consumption; million gallons as reported. This is a rounded annual operator-reported total, not current/daily usage, a permit limit or a building-only allocation. Method pp.82/87 allows metered/invoiced data and estimates where actual data is unavailable; no row-specific metering guarantee. Consumption is withdrawal minus discharge. Seawater/brackish sources excluded.", "sources": [ "https://sustainability.google/files/google-2026-environmental-report.pdf" ] } ] }, { "id": "google-bosc-lima-oh", "state": "oh", "kind": "facility", "name": "Google Project BOSC (Lima)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Allen" ], "city": "Lima", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Google Allen County developer and economic-development project site. Developer/EDO project site, not signed CRA or tax-offset contract. Annual250000for15years is commitment description, not15years of actual receipts.500Mcampus and50Minfrastructure scope overlap not settled, do not add as550Mconfirmed. Current construction wording ambiguous between utilities/site prep and buildings. Generic global efficiency stats not site-measured water or ITMW. Lima market name not city boundary. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.allencountydatacenter.com/", "host": "allencountydatacenter.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.77149, "lng": -84.1058, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "primary-source-review-round9-2026-10-14.json", "scope": "Google Allen County developer and economic-development project site", "fields": { "operator_named_project": "Allen County Data Center, Project BOSC", "operator_announced_identity_date": "2026-03-16", "published_locality": "American Township, Allen County, Ohio", "planned_capital_investment_usd": 500000000, "planned_data_center_buildings": 2, "anticipated_infrastructure_costs_usd": 50000000, "developer_described_school_annual_offset_usd": 250000, "school_offset_term_years": 15, "school_partner": "Elida Local Schools", "status_text_conflict": [ "construction anticipated late2026", "construction underway, utilities being brought to site" ] }, "notes": [ "Developer/EDO project site, not signed CRA or tax-offset contract. Annual250000for15years is commitment description, not15years of actual receipts.500Mcampus and50Minfrastructure scope overlap not settled, do not add as550Mconfirmed. Current construction wording ambiguous between utilities/site prep and buildings. Generic global efficiency stats not site-measured water or ITMW. Lima market name not city boundary.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.allencountydatacenter.com/", "host": "allencountydatacenter.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lima · Allen · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39003" } }, { "id": "h5-data-centers-cincinnati-gest-oh", "state": "oh", "kind": "facility", "name": "H5 Data Centers Cincinnati I", "group": "operating", "status": "Operator-listed interconnection service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Hamilton" ], "city": "Cincinnati", "address": "", "who": "H5 Data Centers", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Page has a stray CincinnatiII tour sentence. Identity/address and main heading are CincinnatiI; do not merge the two sites or adopt undated advertised electricity prices as a tariff. Operator service/design assertions, not an independent uptime or certification audit. Repeated Ashburn42MW/Q32024 promotional footer is excluded from this location. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://h5datacenters.com/cincinnati-data-center.html", "host": "h5datacenters.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=360+Gest+Street%2C+Cincinnati%2C+OH+45203&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "loc": { "lat": 39.098132736099, "lng": -84.526136969277, "precision": "address", "basis": "Published H5 Data Centers facility address 360 Gest Street, Cincinnati, OH 45203 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "h5-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "published_address": "360 Gest Street, Cincinnati, OH 45203", "operator_offering": "Cincinnati I powered shell/private suites", "utility_as_stated": "Duke Energy" }, "notes": [ "Page has a stray CincinnatiII tour sentence. Identity/address and main heading are CincinnatiI; do not merge the two sites or adopt undated advertised electricity prices as a tariff.", "Operator service/design assertions, not an independent uptime or certification audit. Repeated Ashburn42MW/Q32024 promotional footer is excluded from this location.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://h5datacenters.com/cincinnati-data-center.html", "host": "h5datacenters.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "H5 describes Cincinnati I as home to telecommunications providers and offers private suites or a powered shell. Current carrier interconnection is supported; fully fitted IT halls and the copied Cincinnati II tour text are excluded. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_interconnection_service", "scope": "H5 describes Cincinnati I as home to telecommunications providers and offers private suites or a powered shell. Current carrier interconnection is supported; fully fitted IT halls and the copied Cincinnati II tour text are excluded. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "H5 describes Cincinnati I as home to telecommunications providers and offers private suites or a powered shell. Current carrier interconnection is supported; fully fitted IT halls and the copied Cincinnati II tour text are excluded." ], "sources": [ { "url": "https://h5datacenters.com/cincinnati-data-center.html", "host": "h5datacenters.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 7, October 22, 2026", "scope": "Official facility service street reference only. No canonical address, current operation, physical date, capacity, company role, jurisdiction, parcel, complete campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 39.098132736099, "lng": -84.526136969277, "precision": "address", "basis": "Published H5 Data Centers facility address 360 Gest Street, Cincinnati, OH 45203 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "360 Gest Street, Cincinnati, OH 45203", "county_fips": [ "39061" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named operator facility page publishes this service address in its facility location section. Navigation, related facilities, corporate addresses, embedded maps and operator template coordinates are excluded. The canonical address wrapper remains exact; the published address is retained as reviewed location evidence.", "The unique Census street match and retained county boundary agree with the existing county. Street interpolation does not identify a roof, suite, floor, campus boundary, legal parcel, ownership or distinct physical building. Status, dates, quantities and jurisdiction remain unchanged.", "The current operator page describes a powered shell. This review adopts only its published street reference and does not reclassify the existing status or infer current operation. The status owner is separately alerted in PARALLEL WORK." ], "sources": [ { "url": "https://h5datacenters.com/cincinnati-data-center.html", "host": "h5datacenters.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named facility street address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=360+Gest+Street%2C+Cincinnati%2C+OH+45203&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check46, October23,2026", "scope": "H5 Data Centers identifies Cincinnati I and its360GestStreet service address and advertises its own suites, powered shell and interconnection services in the main facility body. Operator per source identifies the H5 Data Centers provider brand for that component only. A Cincinnati II tour caption and an Atlanta template paragraph do not identify this Cincinnati I service street as either other facility. Advertised prices, providers, resilience, certifications and specifications are not independently verified operating measurements or legal title. The previously empty company field is populated only from this exact first party page. The service street is identity context only and does not newly admit a location, parcel or roof. Existing status, location, address, county, quantities, dates and component identity remain exact. Provider brand is distinct from a parent company, tenant and property owner. The source publication date is unknown.", "fields": { "company_association": { "name": "H5 Data Centers", "role": "operator", "identity_scope": "provider_brand_only", "scope": "H5 Data Centers identifies Cincinnati I and its360GestStreet service address and advertises its own suites, powered shell and interconnection services in the main facility body. Operator per source identifies the H5 Data Centers provider brand for that component only. A Cincinnati II tour caption and an Atlanta template paragraph do not identify this Cincinnati I service street as either other facility. Advertised prices, providers, resilience, certifications and specifications are not independently verified operating measurements or legal title. The previously empty company field is populated only from this exact first party page. The service street is identity context only and does not newly admit a location, parcel or roof. Existing status, location, address, county, quantities, dates and component identity remain exact. Provider brand is distinct from a parent company, tenant and property owner. The source publication date is unknown." }, "provider_role": "operator" }, "notes": [ "H5 Data Centers identifies Cincinnati I and its360GestStreet service address and advertises its own suites, powered shell and interconnection services in the main facility body. Operator per source identifies the H5 Data Centers provider brand for that component only. A Cincinnati II tour caption and an Atlanta template paragraph do not identify this Cincinnati I service street as either other facility. Advertised prices, providers, resilience, certifications and specifications are not independently verified operating measurements or legal title. The previously empty company field is populated only from this exact first party page. The service street is identity context only and does not newly admit a location, parcel or roof. Existing status, location, address, county, quantities, dates and component identity remain exact. Provider brand is distinct from a parent company, tenant and property owner. The source publication date is unknown." ], "sources": [ { "url": "https://h5datacenters.com/cincinnati-data-center.html", "host": "h5datacenters.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Cincinnati · Hamilton · Source context reviewed", "status_scope": "H5 describes Cincinnati I as home to telecommunications providers and offers private suites or a powered shell. Current carrier interconnection is supported; fully fitted IT halls and the copied Cincinnati II tour text are excluded. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "h5-data-centers-cleveland-rockwell-oh", "state": "oh", "kind": "facility", "name": "H5 Data Centers Cleveland", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Cuyahoga" ], "city": "Cleveland", "address": "", "who": "H5 Data Centers", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Advertised sales-tax abatement/first-qualified claim lacks a reviewed government award here. No monetary incentive value inferred. Operator service/design assertions, not an independent uptime or certification audit. Repeated Ashburn42MW/Q32024 promotional footer is excluded from this location. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://h5datacenters.com/cleveland-data-center.html", "host": "h5datacenters.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1625+Rockwell+Ave%2C+Cleveland%2C+OH+44114&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "loc": { "lat": 41.506305592067, "lng": -81.683244797253, "precision": "address", "basis": "Published H5 Data Centers facility address 1625 Rockwell Ave, Cleveland, OH 44114 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "h5-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "published_address": "1625 Rockwell Ave, Cleveland, OH 44114", "advertised_colocation_facility_sqft": 351000 }, "notes": [ "Advertised sales-tax abatement/first-qualified claim lacks a reviewed government award here. No monetary incentive value inferred.", "Operator service/design assertions, not an independent uptime or certification audit. Repeated Ashburn42MW/Q32024 promotional footer is excluded from this location.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://h5datacenters.com/cleveland-data-center.html", "host": "h5datacenters.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "H5 lists current colocation and carrier interconnection at its named Rockwell Avenue facility in Cleveland. Tax, certification and capacity claims are not adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "H5 lists current colocation and carrier interconnection at its named Rockwell Avenue facility in Cleveland. Tax, certification and capacity claims are not adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "H5 lists current colocation and carrier interconnection at its named Rockwell Avenue facility in Cleveland. Tax, certification and capacity claims are not adopted." ], "sources": [ { "url": "https://h5datacenters.com/cleveland-data-center.html", "host": "h5datacenters.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 7, October 22, 2026", "scope": "Official facility service street reference only. No canonical address, current operation, physical date, capacity, company role, jurisdiction, parcel, complete campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 41.506305592067, "lng": -81.683244797253, "precision": "address", "basis": "Published H5 Data Centers facility address 1625 Rockwell Ave, Cleveland, OH 44114 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, floor, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "1625 Rockwell Ave, Cleveland, OH 44114", "county_fips": [ "39035" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named operator facility page publishes this service address in its facility location section. Navigation, related facilities, corporate addresses, embedded maps and operator template coordinates are excluded. The canonical address wrapper remains exact; the published address is retained as reviewed location evidence.", "The unique Census street match and retained county boundary agree with the existing county. Street interpolation does not identify a roof, suite, floor, campus boundary, legal parcel, ownership or distinct physical building. Status, dates, quantities and jurisdiction remain unchanged." ], "sources": [ { "url": "https://h5datacenters.com/cleveland-data-center.html", "host": "h5datacenters.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official named facility street address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1625+Rockwell+Ave%2C+Cleveland%2C+OH+44114&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street method and limits" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 12, October 23, 2026", "scope": "H5 Data Centers presents this named facility or campus in its own colocation service portfolio. Operator is the attributed provider brand relationship, not an independently established legal operating entity, property owner or confirmation that every building and phase is operating. No status, location, physical date, capacity, certification, outage guarantee, utility price or environmental outcome is promoted.", "fields": { "company_association": { "name": "H5 Data Centers", "role": "operator", "identity_scope": "provider_brand_only", "scope": "H5 Data Centers presents this named facility or campus in its own colocation service portfolio. Operator is the attributed provider brand relationship, not an independently established legal operating entity, property owner or confirmation that every building and phase is operating. No status, location, physical date, capacity, certification, outage guarantee, utility price or environmental outcome is promoted." }, "provider_role": "operator" }, "notes": [ "H5 Data Centers presents this named facility or campus in its own colocation service portfolio. Operator is the attributed provider brand relationship, not an independently established legal operating entity, property owner or confirmation that every building and phase is operating. No status, location, physical date, capacity, certification, outage guarantee, utility price or environmental outcome is promoted.", "Source dates remain separate from physical milestones and the retained status field." ], "sources": [ { "url": "https://h5datacenters.com/cleveland-data-center.html", "host": "h5datacenters.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party named colocation portfolio page, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Cleveland · Cuyahoga · Source context reviewed", "status_scope": "H5 lists current colocation and carrier interconnection at its named Rockwell Avenue facility in Cleveland. Tax, certification and capacity claims are not adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "logistix-hamilton-innovation-center-butler-county-oh", "state": "oh", "kind": "facility", "name": "Hamilton Innovation Center", "group": "proposed", "status": "Listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Butler" ], "city": "Hamilton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Providing design and will-feature language describe a plan. The over-100-MW basis is unspecified. Tier III/N+1 concept is not independent certification or readiness. Logistix is not established as operator in this source, and no actual opening is given. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://waremalcomb.com/projects/hamilton-innovation-center/", "host": "waremalcomb.com", "date": "2025-12-10", "published": "2025-12-10", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 39.44869, "lng": -84.58651, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round27-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "Ware Malcomb describes its design work for Hamilton Innovation Center, planned at about 310,000 square feet on 15 acres with a two-acre substation inside the site.", "independently_verified_current_operating_status": null, "operator_or_site_identity_needs_crosswalk": true }, "notes": [ "Providing design and will-feature language describe a plan. The over-100-MW basis is unspecified. Tier III/N+1 concept is not independent certification or readiness. Logistix is not established as operator in this source, and no actual opening is given.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://waremalcomb.com/projects/hamilton-innovation-center/", "host": "waremalcomb.com", "date": "2025-12-10", "published": "2025-12-10", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The current original project architect page identifies Hamilton Innovation Center in Hamilton Ohio and says it is providing architecture services for a data center. Its will feature and conceptualized language describe a design proposal. This supports a listed named proposal only, without inferring accomplished construction, independent tier certification, current computing service or Logistix as an operator. Advertised design quantities are not adopted as observed load or technical capacity.", "fields": { "current_stage_evidence": { "outcome": "current_named_architect_design_proposal", "scope": "The current original project architect page identifies Hamilton Innovation Center in Hamilton Ohio and says it is providing architecture services for a data center. Its will feature and conceptualized language describe a design proposal. This supports a listed named proposal only, without inferring accomplished construction, independent tier certification, current computing service or Logistix as an operator. Advertised design quantities are not adopted as observed load or technical capacity." }, "source_read_scope": { "project_main_description_read": true, "architect_as_direct_project_participant_not_operator": true, "design_not_observed_construction": true, "unrelated_completed_projects_not_transferred": true } }, "notes": [ "The current original project architect page identifies Hamilton Innovation Center in Hamilton Ohio and says it is providing architecture services for a data center. Its will feature and conceptualized language describe a design proposal. This supports a listed named proposal only, without inferring accomplished construction, independent tier certification, current computing service or Logistix as an operator. Advertised design quantities are not adopted as observed load or technical capacity.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://waremalcomb.com/projects/hamilton-innovation-center/", "host": "waremalcomb.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hamilton · Butler · Source context reviewed", "status_scope": "The current original project architect page identifies Hamilton Innovation Center in Hamilton Ohio and says it is providing architecture services for a data center. Its will feature and conceptualized language describe a design proposal. This supports a listed named proposal only, without inferring accomplished construction, independent tier certification, current computing service or Logistix as an operator. Advertised design quantities are not adopted as observed load or technical capacity.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39017" } }, { "id": "strata-hanging-rock-haverhill-data-center-oh", "state": "oh", "kind": "facility", "name": "Hanging Rock / Haverhill Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lawrence" ], "city": "Hanging Rock", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Precise Hanging Rock/Haverhill footprint and actual operating status unresolved. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://athensindependent.com/data-centers-across-appalachian-ohio/", "host": "athensindependent.com", "date": "2026-08-06", "published": "2026-08-06", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 38.59876, "lng": -82.53699, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Strata Hanging Rock project described as prospective AI campus with generation/cooling claims.", "independently_verified_current_operating_status": null }, "notes": [ "Precise Hanging Rock/Haverhill footprint and actual operating status unresolved.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://athensindependent.com/data-centers-across-appalachian-ohio/", "host": "athensindependent.com", "date": "2026-08-06", "published": "2026-08-06", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hanging Rock · Lawrence · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39087" } }, { "id": "cipher-digital-hashworks-waterford-washington-oh", "state": "oh", "kind": "facility", "name": "HashWorks Powered Land - Waterford Site", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Washington" ], "city": "", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Baseline combined Cipher/HashWorks identity needs splitting/crosswalk. Registered withdrawal capacity is not daily water consumption. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Public DocumentCloud metadata/index readable, two-page document body not manually reviewed.. Metadata does not verify statement contents. Web-tool request returned403; no alternate restricted-content retrieval attempted. Source report separately distinguishes Waterford from Morgan County Cipher proposal.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://athensindependent.com/data-centers-across-appalachian-ohio/", "host": "athensindependent.com", "date": "2026-08-06", "published": "2026-08-06", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.documentcloud.org/documents/28540731-cipher-digital-public-statement/", "host": "documentcloud.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.45534, "lng": -81.49529, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "operator_identity_hold": true, "verified_operator_name": null, "reported_context": "Article distinguishes HashWorks Waterford from Cipher Center Township in Morgan County.", "independently_verified_current_operating_status": null }, "notes": [ "Baseline combined Cipher/HashWorks identity needs splitting/crosswalk. Registered withdrawal capacity is not daily water consumption.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://athensindependent.com/data-centers-across-appalachian-ohio/", "host": "athensindependent.com", "date": "2026-08-06", "published": "2026-08-06", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Public DocumentCloud metadata/index readable, two-page document body not manually reviewed.", "fields": {}, "notes": [ "Metadata does not verify statement contents. Web-tool request returned403; no alternate restricted-content retrieval attempted. Source report separately distinguishes Waterford from Morgan County Cipher proposal.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.documentcloud.org/documents/28540731-cipher-digital-public-statement/", "host": "documentcloud.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Washington · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39167" } }, { "id": "lumen-akron-2-oh", "state": "oh", "kind": "facility", "name": "Lumen Akron 2", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Summit" ], "city": "Akron", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. The report says existing facilities and expansions are excluded, but the original ordinance scope is not independently reviewed. Viking's separate site and company capacity claims are not Lumen facts. North American fleet counts are not United States site totals. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://signalakron.org/future-data-centers-in-akron-may-face-new-review-process/", "host": "signalakron.org", "date": "2026-06-29", "published": "2026-06-29", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 41.14627, "lng": -81.51655, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round27-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "Signal Akron's July 28 editor note reports council approval of the review process on July 27, superseding the future tense in the June story. A caption identifies Lumen at 110 South Arlington.", "independently_verified_current_operating_status": null }, "notes": [ "The report says existing facilities and expansions are excluded, but the original ordinance scope is not independently reviewed. Viking's separate site and company capacity claims are not Lumen facts. North American fleet counts are not United States site totals.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://signalakron.org/future-data-centers-in-akron-may-face-new-review-process/", "host": "signalakron.org", "date": "2026-06-29", "published": "2026-06-29", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Akron · Summit · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39153" } }, { "id": "mara-findlay-oh", "state": "oh", "kind": "facility", "name": "MARA Findlay Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Hancock" ], "city": "Findlay", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. MARA historical Findlay versus Ohio portfolio power. 372MWwholeOhioportfolioincludes150Findlayand222otheracquiredsites,notFindlayalone.152operationalincludes30Findlayand122others;historical2024notcurrent2026.222includes100expansionnotalloperating.270USD/kWacquisitionmultiplebasisnotconstructioncapexorcustomelectricrate. No observed2025targetfulfillmentorcriticalITlabel. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2024-11-11", "MARA published its Findlay development and capacity account November 11, 2024. This records the dated company publication, not an exact physical opening or verification that its year end 2025 expansion forecast was accomplished." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ir.mara.com/news-events/press-releases/detail/1375/mara-adds-372-megawatts-of-capacity-in-ohio-with-152-megawatts-operational-and-220-megawatts-in-development", "host": "ir.mara.com", "date": "2024-11-11", "published": "2024-11-11", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://ir.mara.com/sec-filings/all-sec-filings/content/0001507605-26-000022/0001507605-26-000022.pdf", "host": "ir.mara.com", "published": "2026-08-06", "date": "2026-08-06", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.00192, "lng": -83.66649, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "MARA historical Findlay versus Ohio portfolio power", "fields": { "issuer": "MARA", "announcement_date": "2024-11-11", "findlay_planned_capacity_mw": 150, "findlay_reported_existing_capacity_mw_at_announcement": 30, "historical_full_energization_target": "end2025", "three_ohio_sites_total_interconnect_approved_capacity_mw": 372, "three_sites_operational_at_announcement_mw": 152, "three_sites_in_development_at_announcement_mw": 220, "other_acquired_sites": [ "Hannibal", "Hopedale" ], "other_two_sites_combined_interconnect_approved_mw": 222, "other_sites_acquisition_date": "2024-11-05" }, "notes": [ "372MWwholeOhioportfolioincludes150Findlayand222otheracquiredsites,notFindlayalone.152operationalincludes30Findlayand122others;historical2024notcurrent2026.222includes100expansionnotalloperating.270USD/kWacquisitionmultiplebasisnotconstructioncapexorcustomelectricrate. No observed2025targetfulfillmentorcriticalITlabel.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://ir.mara.com/news-events/press-releases/detail/1375/mara-adds-372-megawatts-of-capacity-in-ohio-with-152-megawatts-operational-and-220-megawatts-in-development", "host": "ir.mara.com", "date": "2024-11-11", "published": "2024-11-11", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "The November 11, 2024 release describes Findlay development and some existing capacity while forecasting later energization. The captured 2026 quarterly filing has no accepted named current Findlay service or physical completion section. An old capacity statement and passed 2025 target are not full campus operation. Historic activity is retained while present exact component phase, commissioning and delivered quantities remain unclear.", "fields": { "current_stage_evidence": { "outcome": "historic_findlay_capacity_and_elapsed_forecast_not_current_completion", "scope": "The November 11, 2024 release describes Findlay development and some existing capacity while forecasting later energization. The captured 2026 quarterly filing has no accepted named current Findlay service or physical completion section. An old capacity statement and passed 2025 target are not full campus operation. Historic activity is retained while present exact component phase, commissioning and delivered quantities remain unclear." } }, "notes": [ "The November 11, 2024 release describes Findlay development and some existing capacity while forecasting later energization. The captured 2026 quarterly filing has no accepted named current Findlay service or physical completion section. An old capacity statement and passed 2025 target are not full campus operation. Historic activity is retained while present exact component phase, commissioning and delivered quantities remain unclear.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://ir.mara.com/news-events/press-releases/detail/1375/mara-adds-372-megawatts-of-capacity-in-ohio-with-152-megawatts-operational-and-220-megawatts-in-development", "host": "ir.mara.com", "published": "2024-11-11", "date": "2024-11-11", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://ir.mara.com/sec-filings/all-sec-filings/content/0001507605-26-000022/0001507605-26-000022.pdf", "host": "ir.mara.com", "published": "2026-08-06", "date": "2026-08-06", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Findlay · Hancock · Source context reviewed", "event_evidence": [ { "date": "2024-11-11", "text": "MARA published its Findlay development and capacity account November 11, 2024. This records the dated company publication, not an exact physical opening or verification that its year end 2025 expansion forecast was accomplished.", "kind": "announced", "sources": [ { "url": "https://ir.mara.com/news-events/press-releases/detail/1375/mara-adds-372-megawatts-of-capacity-in-ohio-with-152-megawatts-operational-and-220-megawatts-in-development", "host": "ir.mara.com", "published": "2024-11-11", "date": "2024-11-11", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39063" } }, { "id": "mara-hannibal-monroe-oh", "state": "oh", "kind": "facility", "name": "MARA Hannibal Data Center", "group": "operating", "status": "Operating phase", "raw_status": "partly operating", "status_field": "current_status", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Monroe" ], "city": "Hannibal", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.. MARANov11,2024issuerreportsNov5closingHannibal/Hopedaletwosites.222MWINTERCONNECTAPPROVEDcombined,122MWthenoperatingcombined,100MWremainingexpansion;noindividualsplit. SeparateFindlay150MWplan,30MWthenoperatingcreates372approved/152operating/220developmentAGGREGATE. Not372MWineachsite,notallAIIT. End2025targetnotobserved2026energization.270USD/kWacquisitionmultiple=270000USD/MW,not270Mcapex. Hopedalepreviouslyhostednowacquired;potential50%costsavingnotactualmeteredresult. Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol.", "date": "", "events": [ [ "2026-08-06", "MARA signed its quarterly filing August 6, 2026, identifying existing Hannibal data center operations beside the contemplated Long Ridge assets. This is the dated company filing, not an exact existing facility opening or commissioning of future HPC capacity." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ir.mara.com/news-events/press-releases/detail/1375/mara-adds-372-megawatts-of-capacity-in-ohio-with-152-megawatts-operational-and-220-megawatts-in-development", "host": "ir.mara.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://ir.mara.com/sec-filings/all-sec-filings/content/0001507605-26-000022/0001507605-26-000022.pdf", "host": "ir.mara.com", "published": "2026-08-06", "date": "2026-08-06", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 39.72734, "lng": -81.08295, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-and-government-review-round46-2026-10-14.json", "scope": "Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.", "fields": { "named_original_context": "MARANov11,2024issuerreportsNov5closingHannibal/Hopedaletwosites.222MWINTERCONNECTAPPROVEDcombined,122MWthenoperatingcombined,100MWremainingexpansion;noindividualsplit. SeparateFindlay150MWplan,30MWthenoperatingcreates372approved/152operating/220developmentAGGREGATE. Not372MWineachsite,notallAIIT. End2025targetnotobserved2026energization.270USD/kWacquisitionmultiple=270000USD/MW,not270Mcapex. Hopedalepreviouslyhostednowacquired;potential50%costsavingnotactualmeteredresult." }, "notes": [ "MARANov11,2024issuerreportsNov5closingHannibal/Hopedaletwosites.222MWINTERCONNECTAPPROVEDcombined,122MWthenoperatingcombined,100MWremainingexpansion;noindividualsplit. SeparateFindlay150MWplan,30MWthenoperatingcreates372approved/152operating/220developmentAGGREGATE. Not372MWineachsite,notallAIIT. End2025targetnotobserved2026energization.270USD/kWacquisitionmultiple=270000USD/MW,not270Mcapex. Hopedalepreviouslyhostednowacquired;potential50%costsavingnotactualmeteredresult.", "Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol." ], "sources": [ { "url": "https://ir.mara.com/news-events/press-releases/detail/1375/mara-adds-372-megawatts-of-capacity-in-ohio-with-152-megawatts-operational-and-220-megawatts-in-development", "host": "ir.mara.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "MARA quarterly filing signed August 6, 2026 expressly identifies existing Hannibal data center operations as adjacent to the planned Long Ridge acquisition. Operating phase applies to that named existing component as reported for the filing period. The proposed power plant acquisition, prospective HPC buildout, future energization and companywide revenue are separate. The filing says the acquisition had not closed at June 30; it is not used to determine any later closing. No capacity, current role or all future campus operation is promoted.", "fields": { "current_stage_evidence": { "outcome": "quarterly_filing_named_existing_hannibal_operations_not_future_long_ridge_hpc", "scope": "MARA quarterly filing signed August 6, 2026 expressly identifies existing Hannibal data center operations as adjacent to the planned Long Ridge acquisition. Operating phase applies to that named existing component as reported for the filing period. The proposed power plant acquisition, prospective HPC buildout, future energization and companywide revenue are separate. The filing says the acquisition had not closed at June 30; it is not used to determine any later closing. No capacity, current role or all future campus operation is promoted." } }, "notes": [ "MARA quarterly filing signed August 6, 2026 expressly identifies existing Hannibal data center operations as adjacent to the planned Long Ridge acquisition. Operating phase applies to that named existing component as reported for the filing period. The proposed power plant acquisition, prospective HPC buildout, future energization and companywide revenue are separate. The filing says the acquisition had not closed at June 30; it is not used to determine any later closing. No capacity, current role or all future campus operation is promoted.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://ir.mara.com/sec-filings/all-sec-filings/content/0001507605-26-000022/0001507605-26-000022.pdf", "host": "ir.mara.com", "published": "2026-08-06", "date": "2026-08-06", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://ir.mara.com/news-events/press-releases/detail/1375/mara-adds-372-megawatts-of-capacity-in-ohio-with-152-megawatts-operational-and-220-megawatts-in-development", "host": "ir.mara.com", "published": "2024-11-11", "date": "2024-11-11", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hannibal · Monroe · Source context reviewed", "status_scope": "MARA quarterly filing signed August 6, 2026 expressly identifies existing Hannibal data center operations as adjacent to the planned Long Ridge acquisition. Operating phase applies to that named existing component as reported for the filing period. The proposed power plant acquisition, prospective HPC buildout, future energization and companywide revenue are separate. The filing says the acquisition had not closed at June 30; it is not used to determine any later closing. No capacity, current role or all future campus operation is promoted.", "event_evidence": [ { "date": "2026-08-06", "text": "MARA signed its quarterly filing August 6, 2026, identifying existing Hannibal data center operations beside the contemplated Long Ridge assets. This is the dated company filing, not an exact existing facility opening or commissioning of future HPC capacity.", "kind": "announced", "sources": [ { "url": "https://ir.mara.com/sec-filings/all-sec-filings/content/0001507605-26-000022/0001507605-26-000022.pdf", "host": "ir.mara.com", "published": "2026-08-06", "date": "2026-08-06", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39111" } }, { "id": "mara-hopedale-harrison-oh", "state": "oh", "kind": "facility", "name": "MARA Hopedale Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Harrison" ], "city": "Hopedale", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.. MARANov11,2024issuerreportsNov5closingHannibal/Hopedaletwosites.222MWINTERCONNECTAPPROVEDcombined,122MWthenoperatingcombined,100MWremainingexpansion;noindividualsplit. SeparateFindlay150MWplan,30MWthenoperatingcreates372approved/152operating/220developmentAGGREGATE. Not372MWineachsite,notallAIIT. End2025targetnotobserved2026energization.270USD/kWacquisitionmultiple=270000USD/MW,not270Mcapex. Hopedalepreviouslyhostednowacquired;potential50%costsavingnotactualmeteredresult. Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol.", "date": "", "events": [ [ "2024-11-11", "MARA published its Ohio acquisition and operating capacity account November 11, 2024, explicitly naming Hopedale. The publication and historical operating account do not certify an exact opening day, current all phase operation or achievement of its later expansion target." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ir.mara.com/news-events/press-releases/detail/1375/mara-adds-372-megawatts-of-capacity-in-ohio-with-152-megawatts-operational-and-220-megawatts-in-development", "host": "ir.mara.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://ir.mara.com/sec-filings/all-sec-filings/content/0001507605-26-000007/0001507605-26-000007.pdf", "host": "ir.mara.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://ir.mara.com/sec-filings/all-sec-filings/content/0001507605-26-000022/0001507605-26-000022.pdf", "host": "ir.mara.com", "published": "2026-08-06", "date": "2026-08-06", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.29366, "lng": -81.09138, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-and-government-review-round46-2026-10-14.json", "scope": "Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.", "fields": { "named_original_context": "MARANov11,2024issuerreportsNov5closingHannibal/Hopedaletwosites.222MWINTERCONNECTAPPROVEDcombined,122MWthenoperatingcombined,100MWremainingexpansion;noindividualsplit. SeparateFindlay150MWplan,30MWthenoperatingcreates372approved/152operating/220developmentAGGREGATE. Not372MWineachsite,notallAIIT. End2025targetnotobserved2026energization.270USD/kWacquisitionmultiple=270000USD/MW,not270Mcapex. Hopedalepreviouslyhostednowacquired;potential50%costsavingnotactualmeteredresult." }, "notes": [ "MARANov11,2024issuerreportsNov5closingHannibal/Hopedaletwosites.222MWINTERCONNECTAPPROVEDcombined,122MWthenoperatingcombined,100MWremainingexpansion;noindividualsplit. SeparateFindlay150MWplan,30MWthenoperatingcreates372approved/152operating/220developmentAGGREGATE. Not372MWineachsite,notallAIIT. End2025targetnotobserved2026energization.270USD/kWacquisitionmultiple=270000USD/MW,not270Mcapex. Hopedalepreviouslyhostednowacquired;potential50%costsavingnotactualmeteredresult.", "Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol." ], "sources": [ { "url": "https://ir.mara.com/news-events/press-releases/detail/1375/mara-adds-372-megawatts-of-capacity-in-ohio-with-152-megawatts-operational-and-220-megawatts-in-development", "host": "ir.mara.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "The November 11, 2024 company release and annual filing describe acquisition of an operational Hopedale site. That is an explicit historic operating account, but the captured later quarterly filing does not provide a named current Hopedale service section. Historic operation and an old expansion forecast do not independently establish exact present component phase. Absence from that filing is not closure, and current Hannibal operation is not transferred to Hopedale.", "fields": { "current_stage_evidence": { "outcome": "historic_named_hopedale_operation_without_current_exact_component_account", "scope": "The November 11, 2024 company release and annual filing describe acquisition of an operational Hopedale site. That is an explicit historic operating account, but the captured later quarterly filing does not provide a named current Hopedale service section. Historic operation and an old expansion forecast do not independently establish exact present component phase. Absence from that filing is not closure, and current Hannibal operation is not transferred to Hopedale." } }, "notes": [ "The November 11, 2024 company release and annual filing describe acquisition of an operational Hopedale site. That is an explicit historic operating account, but the captured later quarterly filing does not provide a named current Hopedale service section. Historic operation and an old expansion forecast do not independently establish exact present component phase. Absence from that filing is not closure, and current Hannibal operation is not transferred to Hopedale.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://ir.mara.com/news-events/press-releases/detail/1375/mara-adds-372-megawatts-of-capacity-in-ohio-with-152-megawatts-operational-and-220-megawatts-in-development", "host": "ir.mara.com", "published": "2024-11-11", "date": "2024-11-11", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://ir.mara.com/sec-filings/all-sec-filings/content/0001507605-26-000007/0001507605-26-000007.pdf", "host": "ir.mara.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://ir.mara.com/sec-filings/all-sec-filings/content/0001507605-26-000022/0001507605-26-000022.pdf", "host": "ir.mara.com", "published": "2026-08-06", "date": "2026-08-06", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hopedale · Harrison · Source context reviewed", "event_evidence": [ { "date": "2024-11-11", "text": "MARA published its Ohio acquisition and operating capacity account November 11, 2024, explicitly naming Hopedale. The publication and historical operating account do not certify an exact opening day, current all phase operation or achievement of its later expansion target.", "kind": "announced", "sources": [ { "url": "https://ir.mara.com/news-events/press-releases/detail/1375/mara-adds-372-megawatts-of-capacity-in-ohio-with-152-megawatts-operational-and-220-megawatts-in-development", "host": "ir.mara.com", "published": "2024-11-11", "date": "2024-11-11", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39067" } }, { "id": "meta-middleton-township-oh", "state": "oh", "kind": "facility", "name": "Meta Bowling Green (Project Accordion)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Wood" ], "city": "Bowling Green", "address": "", "who": "Meta", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Meta Ohio announced campus scope. BowlingGreen market name is not evidence of Kentucky location or exact city boundary. Future forecasts not current spend/jobs. Ordinal24thUS/28thglobal belongs to announcement date, not current physical-building count. Renewable matching intent and planned operational LEED claims not achieved certification or IT MW. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2025-04-09", "Meta announced its Bowling Green in Middleton Township data center development. This is the release date, not a construction start or an opening day." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://datacenters.atmeta.com/2025/04/hello-bowling-green/", "host": "datacenters.atmeta.com", "date": "2025-04-09", "published": "2025-04-09", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://datacenters.atmeta.com/us-locations/", "host": "datacenters.atmeta.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "loc": { "lat": 41.3617, "lng": -83.62299, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-discovery-review-round8-2026-10-14.json", "scope": "Meta Ohio announced campus scope", "fields": { "announcement_date": "2025-04-09", "operator_site_name": "Bowling Green Data Center", "published_locality": "Middleton Township, Wood County, Ohio", "planned_campus_area_sqft": 715000, "planned_investment_usd_min_exclusive": 800000000, "expected_operational_jobs_approx": 100, "expected_peak_construction_jobs_min_exclusive": 1000 }, "notes": [ "BowlingGreen market name is not evidence of Kentucky location or exact city boundary. Future forecasts not current spend/jobs. Ordinal24thUS/28thglobal belongs to announcement date, not current physical-building count. Renewable matching intent and planned operational LEED claims not achieved certification or IT MW.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://datacenters.atmeta.com/2025/04/hello-bowling-green/", "host": "datacenters.atmeta.com", "date": "2025-04-09", "published": "2025-04-09", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 3", "scope": "Meta announced the Bowling Green in Middleton Township development on 2025-04-09. The announcement and current fleet page do not establish a present building completion or exact construction start day. Year only groundbreaking entries, planned jobs and future service language retain their separate scopes. The announcement date is a historical publication event only.", "fields": { "current_stage_evidence": { "outcome": "unresolved", "scope": "Meta announced the Bowling Green in Middleton Township development on 2025-04-09. The announcement and current fleet page do not establish a present building completion or exact construction start day. Year only groundbreaking entries, planned jobs and future service language retain their separate scopes. The announcement date is a historical publication event only." } }, "notes": [ "Meta announced the Bowling Green in Middleton Township development on 2025-04-09. The announcement and current fleet page do not establish a present building completion or exact construction start day. Year only groundbreaking entries, planned jobs and future service language retain their separate scopes. The announcement date is a historical publication event only." ], "sources": [ { "url": "https://datacenters.atmeta.com/2025/04/hello-bowling-green/", "host": "datacenters.atmeta.com", "published": "2025-04-09", "date": "2025-04-09", "checked": "2026-10-22", "label": "Reviewed operator source" }, { "url": "https://datacenters.atmeta.com/us-locations/", "host": "datacenters.atmeta.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check61, October24,2026", "scope": "Meta explicitly identifies the Bowling Green project as located in Middleton Township and Wood County. Its future owned and operated language is a development announcement, not evidence that service has begun. JE Dunn is named for construction information. This does not relocate the retained record to Bowling Green city. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained.", "fields": { "company_association": { "name": "Meta", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Meta explicitly identifies the Bowling Green project as located in Middleton Township and Wood County. Its future owned and operated language is a development announcement, not evidence that service has begun. JE Dunn is named for construction information. This does not relocate the retained record to Bowling Green city. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained." }, "provider_role": "developer" }, "notes": [ "Meta explicitly identifies the Bowling Green project as located in Middleton Township and Wood County. Its future owned and operated language is a development announcement, not evidence that service has begun. JE Dunn is named for construction information. This does not relocate the retained record to Bowling Green city. The previously empty company field is filled only from this explicit provider identity. Existing status, location, address, county, quantities, dates and component identity remain exact. A street in the account does not newly admit a location, parcel or roof. Publication and modification dates are not construction milestones. No personal contact or resident names are retained." ], "sources": [ { "url": "https://datacenters.atmeta.com/2025/04/hello-bowling-green/", "host": "datacenters.atmeta.com", "published": "2025-04-09", "date": "2025-04-09", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Bowling Green · Wood · Source context reviewed", "event_evidence": [ { "date": "2025-04-09", "text": "Meta announced its Bowling Green in Middleton Township data center development. This is the release date, not a construction start or an opening day.", "kind": "announced", "sources": [ { "url": "https://datacenters.atmeta.com/2025/04/hello-bowling-green/", "host": "datacenters.atmeta.com", "published": "2025-04-09", "date": "2025-04-09", "checked": "2026-10-22", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39173" } }, { "id": "meta-prometheus-new-albany-oh", "state": "oh", "kind": "facility", "name": "Meta Prometheus", "group": "proposed", "status": "AI expansion planned", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. The visible publication date is November 17, not the November 13 URL. Gigawatt-scale, world-first, no-grid-use and no-rate-impact statements are plans or attributed claims, not verified operating metrics or guarantees. Temporary construction jobs are not permanent jobs; no completed generation or power agreement is established. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://spectrumnews1.com/oh/columbus/news/2025/11/13/meta-gigawatt-data-center-new-albany-", "host": "spectrumnews1.com", "date": "2025-11-17", "published": "2025-11-17", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://datacenters.atmeta.com/asset/new-albany-data-center-info-sheet/", "host": "datacenters.atmeta.com", "published": "", "date": "", "checked": "2026-10-16", "label": "Reviewed current operator evidence" } ], "loc": { "lat": 40.10919, "lng": -82.43475, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round28-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "Spectrum News reports ongoing Prometheus construction and officials' plans for on-site gas generation at Meta's New Albany campus.", "independently_verified_current_operating_status": null }, "notes": [ "The visible publication date is November 17, not the November 13 URL. Gigawatt-scale, world-first, no-grid-use and no-rate-impact statements are plans or attributed claims, not verified operating metrics or guarantees. Temporary construction jobs are not permanent jobs; no completed generation or power agreement is established.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://spectrumnews1.com/oh/columbus/news/2025/11/13/meta-gigawatt-data-center-new-albany-", "host": "spectrumnews1.com", "date": "2025-11-17", "published": "2025-11-17", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "overnight-status-2026-10-16", "scope": "Named project and operator-service status review; phase and source limits retained.", "fields": { "current_stage_evidence": { "outcome": "supported_label", "label": "AI expansion planned", "basis": "The current New Albany factsheet specifically names Prometheus and describes its AI role and delivery in future terms.", "checked_on": "2026-10-16" }, "stage_review_limits": "Existing operation of the older New Albany campus does not establish operation or completion of the Prometheus AI expansion. No current delivered gigawatt or energized load is asserted." }, "notes": [ "Existing operation of the older New Albany campus does not establish operation or completion of the Prometheus AI expansion. No current delivered gigawatt or energized load is asserted.", "Current service and project labels are source-scoped research contexts. No entire record, physical site, technical quantity or exact parcel is certified." ], "sources": [ { "url": "https://datacenters.atmeta.com/asset/new-albany-data-center-info-sheet/", "host": "datacenters.atmeta.com", "published": "", "date": "", "checked": "2026-10-16", "label": "Reviewed current operator evidence" } ], "checked": "2026-10-16", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "status_scope": "Primary source review checked 2026-10-16. The current New Albany factsheet specifically names Prometheus and describes its AI role and delivery in future terms. Existing operation of the older New Albany campus does not establish operation or completion of the Prometheus AI expansion. No current delivered gigawatt or energized load is asserted.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "microsoft-heath-oh", "state": "oh", "kind": "facility", "name": "Microsoft Heath Data Center", "group": "building", "status": "Site development underway", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "Heath", "address": "", "who": "Microsoft", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named source section or explicitly limited regional context; no metered load or exact parcel automatically certified.. Site preparation is not a completed operating building. Forecast November grading completion not observed as of October14. July substation work is prospective, not actual energization. Future tree-removal or work-hour text does not establish a new hearing or current road closure. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://local.microsoft.com/blog/heath-datacenter-construction-updates/", "host": "local.microsoft.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.11236, "lng": -82.53349, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round16-2026-10-14.json", "scope": "Named source section or explicitly limited regional context; no metered load or exact parcel automatically certified.", "fields": { "latest_dated_update": "2026-07", "reported_activity": "Summer site preparation, grading, stormwater controls and fencing; substation work expected to begin.", "general_contractor": "Ames Construction", "vertical_construction_schedule": "Not determined/awaiting detail in March2026 update.", "older_mass_grading_forecast": "February through November2026", "actual_operational_date": null, "reported_access": "Thornwood Drive construction entrance; second off Lees Road planned" }, "notes": [ "Site preparation is not a completed operating building. Forecast November grading completion not observed as of October14. July substation work is prospective, not actual energization.", "Future tree-removal or work-hour text does not establish a new hearing or current road closure.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://local.microsoft.com/blog/heath-datacenter-construction-updates/", "host": "local.microsoft.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 13", "scope": "Microsoft reports continuing site preparation in Heath, including grading, stormwater pond work and erosion controls, in its July 2026 update. Site development underway is scoped to those preliminary physical works. The source treats vertical construction as a later phase and expressly separates construction completion from operation. No finished server building, operating capacity or exact construction start day is inferred.", "fields": { "current_stage_evidence": { "outcome": "operator_reported_preliminary_site_development", "scope": "Microsoft reports continuing site preparation in Heath, including grading, stormwater pond work and erosion controls, in its July 2026 update. Site development underway is scoped to those preliminary physical works. The source treats vertical construction as a later phase and expressly separates construction completion from operation. No finished server building, operating capacity or exact construction start day is inferred." }, "phase_scope": { "reported_activity_period": "July 2026", "preliminary_site_works_distinct_from_vertical_construction": true, "datacenter_operation_verified": false, "month_not_converted_into_exact_start_day": true } }, "notes": [ "Microsoft reports continuing site preparation in Heath, including grading, stormwater pond work and erosion controls, in its July 2026 update. Site development underway is scoped to those preliminary physical works. The source treats vertical construction as a later phase and expressly separates construction completion from operation. No finished server building, operating capacity or exact construction start day is inferred.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones." ], "sources": [ { "url": "https://local.microsoft.com/blog/heath-datacenter-construction-updates/", "host": "local.microsoft.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check59, October24,2026", "scope": "Microsoft identifies its own Heath data center project in the main body of the official community update. Developer per source identifies the Microsoft provider brand for this retained project only. The previously empty company field is filled from that explicit source, without assigning a legal subsidiary, landowner, contractor or current operator. Existing status, location, address, county, quantities, dates and component identity remain exact. Any separately retained street is identity context only and does not newly admit a location, parcel or roof. Proposed designs, forecast schedules, contractor descriptions and community measures do not certify current physical completion, operation, permits, impacts or site ownership. Declared publication and modification dates are separate from construction milestones. No personal contact or resident names are retained in the review. Microsoft names Ames Construction as general contractor and describes site preparation, truck traffic and erosion controls. Potential Sunday work is not an unrestricted right or proof that work occurred, and no vertical completion or opening is inferred.", "fields": { "company_association": { "name": "Microsoft", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Microsoft identifies its own Heath data center project in the main body of the official community update. Developer per source identifies the Microsoft provider brand for this retained project only. The previously empty company field is filled from that explicit source, without assigning a legal subsidiary, landowner, contractor or current operator. Existing status, location, address, county, quantities, dates and component identity remain exact. Any separately retained street is identity context only and does not newly admit a location, parcel or roof. Proposed designs, forecast schedules, contractor descriptions and community measures do not certify current physical completion, operation, permits, impacts or site ownership. Declared publication and modification dates are separate from construction milestones. No personal contact or resident names are retained in the review. Microsoft names Ames Construction as general contractor and describes site preparation, truck traffic and erosion controls. Potential Sunday work is not an unrestricted right or proof that work occurred, and no vertical completion or opening is inferred." }, "provider_role": "developer" }, "notes": [ "Microsoft identifies its own Heath data center project in the main body of the official community update. Developer per source identifies the Microsoft provider brand for this retained project only. The previously empty company field is filled from that explicit source, without assigning a legal subsidiary, landowner, contractor or current operator. Existing status, location, address, county, quantities, dates and component identity remain exact. Any separately retained street is identity context only and does not newly admit a location, parcel or roof. Proposed designs, forecast schedules, contractor descriptions and community measures do not certify current physical completion, operation, permits, impacts or site ownership. Declared publication and modification dates are separate from construction milestones. No personal contact or resident names are retained in the review. Microsoft names Ames Construction as general contractor and describes site preparation, truck traffic and erosion controls. Potential Sunday work is not an unrestricted right or proof that work occurred, and no vertical completion or opening is inferred." ], "sources": [ { "url": "https://local.microsoft.com/blog/heath-datacenter-construction-updates/", "host": "local.microsoft.com", "published": "2026-03-02", "date": "2026-03-02", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Heath · Licking · Source context reviewed", "status_scope": "Microsoft reports continuing site preparation in Heath, including grading, stormwater pond work and erosion controls, in its July 2026 update. Site development underway is scoped to those preliminary physical works. The source treats vertical construction as a later phase and expressly separates construction completion from operation. No finished server building, operating capacity or exact construction start day is inferred.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "microsoft-hebron-oh", "state": "oh", "kind": "facility", "name": "Microsoft Hebron Data Center", "group": "building", "status": "Site development underway", "raw_status": "under construction", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "Hebron", "address": "", "who": "Microsoft", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named source section or explicitly limited regional context; no metered load or exact parcel automatically certified.. Site preparation is not a completed operating building. Forecast November grading completion not observed as of October14. July substation work is prospective, not actual energization. Future tree-removal or work-hour text does not establish a new hearing or current road closure. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://local.microsoft.com/blog/hebron-datacenter-construction-update/", "host": "local.microsoft.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.03946, "lng": -82.45869, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round16-2026-10-14.json", "scope": "Named source section or explicitly limited regional context; no metered load or exact parcel automatically certified.", "fields": { "latest_dated_update": "2026-07", "reported_activity": "Summer site preparation, grading, stormwater controls and fencing; substation work expected to begin.", "general_contractor": "Ames Construction", "vertical_construction_schedule": "Not determined/awaiting detail in March2026 update.", "older_mass_grading_forecast": "February through November2026", "actual_operational_date": null, "reported_access": "Temporary Canyon Road entrance; permanent east entrance by industrial park planned" }, "notes": [ "Site preparation is not a completed operating building. Forecast November grading completion not observed as of October14. July substation work is prospective, not actual energization.", "Future tree-removal or work-hour text does not establish a new hearing or current road closure.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://local.microsoft.com/blog/hebron-datacenter-construction-update/", "host": "local.microsoft.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 13", "scope": "Microsoft reports continuing site preparation in Hebron, including grading, stormwater pond work and erosion controls, in its July 2026 update. Site development underway is scoped to those preliminary physical works. The source treats vertical construction as a later phase and expressly separates construction completion from operation. No finished server building, operating capacity or exact construction start day is inferred.", "fields": { "current_stage_evidence": { "outcome": "operator_reported_preliminary_site_development", "scope": "Microsoft reports continuing site preparation in Hebron, including grading, stormwater pond work and erosion controls, in its July 2026 update. Site development underway is scoped to those preliminary physical works. The source treats vertical construction as a later phase and expressly separates construction completion from operation. No finished server building, operating capacity or exact construction start day is inferred." }, "phase_scope": { "reported_activity_period": "July 2026", "preliminary_site_works_distinct_from_vertical_construction": true, "datacenter_operation_verified": false, "month_not_converted_into_exact_start_day": true } }, "notes": [ "Microsoft reports continuing site preparation in Hebron, including grading, stormwater pond work and erosion controls, in its July 2026 update. Site development underway is scoped to those preliminary physical works. The source treats vertical construction as a later phase and expressly separates construction completion from operation. No finished server building, operating capacity or exact construction start day is inferred.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Document and source check dates remain separate from physical milestones." ], "sources": [ { "url": "https://local.microsoft.com/blog/hebron-datacenter-construction-update/", "host": "local.microsoft.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check59, October24,2026", "scope": "Microsoft identifies its own Hebron data center project in the main body of the official community update. Developer per source identifies the Microsoft provider brand for this retained project only. The previously empty company field is filled from that explicit source, without assigning a legal subsidiary, landowner, contractor or current operator. Existing status, location, address, county, quantities, dates and component identity remain exact. Any separately retained street is identity context only and does not newly admit a location, parcel or roof. Proposed designs, forecast schedules, contractor descriptions and community measures do not certify current physical completion, operation, permits, impacts or site ownership. Declared publication and modification dates are separate from construction milestones. No personal contact or resident names are retained in the review. Microsoft names Ames Construction as general contractor. Its possible brief trail closure is prospective, not an observed closure; estimated grading completion is not operation or availability.", "fields": { "company_association": { "name": "Microsoft", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Microsoft identifies its own Hebron data center project in the main body of the official community update. Developer per source identifies the Microsoft provider brand for this retained project only. The previously empty company field is filled from that explicit source, without assigning a legal subsidiary, landowner, contractor or current operator. Existing status, location, address, county, quantities, dates and component identity remain exact. Any separately retained street is identity context only and does not newly admit a location, parcel or roof. Proposed designs, forecast schedules, contractor descriptions and community measures do not certify current physical completion, operation, permits, impacts or site ownership. Declared publication and modification dates are separate from construction milestones. No personal contact or resident names are retained in the review. Microsoft names Ames Construction as general contractor. Its possible brief trail closure is prospective, not an observed closure; estimated grading completion is not operation or availability." }, "provider_role": "developer" }, "notes": [ "Microsoft identifies its own Hebron data center project in the main body of the official community update. Developer per source identifies the Microsoft provider brand for this retained project only. The previously empty company field is filled from that explicit source, without assigning a legal subsidiary, landowner, contractor or current operator. Existing status, location, address, county, quantities, dates and component identity remain exact. Any separately retained street is identity context only and does not newly admit a location, parcel or roof. Proposed designs, forecast schedules, contractor descriptions and community measures do not certify current physical completion, operation, permits, impacts or site ownership. Declared publication and modification dates are separate from construction milestones. No personal contact or resident names are retained in the review. Microsoft names Ames Construction as general contractor. Its possible brief trail closure is prospective, not an observed closure; estimated grading completion is not operation or availability." ], "sources": [ { "url": "https://local.microsoft.com/blog/hebron-datacenter-construction-update/", "host": "local.microsoft.com", "published": "2025-11-13", "date": "2025-11-13", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hebron · Licking · Source context reviewed", "status_scope": "Microsoft reports continuing site preparation in Hebron, including grading, stormwater pond work and erosion controls, in its July 2026 update. Site development underway is scoped to those preliminary physical works. The source treats vertical construction as a later phase and expressly separates construction completion from operation. No finished server building, operating capacity or exact construction start day is inferred.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "db-stu-mount-orab-brown-oh", "state": "oh", "kind": "facility", "name": "Mount Orab Mega-Site Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Brown" ], "city": "Mount Orab", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. Proposedpause explicitly notadopted inthissource. General CRAauthorization is not a project-specific executedabatement or actualpaidbenefit. Tracker 81/100 risk is editorialscore, not independenttechnicalfinding. NDA/emergency-ordinance illegality andlitigation claims are allegations/interpretations without reviewedoriginalpleadings. HB 695 pendingbill andballotpetitioncertification/signaturecollection are not enacted 25 MWstateban or confirmedballotqualification. GenericOPSB 50 MWassertion cannot establish jurisdiction over every electricalLOAD; nolegalconclusionadopted. Operator undisclosed, no siteITMW/ESA/RFSverified. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://stopohiodatacenters.org/brown-county", "host": "stopohiodatacenters.org", "date": "2026-04-26", "published": "2026-04-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 38.93376, "lng": -83.86724, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "StopOhioDataCenters’ BrownCounty page describes DBStu’s roughly 1000 acreMt.Orab site-control/zoning/NDAcontroversy and a councilmember’s proposed six-monthpause, relying on other reporting.", "independently_verified_current_operating_status": null }, "notes": [ "Proposedpause explicitly notadopted inthissource. General CRAauthorization is not a project-specific executedabatement or actualpaidbenefit. Tracker 81/100 risk is editorialscore, not independenttechnicalfinding. NDA/emergency-ordinance illegality andlitigation claims are allegations/interpretations without reviewedoriginalpleadings. HB 695 pendingbill andballotpetitioncertification/signaturecollection are not enacted 25 MWstateban or confirmedballotqualification. GenericOPSB 50 MWassertion cannot establish jurisdiction over every electricalLOAD; nolegalconclusionadopted. Operator undisclosed, no siteITMW/ESA/RFSverified.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://stopohiodatacenters.org/brown-county", "host": "stopohiodatacenters.org", "date": "2026-04-26", "published": "2026-04-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Mount Orab · Brown · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39015" } }, { "id": "oregon-industrial-park-data-center-lucas-oh", "state": "oh", "kind": "facility", "name": "Oregon Industrial Park Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lucas" ], "city": "Oregon", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Originaloperator/localreporter orvisibleoriginalregulatorycopy, stage/date/numericalscopeexplicit.. 13abc BriannaWeaver July29,2026 originalinterview identifies Vantage asPROSPECTIVEdeveloper forOregonOhio Wynn/Corduroyroads proposal. Currentplanthreebuildings mayhavemultipleendusers; nofinaldecision, futurepropertytransfer/compensationnegotiations. Christmasanswer is atarget, notsigneddeal/permit. Petitiondrive1400signatures/fivedaysleft andNovemberballot aspiration are notvalidatedsignatures, acceptedreferendum or electionoutcome. Rumoredexpansionoutsideboundaryexplicitlynotonplan. Vantage2010company/2013Washingtonfirstsite doesnotdateOhiofacility. NoITMW orexactparcelgiven. Notallfield/currentoperatingcensus/fullyexecutedcontract/actualpaymentorimpactcertification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.13abc.com/2026/07/29/oregon-officials-eye-vantage-data-centers-proposed-development-near-wynn-corduroy-roads/", "host": "13abc.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 41.61988, "lng": -83.65847, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "border-state-permit-execution-and-capacity-scope-review-round71-2026-10-15.json", "scope": "Originaloperator/localreporter orvisibleoriginalregulatorycopy, stage/date/numericalscopeexplicit.", "fields": {}, "notes": [ "13abc BriannaWeaver July29,2026 originalinterview identifies Vantage asPROSPECTIVEdeveloper forOregonOhio Wynn/Corduroyroads proposal. Currentplanthreebuildings mayhavemultipleendusers; nofinaldecision, futurepropertytransfer/compensationnegotiations. Christmasanswer is atarget, notsigneddeal/permit.", "Petitiondrive1400signatures/fivedaysleft andNovemberballot aspiration are notvalidatedsignatures, acceptedreferendum or electionoutcome. Rumoredexpansionoutsideboundaryexplicitlynotonplan. Vantage2010company/2013Washingtonfirstsite doesnotdateOhiofacility. NoITMW orexactparcelgiven.", "Notallfield/currentoperatingcensus/fullyexecutedcontract/actualpaymentorimpactcertification." ], "sources": [ { "url": "https://www.13abc.com/2026/07/29/oregon-officials-eye-vantage-data-centers-proposed-development-near-wynn-corduroy-roads/", "host": "13abc.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Oregon · Lucas · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39095" } }, { "id": "new-day-ports-technology-campus-piketon-oh", "state": "oh", "kind": "facility", "name": "PORTS-Pike Technology Campus", "group": "proposed", "status": "Listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Pike" ], "city": "Piketon", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.. DOENov17,2025NEPAwebentrydescribesPROPOSEDlease189acBatch1PORTS. Pagealoneisnotexecutedlease,wholecampusenvironmentalapproval/constructionpermitorcurrentoperation. UnderlyinglinkedPDFnotreadinthispass. Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol. DOEApr29,2026NEPAwebentrysaysPikeCountyPortsmouthDCLLC hasLEASEDapprox189acforAI/cloudandancillaryuses,phasedBatch1premises. Evidenceofreportedleasebydate,notexactclosingday/deed/newwholecampusarea. ESAinthistitlemeansEnvironmentalSiteAssessment,notElectricalServiceAgreement. UnderlyingPDFnotread. DOEMar20,2026factsheetdescribesplanned10GWdatacenterdevelopmentplus10GWNEWGENERATIONincludingatleast9.2GWgas;not20GWIT. Italso says10GWcomputepowerincluding9.2GWgen,soheadlineterminologyinconsistent;noITcertification.33.3BJapanese fundingforgeneration,4.2Bfuturetransmission,40Mcommunitycommitmentnotadditivewholecampuscapexorpaidfunds.765kVvoltage/foursubstationsnotMW. Dedicatedratestructurewillbeagreed,notexecutedtarifforprooflowerratepayerbills.10000constructionover4yr/2000+operationsregionalwholeprogramforecastsnot189acdirectsitepayroll. DOEMar24,2026EMphotocaptionreportsMar20groundbreaking;189acinitialphasewithdevelopmentexpected2026. Ceremonydoesnotproveconstruction/airpermit,RFSorallsitecleanupfinished.10GWgeneration/data-centerfiguresnot20GWIT;worldlargestclaimunverified. Leaseisgovernmentreported,notclosedlandpurchase. PermittingCouncilJune16,2026FAST41coverage forSBPORTSTechnologyCampus;USACEleadagency. Coverageprovidescoordinatedreview/timetable,notallpermitsapproved,NEPAcompletionorenergization.10GWcomplexincludesseparategasgen/gridupgrades;33Bquoteunclearscopenotnewpaidcampuscapex. NoexactnewRFS.", "date": "", "events": [ [ "2025-11-17", "DOE signed its Batch 1 Portsmouth proposed property lease categorical exclusion determination November 17, 2025. This dates the agency property transfer review, not an executed computing lease, construction approval or operating campus." ], [ "2026-04-29", "DOE signed its Batch 1 Portsmouth environmental site assessment categorical exclusion determination April 29, 2026. The described first phase concerns assessment for a planned AI and cloud campus, not completed campus review, physical construction or computing service." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.energy.gov/nepa/articles/cx-270875-4511a-086-lease-real-property-batch-1-property-portsmouth-gaseous-diffusion", "host": "energy.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.energy.gov/nepa/articles/cx-270956-environmental-site-assessment-esa-batch-1-leased-property-portsmouth", "host": "energy.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.energy.gov/articles/fact-sheet-department-energy-ensuring-affordable-energy-access-ohio-while-powering-future", "host": "energy.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.energy.gov/em/articles/partnership-ensures-affordable-energy-powers-ai-future-portsmouth-site", "host": "energy.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.permitting.gov/newsroom/press-releases/ports-technology-campus-latest-gain-fast-41-coverage", "host": "permitting.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.energy.gov/sites/default/files/2025-11/CX-270875.pdf", "host": "www.energy.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.energy.gov/sites/default/files/2026-04/CX-270956.pdf", "host": "www.energy.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 39.07716, "lng": -83.06665, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-and-government-review-round46-2026-10-14.json", "scope": "Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.", "fields": { "named_original_context": "DOENov17,2025NEPAwebentrydescribesPROPOSEDlease189acBatch1PORTS. Pagealoneisnotexecutedlease,wholecampusenvironmentalapproval/constructionpermitorcurrentoperation. UnderlyinglinkedPDFnotreadinthispass." }, "notes": [ "DOENov17,2025NEPAwebentrydescribesPROPOSEDlease189acBatch1PORTS. Pagealoneisnotexecutedlease,wholecampusenvironmentalapproval/constructionpermitorcurrentoperation. UnderlyinglinkedPDFnotreadinthispass.", "Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol." ], "sources": [ { "url": "https://www.energy.gov/nepa/articles/cx-270875-4511a-086-lease-real-property-batch-1-property-portsmouth-gaseous-diffusion", "host": "energy.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "operator-and-government-review-round46-2026-10-14.json", "scope": "Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.", "fields": { "named_original_context": "DOEApr29,2026NEPAwebentrysaysPikeCountyPortsmouthDCLLC hasLEASEDapprox189acforAI/cloudandancillaryuses,phasedBatch1premises. Evidenceofreportedleasebydate,notexactclosingday/deed/newwholecampusarea. ESAinthistitlemeansEnvironmentalSiteAssessment,notElectricalServiceAgreement. UnderlyingPDFnotread." }, "notes": [ "DOEApr29,2026NEPAwebentrysaysPikeCountyPortsmouthDCLLC hasLEASEDapprox189acforAI/cloudandancillaryuses,phasedBatch1premises. Evidenceofreportedleasebydate,notexactclosingday/deed/newwholecampusarea. ESAinthistitlemeansEnvironmentalSiteAssessment,notElectricalServiceAgreement. UnderlyingPDFnotread.", "Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol." ], "sources": [ { "url": "https://www.energy.gov/nepa/articles/cx-270956-environmental-site-assessment-esa-batch-1-leased-property-portsmouth", "host": "energy.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "operator-and-government-review-round46-2026-10-14.json", "scope": "Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.", "fields": { "named_original_context": "DOEMar20,2026factsheetdescribesplanned10GWdatacenterdevelopmentplus10GWNEWGENERATIONincludingatleast9.2GWgas;not20GWIT. Italso says10GWcomputepowerincluding9.2GWgen,soheadlineterminologyinconsistent;noITcertification.33.3BJapanese fundingforgeneration,4.2Bfuturetransmission,40Mcommunitycommitmentnotadditivewholecampuscapexorpaidfunds.765kVvoltage/foursubstationsnotMW. Dedicatedratestructurewillbeagreed,notexecutedtarifforprooflowerratepayerbills.10000constructionover4yr/2000+operationsregionalwholeprogramforecastsnot189acdirectsitepayroll." }, "notes": [ "DOEMar20,2026factsheetdescribesplanned10GWdatacenterdevelopmentplus10GWNEWGENERATIONincludingatleast9.2GWgas;not20GWIT. Italso says10GWcomputepowerincluding9.2GWgen,soheadlineterminologyinconsistent;noITcertification.33.3BJapanese fundingforgeneration,4.2Bfuturetransmission,40Mcommunitycommitmentnotadditivewholecampuscapexorpaidfunds.765kVvoltage/foursubstationsnotMW. Dedicatedratestructurewillbeagreed,notexecutedtarifforprooflowerratepayerbills.10000constructionover4yr/2000+operationsregionalwholeprogramforecastsnot189acdirectsitepayroll.", "Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol." ], "sources": [ { "url": "https://www.energy.gov/articles/fact-sheet-department-energy-ensuring-affordable-energy-access-ohio-while-powering-future", "host": "energy.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "operator-and-government-review-round46-2026-10-14.json", "scope": "Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.", "fields": { "named_original_context": "DOEMar24,2026EMphotocaptionreportsMar20groundbreaking;189acinitialphasewithdevelopmentexpected2026. Ceremonydoesnotproveconstruction/airpermit,RFSorallsitecleanupfinished.10GWgeneration/data-centerfiguresnot20GWIT;worldlargestclaimunverified. Leaseisgovernmentreported,notclosedlandpurchase." }, "notes": [ "DOEMar24,2026EMphotocaptionreportsMar20groundbreaking;189acinitialphasewithdevelopmentexpected2026. Ceremonydoesnotproveconstruction/airpermit,RFSorallsitecleanupfinished.10GWgeneration/data-centerfiguresnot20GWIT;worldlargestclaimunverified. Leaseisgovernmentreported,notclosedlandpurchase.", "Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol." ], "sources": [ { "url": "https://www.energy.gov/em/articles/partnership-ensures-affordable-energy-powers-ai-future-portsmouth-site", "host": "energy.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "operator-and-government-review-round46-2026-10-14.json", "scope": "Originaloperator/issuer/government namedidentity,historicaltransaction orproposal/policycontext;notwhole-recordcurrentoperationcertification.", "fields": { "named_original_context": "PermittingCouncilJune16,2026FAST41coverage forSBPORTSTechnologyCampus;USACEleadagency. Coverageprovidescoordinatedreview/timetable,notallpermitsapproved,NEPAcompletionorenergization.10GWcomplexincludesseparategasgen/gridupgrades;33Bquoteunclearscopenotnewpaidcampuscapex. NoexactnewRFS." }, "notes": [ "PermittingCouncilJune16,2026FAST41coverage forSBPORTSTechnologyCampus;USACEleadagency. Coverageprovidescoordinatedreview/timetable,notallpermitsapproved,NEPAcompletionorenergization.10GWcomplexincludesseparategasgen/gridupgrades;33Bquoteunclearscopenotnewpaidcampuscapex. NoexactnewRFS.", "Sharedaggregatepower/generation,unknownITbasisanddate-rolelimitationscontrol." ], "sources": [ { "url": "https://www.permitting.gov/newsroom/press-releases/ports-technology-campus-latest-gain-fast-41-coverage", "host": "permitting.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 54", "scope": "The original DOE April 29, 2026 assessment determination identifies leased Batch 1 property at Portsmouth in Piketon and its intended AI and cloud campus. Phase 1 assessment activities are to establish feasibility, permitting, design and construction requirements. The November 17, 2025 determination concerns a proposed property transfer. The retained current agency project records support a listed campus proposal only. Neither categorical exclusion certifies completed campus environmental review, a construction permit, completed assessment, physical construction or computing operation. No New Day ownership, tenant, quantity or parcel field is certified or changed.", "fields": { "current_stage_evidence": { "outcome": "agency_listed_campus_assessment_proposal", "scope": "The original DOE April 29, 2026 assessment determination identifies leased Batch 1 property at Portsmouth in Piketon and its intended AI and cloud campus. Phase 1 assessment activities are to establish feasibility, permitting, design and construction requirements. The November 17, 2025 determination concerns a proposed property transfer. The retained current agency project records support a listed campus proposal only. Neither categorical exclusion certifies completed campus environmental review, a construction permit, completed assessment, physical construction or computing operation. No New Day ownership, tenant, quantity or parcel field is certified or changed." }, "source_read_scope": { "lease_determination_text_and_visual_pages": [ 1 ], "assessment_determination_text_and_visual_pages": [ 1 ], "actual_digital_signature_dates_read": true, "web_entries_main_descriptions_read": true, "assessment_scope_not_entire_campus_approval": true } }, "notes": [ "The original DOE April 29, 2026 assessment determination identifies leased Batch 1 property at Portsmouth in Piketon and its intended AI and cloud campus. Phase 1 assessment activities are to establish feasibility, permitting, design and construction requirements. The November 17, 2025 determination concerns a proposed property transfer. The retained current agency project records support a listed campus proposal only. Neither categorical exclusion certifies completed campus environmental review, a construction permit, completed assessment, physical construction or computing operation. No New Day ownership, tenant, quantity or parcel field is certified or changed.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Proposal and administrative evidence do not certify computing operation." ], "sources": [ { "url": "https://www.energy.gov/nepa/articles/cx-270875-4511a-086-lease-real-property-batch-1-property-portsmouth-gaseous-diffusion", "host": "www.energy.gov", "published": "2025-11-17", "date": "2025-11-17", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.energy.gov/nepa/articles/cx-270956-environmental-site-assessment-esa-batch-1-leased-property-portsmouth", "host": "www.energy.gov", "published": "2026-04-29", "date": "2026-04-29", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.energy.gov/sites/default/files/2025-11/CX-270875.pdf", "host": "www.energy.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.energy.gov/sites/default/files/2026-04/CX-270956.pdf", "host": "www.energy.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Piketon · Pike · Source context reviewed", "status_scope": "The original DOE April 29, 2026 assessment determination identifies leased Batch 1 property at Portsmouth in Piketon and its intended AI and cloud campus. Phase 1 assessment activities are to establish feasibility, permitting, design and construction requirements. The November 17, 2025 determination concerns a proposed property transfer. The retained current agency project records support a listed campus proposal only. Neither categorical exclusion certifies completed campus environmental review, a construction permit, completed assessment, physical construction or computing operation. No New Day ownership, tenant, quantity or parcel field is certified or changed.", "event_evidence": [ { "date": "2025-11-17", "text": "DOE signed its Batch 1 Portsmouth proposed property lease categorical exclusion determination November 17, 2025. This dates the agency property transfer review, not an executed computing lease, construction approval or operating campus.", "kind": "announced", "sources": [ { "url": "https://www.energy.gov/nepa/articles/cx-270875-4511a-086-lease-real-property-batch-1-property-portsmouth-gaseous-diffusion", "host": "www.energy.gov", "published": "2025-11-17", "date": "2025-11-17", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.energy.gov/sites/default/files/2025-11/CX-270875.pdf", "host": "www.energy.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] }, { "date": "2026-04-29", "text": "DOE signed its Batch 1 Portsmouth environmental site assessment categorical exclusion determination April 29, 2026. The described first phase concerns assessment for a planned AI and cloud campus, not completed campus review, physical construction or computing service.", "kind": "announced", "sources": [ { "url": "https://www.energy.gov/nepa/articles/cx-270956-environmental-site-assessment-esa-batch-1-leased-property-portsmouth", "host": "www.energy.gov", "published": "2026-04-29", "date": "2026-04-29", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.energy.gov/sites/default/files/2026-04/CX-270956.pdf", "host": "www.energy.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39131" } }, { "id": "google-project-dazzler-franklin-furnace-oh", "state": "oh", "kind": "facility", "name": "Project Dazzler", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Scioto" ], "city": "Franklin Furnace", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Originaloperator/localreporter orvisibleoriginalregulatorycopy, stage/date/numericalscopeexplicit.. SciotoValleyGuardian JasonSalley March6,2026updatedJuly1 report namesTiltedGateLLC ProjectDazzlerFranklinFurnace. Headerkeypermitclearsreview mustnotbecomepermitissued: bodyandoriginalletter say ADMINISTRATIVELYCOMPLETEapplication, technicalreviewstillrequired. No finalwetlandspermit/buildingapproval/commissioning established. $1B/1.7Msf/792acres/twobuildings/$500kannualPILOT/75%15yrabatement/50phase1jobsare reportedproposal/agreement claims, notinspectedexecutedcontract, payments, spentcapex oractualworkers. No multiplicationintopaidtax/subsidytotal. EastofOhioRivergeographicwordingnotusedtoverifyparcels. ApplicantTiltedGate notautomaticallysignedGoogletenant/operatorproof. Notallfield/currentoperatingcensus/fullyexecutedcontract/actualpaymentorimpactcertification. Both2pagesofOhioEPA-authoredProjectDazzlerletterhostedbynewspaper readVISUALLYonly. DatedMarch5,2026,applicationreceivedFeb13,OhioEPAID262431W,LevelThreeIsolatedWetlandsAPPLICATIONadministrativelycomplete. Intermediatecorrespondence, notfinalpermit.180dayactionwindowfromletterdoesnotproveapprovalorcompliancenowmerelydeadlinepassed. P2AndrewGravesapplicationcoordinatorsignaturevisible;notindependentdigitalsignaturevalidation. RecipientTiltedGateLLC/Google-domaincontactsupportscontactaffiliation,notparcel-title/operatorcontractproof. WilmingtonDelawareapplicantmailingaddressandColumbusagencyaddressareNOTOhioDCpremises. NoMW/investment/wetlandimpactquantityprovidedbyletter; secondaryprojectnumbersnotupgradedtooriginalpermitfacts.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://sciotovalleyguardian.com/2026/03/06/scioto-county-data-center-moves-closer-to-construction-as-key-environmental-permit-clears-state-review/", "host": "sciotovalleyguardian.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://sciotovalleyguardian.com/wp-content/uploads/2026/03/ViewDocument-3.pdf", "host": "sciotovalleyguardian.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 38.80401, "lng": -82.99328, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "border-state-permit-execution-and-capacity-scope-review-round71-2026-10-15.json", "scope": "Originaloperator/localreporter orvisibleoriginalregulatorycopy, stage/date/numericalscopeexplicit.", "fields": {}, "notes": [ "SciotoValleyGuardian JasonSalley March6,2026updatedJuly1 report namesTiltedGateLLC ProjectDazzlerFranklinFurnace. Headerkeypermitclearsreview mustnotbecomepermitissued: bodyandoriginalletter say ADMINISTRATIVELYCOMPLETEapplication, technicalreviewstillrequired. No finalwetlandspermit/buildingapproval/commissioning established.", "$1B/1.7Msf/792acres/twobuildings/$500kannualPILOT/75%15yrabatement/50phase1jobsare reportedproposal/agreement claims, notinspectedexecutedcontract, payments, spentcapex oractualworkers. No multiplicationintopaidtax/subsidytotal. EastofOhioRivergeographicwordingnotusedtoverifyparcels. ApplicantTiltedGate notautomaticallysignedGoogletenant/operatorproof.", "Notallfield/currentoperatingcensus/fullyexecutedcontract/actualpaymentorimpactcertification." ], "sources": [ { "url": "https://sciotovalleyguardian.com/2026/03/06/scioto-county-data-center-moves-closer-to-construction-as-key-environmental-permit-clears-state-review/", "host": "sciotovalleyguardian.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "border-state-permit-execution-and-capacity-scope-review-round71-2026-10-15.json", "scope": "Originaloperator/localreporter orvisibleoriginalregulatorycopy, stage/date/numericalscopeexplicit.", "fields": {}, "notes": [ "Both2pagesofOhioEPA-authoredProjectDazzlerletterhostedbynewspaper readVISUALLYonly. DatedMarch5,2026,applicationreceivedFeb13,OhioEPAID262431W,LevelThreeIsolatedWetlandsAPPLICATIONadministrativelycomplete. Intermediatecorrespondence, notfinalpermit.180dayactionwindowfromletterdoesnotproveapprovalorcompliancenowmerelydeadlinepassed.", "P2AndrewGravesapplicationcoordinatorsignaturevisible;notindependentdigitalsignaturevalidation. RecipientTiltedGateLLC/Google-domaincontactsupportscontactaffiliation,notparcel-title/operatorcontractproof. WilmingtonDelawareapplicantmailingaddressandColumbusagencyaddressareNOTOhioDCpremises. NoMW/investment/wetlandimpactquantityprovidedbyletter; secondaryprojectnumbersnotupgradedtooriginalpermitfacts.", "Notallfield/currentoperatingcensus/fullyexecutedcontract/actualpaymentorimpactcertification." ], "sources": [ { "url": "https://sciotovalleyguardian.com/wp-content/uploads/2026/03/ViewDocument-3.pdf", "host": "sciotovalleyguardian.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Franklin Furnace · Scioto · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39145" } }, { "id": "meta-project-klondike-piqua-oh", "state": "oh", "kind": "facility", "name": "Project Klondike", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Miami" ], "city": "Piqua", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.. Reported corporate-document linkage, not independently retrieved Nevada/SEC originals or confirmed tenant lease. USD1billion headline is proposed value, not expenditure. November emergency resolution/tax abatement reported without original adopted agreement, exact terms or payment. 2500petition signatures are platform tally, not verified local population. DBStu corporate similarities are a separate MountOrab project; Hatchbo linkage explicitly unconfirmed, 500MWpower-equipment rental not Piqua IT. Source discloses investment-affiliate relationship. April2visible publication takes precedence over June20metadata as original report date; later ownership/approval outcomes unknown. Historical observations and forecasts are dated; no later outcome assumed. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://hntrbrk.com/meta-data-centers/", "host": "hntrbrk.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.05358, "lng": -84.22898, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round35-2026-10-14.json", "scope": "Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.", "fields": { "reported_context": "Hunterbrook open-source investigation links Piqua Project Klondike developer J5/Shaytura to Meta through a Nevada branch address at1601WillowRoad and named corporate officer David Kling, while describing residents opposing the proposed approximately600-acre project.", "independently_verified_current_operating_status": null }, "notes": [ "Reported corporate-document linkage, not independently retrieved Nevada/SEC originals or confirmed tenant lease. USD1billion headline is proposed value, not expenditure. November emergency resolution/tax abatement reported without original adopted agreement, exact terms or payment. 2500petition signatures are platform tally, not verified local population. DBStu corporate similarities are a separate MountOrab project; Hatchbo linkage explicitly unconfirmed, 500MWpower-equipment rental not Piqua IT. Source discloses investment-affiliate relationship. April2visible publication takes precedence over June20metadata as original report date; later ownership/approval outcomes unknown.", "Historical observations and forecasts are dated; no later outcome assumed.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://hntrbrk.com/meta-data-centers/", "host": "hntrbrk.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Piqua · Miami · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39109" } }, { "id": "prologis-mila-trenton-oh", "state": "oh", "kind": "facility", "name": "Prologis Project Mila", "group": "proposed", "status": "Listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Butler" ], "city": "Trenton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.. Secondary stage lead only, original deed/siteplan/adoption/conditions unreviewed. Site-plan approval is not final building permit or operation; fall2026construction/early2029firstservice are forecasts, not observed.250MWdemandbasisnotcriticalIT.140jobs/120000USDannualutilityfees are developer forecasts, utilitychargesnotpropertytax or netpublicbenefit. Threepercentyearwatercooling not gallons/actualwithdrawal. Tracker applies AEPOhiotariff without inspected site-specific utility territory/account; do not assume applicability.85percentminimum-bill terms not proof100percentinfrastructurefunded. Risk84/100is tracker score, not scientificrisk. City-versus-countyauthorityneedslawrecord; signaturecollectionnotadoptedballotban. Historical observations and forecasts are dated; no later outcome assumed. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-03-19", "The original Trenton staff report records Council approval of the Prologis commercial and industrial fence permit on March 19, 2026. This dates the limited fence action, without final whole campus permission, vertical construction or commissioned service." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://stopohiodatacenters.org/butler-county", "host": "stopohiodatacenters.org", "date": "2026-04-26", "published": "2026-04-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.ci.trenton.oh.us/AgendaCenter/ViewFile/Agenda/_03302026-550", "host": "www.ci.trenton.oh.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://trentonoh.gov/DocumentCenter/View/2403/Prologis-and-Staff-Public-Forum-Agenda-?bidId=", "host": "trentonoh.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://ci.trenton.oh.us/AgendaCenter/ViewFile/Minutes/_04022026-551", "host": "ci.trenton.oh.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 39.41756, "lng": -84.57365, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round35-2026-10-14.json", "scope": "Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.", "fields": { "reported_context": "Commercial Ohio tracker reports TrentonPlanningCommission approved ProjectMila site plan March30,2026 on already-industrial141acres sold toPrologis forUSD7.75million inOctober2025. Four220353squarefootbuildings plus16150utility/1503security sum899065squarefeet.", "independently_verified_current_operating_status": null }, "notes": [ "Secondary stage lead only, original deed/siteplan/adoption/conditions unreviewed. Site-plan approval is not final building permit or operation; fall2026construction/early2029firstservice are forecasts, not observed.250MWdemandbasisnotcriticalIT.140jobs/120000USDannualutilityfees are developer forecasts, utilitychargesnotpropertytax or netpublicbenefit. Threepercentyearwatercooling not gallons/actualwithdrawal. Tracker applies AEPOhiotariff without inspected site-specific utility territory/account; do not assume applicability.85percentminimum-bill terms not proof100percentinfrastructurefunded. Risk84/100is tracker score, not scientificrisk. City-versus-countyauthorityneedslawrecord; signaturecollectionnotadoptedballotban.", "Historical observations and forecasts are dated; no later outcome assumed.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://stopohiodatacenters.org/butler-county", "host": "stopohiodatacenters.org", "date": "2026-04-26", "published": "2026-04-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 62", "scope": "The original City staff report and hosted Prologis presentation explicitly identify the proposed Mila campus. This supports a listed proposal without certifying present vertical construction or computing operation. The presentation reports electrical yard grading and expressly says this does not indicate vertical construction. Its undated schedule graphic and preliminary financial and water tables are forecasts. The March 30 packet records a March 16 fence recommendation and March 19 Council fence permit approval, while detailed engineering review and whole site permission remain separate. Design models and public assurances are not measured noise, water use or accomplished benefits.", "fields": { "current_stage_evidence": { "outcome": "official_named_mila_proposal_and_limited_infrastructure_context", "scope": "The original City staff report and hosted Prologis presentation explicitly identify the proposed Mila campus. This supports a listed proposal without certifying present vertical construction or computing operation. The presentation reports electrical yard grading and expressly says this does not indicate vertical construction. Its undated schedule graphic and preliminary financial and water tables are forecasts. The March 30 packet records a March 16 fence recommendation and March 19 Council fence permit approval, while detailed engineering review and whole site permission remain separate. Design models and public assurances are not measured noise, water use or accomplished benefits." }, "source_read_scope": { "original_march30_packet_selected_physical_pages1through9_read": true, "complete29page_forum_text_read": true, "physical_page10_forecast_timeline_viewed": true, "stepdown_yard_grading_explicitly_not_vertical_construction": true, "original_april2_selected_pages5_6_7_9_read": true, "physical_april2_page5_group_account_viewed": true, "private_resident_details_excluded": true, "no_financial_technical_role_or_location_export": true } }, "notes": [ "The original City staff report and hosted Prologis presentation explicitly identify the proposed Mila campus. This supports a listed proposal without certifying present vertical construction or computing operation. The presentation reports electrical yard grading and expressly says this does not indicate vertical construction. Its undated schedule graphic and preliminary financial and water tables are forecasts. The March 30 packet records a March 16 fence recommendation and March 19 Council fence permit approval, while detailed engineering review and whole site permission remain separate. Design models and public assurances are not measured noise, water use or accomplished benefits.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://www.ci.trenton.oh.us/AgendaCenter/ViewFile/Agenda/_03302026-550", "host": "www.ci.trenton.oh.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://trentonoh.gov/DocumentCenter/View/2403/Prologis-and-Staff-Public-Forum-Agenda-?bidId=", "host": "trentonoh.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://ci.trenton.oh.us/AgendaCenter/ViewFile/Minutes/_04022026-551", "host": "ci.trenton.oh.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Trenton · Butler · Source context reviewed", "status_scope": "The original City staff report and hosted Prologis presentation explicitly identify the proposed Mila campus. This supports a listed proposal without certifying present vertical construction or computing operation. The presentation reports electrical yard grading and expressly says this does not indicate vertical construction. Its undated schedule graphic and preliminary financial and water tables are forecasts. The March 30 packet records a March 16 fence recommendation and March 19 Council fence permit approval, while detailed engineering review and whole site permission remain separate. Design models and public assurances are not measured noise, water use or accomplished benefits.", "event_evidence": [ { "date": "2026-03-19", "text": "The original Trenton staff report records Council approval of the Prologis commercial and industrial fence permit on March 19, 2026. This dates the limited fence action, without final whole campus permission, vertical construction or commissioned service.", "kind": "approved", "sources": [ { "url": "https://www.ci.trenton.oh.us/AgendaCenter/ViewFile/Agenda/_03302026-550", "host": "www.ci.trenton.oh.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39017" } }, { "id": "prsm-preble-county-oh", "state": "oh", "kind": "facility", "name": "PRSM Preble County Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Preble" ], "city": "Monroe Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.. No final county commissioners decision established. Two advisory or intermediate denials do not prove permanent project cancellation. Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://dayton247now.com/news/local/commissions-in-preble-county-reject-farmland-rezoning-for-data-center-development-plan", "host": "dayton247now.com", "date": "2025-09-03", "published": "2025-09-03", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.prebco.org/AgendaCenter/ViewFile/Minutes/_05152025-920", "host": "www.prebco.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.prebco.org/AgendaCenter", "host": "www.prebco.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 39.7415, "lng": -84.64801, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcomes-review-round20-2026-10-14.json", "scope": "Manual review of named-project reporting excerpts. Historical account and claims are attributed to publisher; no whole-record or current legal-status certification.", "fields": { "reported_action_type": "two-commission-rejections-before-board-hearing", "reported_finding": "Dayton 24/7 reports Preble planning and rural zoning commission rejections; county commissioners hearing was still scheduled for October 1.", "report_display_date": "2025-09-03", "independently_verified_current_status": null }, "notes": [ "No final county commissioners decision established. Two advisory or intermediate denials do not prove permanent project cancellation.", "Original signed law, permit, docket and any subsequent decisions take precedence. No future outcomes inferred.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://dayton247now.com/news/local/commissions-in-preble-county-reject-farmland-rezoning-for-data-center-development-plan", "host": "dayton247now.com", "date": "2025-09-03", "published": "2025-09-03", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 62", "scope": "Selected original May 15, 2025 Planning Commission minute pages nine through eleven name PRSM and expressly describe a preliminary discussion without an application or vote. That account concerns a Jefferson Township property and does not independently complete the inherited Monroe Township and larger project crosswalk. The current original agenda index supplies no read final withdrawal or commissioners disposition. Earlier intermediate rejections, private withdrawal reports and a scheduled October meeting are not substituted for an independently read exact final action or present physical computing stage.", "fields": { "current_stage_evidence": { "outcome": "official_prsm_preapplication_separate_property_crosswalk_and_current_stage_held", "scope": "Selected original May 15, 2025 Planning Commission minute pages nine through eleven name PRSM and expressly describe a preliminary discussion without an application or vote. That account concerns a Jefferson Township property and does not independently complete the inherited Monroe Township and larger project crosswalk. The current original agenda index supplies no read final withdrawal or commissioners disposition. Earlier intermediate rejections, private withdrawal reports and a scheduled October meeting are not substituted for an independently read exact final action or present physical computing stage." }, "source_read_scope": { "original_may15_selected_physical_pages9through11_read": true, "explicit_no_application_or_vote_at_preapplication": true, "jefferson_property_not_assumed_inherited_monroe_project": true, "current_selected_county_agenda_index_read": true, "final_withdrawal_document_not_read": true, "no_role_location_or_quantity_export": true } }, "notes": [ "Selected original May 15, 2025 Planning Commission minute pages nine through eleven name PRSM and expressly describe a preliminary discussion without an application or vote. That account concerns a Jefferson Township property and does not independently complete the inherited Monroe Township and larger project crosswalk. The current original agenda index supplies no read final withdrawal or commissioners disposition. Earlier intermediate rejections, private withdrawal reports and a scheduled October meeting are not substituted for an independently read exact final action or present physical computing stage.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://www.prebco.org/AgendaCenter/ViewFile/Minutes/_05152025-920", "host": "www.prebco.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.prebco.org/AgendaCenter", "host": "www.prebco.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Monroe Township · Preble · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39135" } }, { "id": "qts-new-albany-1-franklin-county-oh", "state": "oh", "kind": "facility", "name": "QTS New Albany 1", "group": "proposed", "status": "Operator-listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Upstream ID/county label says Franklin, but cited parcel is in the Licking County cadastral service and Jersey Township. Resolve county to the matched physical site before publication; do not retain the imported Franklin label as verified. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. named operator source. No exact MW, opening event or site capital value adopted. Three-million-dollar electricity-assistance commitment is across Ohio over three years, not this individual campus. County conflict remains in the separate cadastral review.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'094-106404-00.011'&outFields=*&f=json&returnGeometry=true&outSR=4326", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://q.com/data-centers/new-albany-1/", "host": "q.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://q.com/data-centers/", "host": "q.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "loc": { "lat": 40.14909, "lng": -82.46501, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PID": 98685, "Parcel": "094-106404-00.011", "OwnerName": "QTS NEW ALBANY I DC1 LLC", "SiteAddress": "1235 BEECH RD SW", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 18.1 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Upstream ID/county label says Franklin, but cited parcel is in the Licking County cadastral service and Jersey Township. Resolve county to the matched physical site before publication; do not retain the imported Franklin label as verified.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'094-106404-00.011'&outFields=*&f=json&returnGeometry=true&outSR=4326", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "direct-operators-round5-2026-10-14.json", "scope": "named operator source", "fields": { "operator_named_listing": "New Albany1" }, "notes": [ "No exact MW, opening event or site capital value adopted. Three-million-dollar electricity-assistance commitment is across Ohio over three years, not this individual campus. County conflict remains in the separate cadastral review.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://q.com/data-centers/new-albany-1/", "host": "q.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "QTS explicitly lists New Albany 1 as in development in its current location directory. This does not establish a physical construction phase or commissioning; the inherited county and address associations are not reverified by this review. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_development", "scope": "QTS explicitly lists New Albany 1 as in development in its current location directory. This does not establish a physical construction phase or commissioning; the inherited county and address associations are not reverified by this review. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "QTS explicitly lists New Albany 1 as in development in its current location directory. This does not establish a physical construction phase or commissioning; the inherited county and address associations are not reverified by this review." ], "sources": [ { "url": "https://q.com/data-centers/", "host": "q.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "status_scope": "QTS explicitly lists New Albany 1 as in development in its current location directory. This does not establish a physical construction phase or commissioning; the inherited county and address associations are not reverified by this review. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "qts-new-albany-2-franklin-county-oh", "state": "oh", "kind": "facility", "name": "QTS New Albany 2", "group": "proposed", "status": "Operator-listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Upstream ID/county label says Franklin, but cited parcel is in the Licking County cadastral service and Jersey Township. Resolve county to the matched physical site before publication; do not retain the imported Franklin label as verified. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. named operator source. No exact MW, opening event or site capital value adopted. Shared statewide assistance commitment cannot be counted again for this campus. County conflict remains unresolved.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'094-107502-00.003'&outFields=*&f=json&returnGeometry=true&outSR=4326", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://q.com/data-centers/new-albany-2/", "host": "q.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://q.com/data-centers/", "host": "q.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "loc": { "lat": 40.05996, "lng": -82.53757, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PID": 96153, "Parcel": "094-107502-00.003", "OwnerName": "QTS NEW ALBANY II DC1 LLC", "SiteAddress": "BEECH RD SW", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 18.85 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Upstream ID/county label says Franklin, but cited parcel is in the Licking County cadastral service and Jersey Township. Resolve county to the matched physical site before publication; do not retain the imported Franklin label as verified.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=Parcel%3D'094-107502-00.003'&outFields=*&f=json&returnGeometry=true&outSR=4326", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "direct-operators-round5-2026-10-14.json", "scope": "named operator source", "fields": { "operator_named_listing": "New Albany2" }, "notes": [ "No exact MW, opening event or site capital value adopted. Shared statewide assistance commitment cannot be counted again for this campus. County conflict remains unresolved.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://q.com/data-centers/new-albany-2/", "host": "q.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "QTS explicitly lists New Albany 2 as in development in its current location directory. This does not establish a physical construction phase or commissioning; the inherited county and address associations are not reverified by this review. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_development", "scope": "QTS explicitly lists New Albany 2 as in development in its current location directory. This does not establish a physical construction phase or commissioning; the inherited county and address associations are not reverified by this review. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "QTS explicitly lists New Albany 2 as in development in its current location directory. This does not establish a physical construction phase or commissioning; the inherited county and address associations are not reverified by this review." ], "sources": [ { "url": "https://q.com/data-centers/", "host": "q.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "status_scope": "QTS explicitly lists New Albany 2 as in development in its current location directory. This does not establish a physical construction phase or commissioning; the inherited county and address associations are not reverified by this review. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "qts-new-albany-3-franklin-county-oh", "state": "oh", "kind": "facility", "name": "QTS New Albany III", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=UPPER(OWNERNME1)+LIKE+'%25QTS%25'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.franklincountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 39.96349, "lng": -83.04383, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PARCELID": "222-005361", "ACRES": 78.24176124, "SITEADDRESS": "5760 - 5780 BABBITT RD", "OWNERNME1": "QTS NEW ALBANY III LLC", "BLDGAREA": null } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.franklincountyohio.gov/hosting/rest/services/ParcelFeatures/Parcel_Features/FeatureServer/0/query?where=UPPER(OWNERNME1)+LIKE+'%25QTS%25'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.franklincountyohio.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Franklin · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39049" } }, { "id": "qts-new-albany-4-licking-county-oh", "state": "oh", "kind": "facility", "name": "QTS New Albany IV", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "New Albany", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=UPPER(OwnerName)+LIKE+'%25QTS+NEW+ALBANY+IV%25'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.07747, "lng": -82.41903, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PID": 97052, "Parcel": "095-111570-01.000", "OwnerName": "QTS NEW ALBANY IV LLC", "SiteAddress": "13335 MILLER RD ", "SitePostalCity": "NEW ALBANY", "Jurisdiction": "New Albany City", "Municipality": "New Albany", "Township": "Jersey", "TaxAcres": 161.26 } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=UPPER(OwnerName)+LIKE+'%25QTS+NEW+ALBANY+IV%25'&outFields=*&returnCentroid=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Licking · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "qts-van-wert-oh", "state": "oh", "kind": "facility", "name": "QTS Van Wert Data Center Campus", "group": "proposed", "status": "Operator-listed planning", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Van Wert" ], "city": "Van Wert", "address": "", "who": "QTS", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Developer-issued release. Revenue/jobs are forecasts. Cooling no-consumption claim describes future cooling operations, not all facility water use or measured WUE. Its June 11 event is historical by check date. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://q.com/news/city-of-van-wert-and-qts-announce-data-center-campus-in-northwest-ohio/", "host": "q.com", "date": "2026-05-29", "published": "2026-05-29", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://q.com/data-centers/van-wert/", "host": "q.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "loc": { "lat": 40.85543, "lng": -84.58613, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "planned_capital_investment_usd_approx": 10000000000, "forecast_tax_revenue_usd": 200000000, "forecast_tax_revenue_period_years": 20, "forecast_construction_jobs_lower_bound": 1500, "forecast_full_time_qts_jobs_approx": 200, "initial_career_training_commitment_usd": 100000, "planned_cooling_design": "closed loop" }, "notes": [ "Developer-issued release. Revenue/jobs are forecasts. Cooling no-consumption claim describes future cooling operations, not all facility water use or measured WUE. Its June 11 event is historical by check date.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://q.com/news/city-of-van-wert-and-qts-announce-data-center-campus-in-northwest-ohio/", "host": "q.com", "date": "2026-05-29", "published": "2026-05-29", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "QTS explicitly describes its Van Wert campus as early planning with a concept that is not final. Copied Richmond County wording is excluded; no projected investment, tax receipt or construction outcome is adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_planning", "scope": "QTS explicitly describes its Van Wert campus as early planning with a concept that is not final. Copied Richmond County wording is excluded; no projected investment, tax receipt or construction outcome is adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "QTS explicitly describes its Van Wert campus as early planning with a concept that is not final. Copied Richmond County wording is excluded; no projected investment, tax receipt or construction outcome is adopted." ], "sources": [ { "url": "https://q.com/data-centers/van-wert/", "host": "q.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Company role source check 09, October 23, 2026", "scope": "QTS announces plans for this named data center campus in its own dated release. Developer is the attributed provider brand role for the announced project, not proof of construction, operating service, current delivery, legal ownership or a confirmed parcel. The source publication date is not a physical milestone. No status, location, technical figure, investment, jobs, water use, utility cost or environmental outcome is promoted.", "fields": { "company_association": { "name": "QTS", "role": "developer", "identity_scope": "provider_brand_only", "scope": "QTS announces plans for this named data center campus in its own dated release. Developer is the attributed provider brand role for the announced project, not proof of construction, operating service, current delivery, legal ownership or a confirmed parcel. The source publication date is not a physical milestone. No status, location, technical figure, investment, jobs, water use, utility cost or environmental outcome is promoted." }, "provider_role": "developer" }, "notes": [ "QTS announces plans for this named data center campus in its own dated release. Developer is the attributed provider brand role for the announced project, not proof of construction, operating service, current delivery, legal ownership or a confirmed parcel. The source publication date is not a physical milestone. No status, location, technical figure, investment, jobs, water use, utility cost or environmental outcome is promoted.", "Source dates remain separate from physical milestones and the retained status field." ], "sources": [ { "url": "https://q.com/news/city-of-van-wert-and-qts-announce-data-center-campus-in-northwest-ohio/", "host": "q.com", "published": "2026-05-29", "date": "2026-05-29", "checked": "2026-10-23", "label": "Dated first party named campus announcement, planned developer role only" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Van Wert · Van Wert · Source context reviewed", "status_scope": "QTS explicitly describes its Van Wert campus as early planning with a concept that is not final. Copied Richmond County wording is excluded; no projected investment, tax receipt or construction outcome is adopted. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39161" } }, { "id": "saadia-holding-athens-dover-township-oh", "state": "oh", "kind": "facility", "name": "Saadia Holding Athens-Dover Township Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Athens" ], "city": "The Plains", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.. 250,000 square feet and 100 jobs are an anonymous meeting source’s attributed expectation, not approvals or verified employment. Water superintendent relays 100,000 gallons INITIAL FILL plus 10,000 to 20,000 gallons PER MONTH makeup; do not publish either as daily use or sum monthly makeup into initial storage. No power quantity disclosed. A local study group is not a moratorium. The separate Pennsylvania $6.35 million rejected land offer is not Ohio investment. Indirect-water discussion is industry context, not a measured site footprint. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://athensindependent.com/possible-athens-data-center/", "host": "athensindependent.com", "date": "2026-07-23", "published": "2026-07-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://athenstwp.com/", "host": "athenstwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://athenstwp.com/meetings/", "host": "athenstwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://athenstwp.com/projects/", "host": "athenstwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.ci.athens.oh.us/90/City-Council", "host": "www.ci.athens.oh.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 39.334, "lng": -82.04483, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round32-2026-10-14.json", "scope": "Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.", "fields": { "reported_context": "Athens County Independent reports Saadia’s July inquiry about nearly 300 acres across six Athens/Dover township parcels, with local planners explicitly saying no formal application had been submitted.", "independently_verified_current_operating_status": null }, "notes": [ "250,000 square feet and 100 jobs are an anonymous meeting source’s attributed expectation, not approvals or verified employment. Water superintendent relays 100,000 gallons INITIAL FILL plus 10,000 to 20,000 gallons PER MONTH makeup; do not publish either as daily use or sum monthly makeup into initial storage. No power quantity disclosed. A local study group is not a moratorium. The separate Pennsylvania $6.35 million rejected land offer is not Ohio investment. Indirect-water discussion is industry context, not a measured site footprint.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://athensindependent.com/possible-athens-data-center/", "host": "athensindependent.com", "date": "2026-07-23", "published": "2026-07-23", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 62", "scope": "The complete original Athens Township home, meeting and project bodies and separate City Council account were read. They describe government, recurring meeting procedures and road projects without independently naming the exact Saadia computing proposal or current physical stage. City, Township and Dover jurisdictions are distinct. Private moratorium accounts and other states with a Dover or Athens name are not original executed rules for this property. No site eligibility, current computing closure or general rule absence is inferred.", "fields": { "current_stage_evidence": { "outcome": "official_government_context_exact_saadia_subject_and_physical_stage_held", "scope": "The complete original Athens Township home, meeting and project bodies and separate City Council account were read. They describe government, recurring meeting procedures and road projects without independently naming the exact Saadia computing proposal or current physical stage. City, Township and Dover jurisdictions are distinct. Private moratorium accounts and other states with a Dover or Athens name are not original executed rules for this property. No site eligibility, current computing closure or general rule absence is inferred." }, "source_read_scope": { "complete_original_township_home_meetings_projects_and_citycouncil_bodies_read": true, "recurring_meeting_pattern_not_computing_notice": true, "city_and_township_and_dover_scope_separate": true, "dover_york_pa_and_tuscarawas_oh_not_athens_oh": true, "no_exact_saadia_application_or_stage_in_selected_bodies": true, "no_roles_locations_or_quantities_changed": true } }, "notes": [ "The complete original Athens Township home, meeting and project bodies and separate City Council account were read. They describe government, recurring meeting procedures and road projects without independently naming the exact Saadia computing proposal or current physical stage. City, Township and Dover jurisdictions are distinct. Private moratorium accounts and other states with a Dover or Athens name are not original executed rules for this property. No site eligibility, current computing closure or general rule absence is inferred.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://athenstwp.com/", "host": "athenstwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://athenstwp.com/meetings/", "host": "athenstwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://athenstwp.com/projects/", "host": "athenstwp.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.ci.athens.oh.us/90/City-Council", "host": "www.ci.athens.oh.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "The Plains · Athens · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39009" } }, { "id": "harner-sr-14-ravenna-portage-oh", "state": "oh", "kind": "facility", "name": "SR-14 Data Center Proposal (Ravenna)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Portage" ], "city": "Ravenna", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.. Secondary local-stage lead only; original signed ordinance, jurisdiction, scope, exceptions and expiry unreviewed. No countywide prohibition or project withdrawal inferred. Opening text says nine named counties but enumerates eight before FAQ adds Pike; no authoritative Ohio facility count adopted. April ballot-signature campaign is not evidence of qualification, passage or enacted ban. Risk scores, regional water/tariff claims and other-campus quantities do not establish this site. Historical observations and forecasts are dated; no later outcome assumed. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://stopohiodatacenters.org/data-center-near-my-home-ohio", "host": "stopohiodatacenters.org", "date": "2026-04-27", "published": "2026-04-27", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.ravennaoh.gov/wp-content/uploads/2026/05/4-20-26-Special.pdf", "host": "www.ravennaoh.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.17991, "lng": -81.21074, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round35-2026-10-14.json", "scope": "Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.", "fields": { "reported_context": "Commercial advocacy tracker names Ray Harner SR14 across from UH Portage Medical Center and reports Ravenna adopted a 12-month pause April20,2026.", "independently_verified_current_operating_status": null }, "notes": [ "Secondary local-stage lead only; original signed ordinance, jurisdiction, scope, exceptions and expiry unreviewed. No countywide prohibition or project withdrawal inferred. Opening text says nine named counties but enumerates eight before FAQ adds Pike; no authoritative Ohio facility count adopted. April ballot-signature campaign is not evidence of qualification, passage or enacted ban. Risk scores, regional water/tariff claims and other-campus quantities do not establish this site.", "Historical observations and forecasts are dated; no later outcome assumed.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://stopohiodatacenters.org/data-center-near-my-home-ohio", "host": "stopohiodatacenters.org", "date": "2026-04-27", "published": "2026-04-27", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 62", "scope": "The original April 20, 2026 Council minutes record adoption of Ordinance 2026 067 for a one year pause and institutional discussion of local computing uses. Physical page two was read and visually checked. The selected body does not independently name the exact Harner State Route 14 proposal or certify its current physical stage. Its account of an already existing local mining facility is not assigned to this proposed record. A general moratorium and reported legal limits are not a project specific denial, accomplished closure or computing operation.", "fields": { "current_stage_evidence": { "outcome": "official_ravenna_pause_exact_harner_physical_stage_held", "scope": "The original April 20, 2026 Council minutes record adoption of Ordinance 2026 067 for a one year pause and institutional discussion of local computing uses. Physical page two was read and visually checked. The selected body does not independently name the exact Harner State Route 14 proposal or certify its current physical stage. Its account of an already existing local mining facility is not assigned to this proposed record. A general moratorium and reported legal limits are not a project specific denial, accomplished closure or computing operation." }, "source_read_scope": { "original_april20_physical_page2_read_and_viewed": true, "named_exact_harner_project_not_in_selected_body": true, "unnamed_existing_mining_not_transferred_to_proposal": true, "general_pause_not_site_specific_cancellation": true, "no_location_role_or_quantity_export": true } }, "notes": [ "The original April 20, 2026 Council minutes record adoption of Ordinance 2026 067 for a one year pause and institutional discussion of local computing uses. Physical page two was read and visually checked. The selected body does not independently name the exact Harner State Route 14 proposal or certify its current physical stage. Its account of an already existing local mining facility is not assigned to this proposed record. A general moratorium and reported legal limits are not a project specific denial, accomplished closure or computing operation.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://www.ravennaoh.gov/wp-content/uploads/2026/05/4-20-26-Special.pdf", "host": "www.ravennaoh.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Ravenna · Portage · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39133" } }, { "id": "stack-nal01-new-albany-oh", "state": "oh", "kind": "facility", "name": "STACK Infrastructure NAL01 (New Albany)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "New Albany", "address": "", "who": "STACK Infrastructure", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Regional page names NAL01. Do not claim contracted/energized capacity from scalability language. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.stackinfra.com/locations/americas/new-albany/", "host": "stackinfra.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.stackinfra.com/locations/americas/new-albany/nal01/", "host": "www.stackinfra.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 39.94866, "lng": -82.97672, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "advertised_campus_power_mw": 60, "power_basis": "scalable campus offering, not measured load", "campus_acres": 40, "campuses": 1 }, "notes": [ "Regional page names NAL01. Do not claim contracted/energized capacity from scalability language.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.stackinfra.com/locations/americas/new-albany/", "host": "stackinfra.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Company role source check 17, October 23, 2026", "scope": "STACK Infrastructure explicitly lists this exact named campus or code in its own source. The operator role is an attributed provider brand relationship, not independently verified legal ownership, whole building control or operation of every phase. Current service and future development stay separate. No status, coordinate, address, physical date, power figure, water figure, safety, certification or environmental outcome is promoted. The New Albany market page explicitly lists NAL01. The provider brand offers scalable campus infrastructure; market safety, tax and land availability claims do not establish commissioning, permits or eligibility.", "fields": { "company_association": { "name": "STACK Infrastructure", "role": "operator", "identity_scope": "provider_brand_only", "scope": "STACK Infrastructure explicitly lists this exact named campus or code in its own source. The operator role is an attributed provider brand relationship, not independently verified legal ownership, whole building control or operation of every phase. Current service and future development stay separate. No status, coordinate, address, physical date, power figure, water figure, safety, certification or environmental outcome is promoted. The New Albany market page explicitly lists NAL01. The provider brand offers scalable campus infrastructure; market safety, tax and land availability claims do not establish commissioning, permits or eligibility." }, "provider_role": "operator" }, "notes": [ "STACK Infrastructure explicitly lists this exact named campus or code in its own source. The operator role is an attributed provider brand relationship, not independently verified legal ownership, whole building control or operation of every phase. Current service and future development stay separate. No status, coordinate, address, physical date, power figure, water figure, safety, certification or environmental outcome is promoted. The New Albany market page explicitly lists NAL01. The provider brand offers scalable campus infrastructure; market safety, tax and land availability claims do not establish commissioning, permits or eligibility.", "Global Stack and Fluidstack are not assigned to STACK Infrastructure by substring matching. Retrieval and publication dates remain separate from physical milestones." ], "sources": [ { "url": "https://www.stackinfra.com/locations/americas/new-albany/", "host": "www.stackinfra.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact code or campus text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "STACK current named NAL01 page presents separate A and B buildings, secured utility power and marketed critical capacity. It does not explicitly establish completed current customer compute service or the exact phase of every component in the inherited combined campus record. Available power, a tour invitation, a virtual experience and campus capacity are not commissioning. No individual building phases, inconsistent advertised totals, exact locations or roles are merged or promoted.", "fields": { "current_stage_evidence": { "outcome": "named_nal01_building_marketing_and_power_without_exact_combined_service_phase", "scope": "STACK current named NAL01 page presents separate A and B buildings, secured utility power and marketed critical capacity. It does not explicitly establish completed current customer compute service or the exact phase of every component in the inherited combined campus record. Available power, a tour invitation, a virtual experience and campus capacity are not commissioning. No individual building phases, inconsistent advertised totals, exact locations or roles are merged or promoted." } }, "notes": [ "STACK current named NAL01 page presents separate A and B buildings, secured utility power and marketed critical capacity. It does not explicitly establish completed current customer compute service or the exact phase of every component in the inherited combined campus record. Available power, a tour invitation, a virtual experience and campus capacity are not commissioning. No individual building phases, inconsistent advertised totals, exact locations or roles are merged or promoted.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://www.stackinfra.com/locations/americas/new-albany/", "host": "www.stackinfra.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.stackinfra.com/locations/americas/new-albany/nal01/", "host": "www.stackinfra.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "New Albany · Franklin · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39049" } }, { "id": "standard-power-coshocton-oh", "state": "oh", "kind": "facility", "name": "Standard Power Coshocton", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Coshocton" ], "city": "Coshocton", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.. Host publication metadata is November 28, 2023, not a new opening. Monday ribbon-cutting day is relative and not assigned an inferred exact date. Historical 50 MW is not certified critical IT/current load. Proposed nearby Conesville 700 MW is a distinct project, not additive capacity at Coshocton. Plans for over 100 employees or more power by 2023 are unobserved forecasts in this retained account. October 2018 property purchase and 2015 paper-mill closure are separate history events. Later original decisions and observed outcomes take precedence; future events have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2021-07-12", "Energy Harbor announced a supply partnership for the Standard Power Coshocton mining project on July 12, 2021. The release forecasts a December 2021 supply start; neither the forecast nor this announcement dates an accomplished computing opening." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://frontier-companies.com/coshoctons-standard-power-center-powers-blockchain-mining-for-ohio/", "host": "frontier-companies.com", "date": "2022-09-21", "published": "2022-09-21", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.prnewswire.com/news-releases/energy-harbor-partners-with-standard-power-to-provide-carbon-free-nuclear-power-to-new-ohio-bitcoin-blockchain-mining-center-301331473.html", "host": "www.prnewswire.com", "published": "2021-07-12", "date": "2021-07-12", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.coshoctoncounty.net/rpc/wp-content/uploads/sites/22/2025/01/Minutes-from-full-board-attachments-11-18-24-Approved.pdf", "host": "www.coshoctoncounty.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.31203, "lng": -81.93139, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round33-2026-10-14.json", "scope": "Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.", "fields": { "reported_context": "Frontier Companies republishes a September 21, 2022 Coshocton Tribune account of Standard Power’s ribbon cutting at 500 North Fourth Street, with reported 50 MW mining operation and about twenty employees at that time.", "independently_verified_current_operating_status": null }, "notes": [ "Host publication metadata is November 28, 2023, not a new opening. Monday ribbon-cutting day is relative and not assigned an inferred exact date. Historical 50 MW is not certified critical IT/current load. Proposed nearby Conesville 700 MW is a distinct project, not additive capacity at Coshocton. Plans for over 100 employees or more power by 2023 are unobserved forecasts in this retained account. October 2018 property purchase and 2015 paper-mill closure are separate history events.", "Later original decisions and observed outcomes take precedence; future events have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://frontier-companies.com/coshoctons-standard-power-center-powers-blockchain-mining-for-ohio/", "host": "frontier-companies.com", "date": "2022-09-21", "published": "2022-09-21", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 62", "scope": "The complete original July 12, 2021 Energy Harbor issuer release announces a supply contract with a projected December 2021 start. It does not establish that computing actually opened on that forecast. Selected physical page one of the original November 18, 2024 County minutes describes a wastewater lagoon closure plan and anticipated later dewatering, not closure of a computing facility. Current Standard Power and CS Global original robots requests remain held. Older service accounts, contract terms and nearby Conesville development are not present exact computing confirmation, measured load or an assumed closure.", "fields": { "current_stage_evidence": { "outcome": "original_supply_announcement_and_lagoon_workflow_present_computing_stage_held", "scope": "The complete original July 12, 2021 Energy Harbor issuer release announces a supply contract with a projected December 2021 start. It does not establish that computing actually opened on that forecast. Selected physical page one of the original November 18, 2024 County minutes describes a wastewater lagoon closure plan and anticipated later dewatering, not closure of a computing facility. Current Standard Power and CS Global original robots requests remain held. Older service accounts, contract terms and nearby Conesville development are not present exact computing confirmation, measured load or an assumed closure." }, "source_read_scope": { "complete_original_energyharbor_issuer_body_read": true, "december2021_supply_target_not_actual_opening": true, "original_county_minutes_selected_physical_page1_read": true, "lagoon_reclamation_forecast_not_data_center_closure": true, "current_provider_robots_holds_retained": true, "no_role_location_capacity_or_supply_quantity_export": true } }, "notes": [ "The complete original July 12, 2021 Energy Harbor issuer release announces a supply contract with a projected December 2021 start. It does not establish that computing actually opened on that forecast. Selected physical page one of the original November 18, 2024 County minutes describes a wastewater lagoon closure plan and anticipated later dewatering, not closure of a computing facility. Current Standard Power and CS Global original robots requests remain held. Older service accounts, contract terms and nearby Conesville development are not present exact computing confirmation, measured load or an assumed closure.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://www.prnewswire.com/news-releases/energy-harbor-partners-with-standard-power-to-provide-carbon-free-nuclear-power-to-new-ohio-bitcoin-blockchain-mining-center-301331473.html", "host": "www.prnewswire.com", "published": "2021-07-12", "date": "2021-07-12", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.coshoctoncounty.net/rpc/wp-content/uploads/sites/22/2025/01/Minutes-from-full-board-attachments-11-18-24-Approved.pdf", "host": "www.coshoctoncounty.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Coshocton · Coshocton · Source context reviewed", "event_evidence": [ { "date": "2021-07-12", "text": "Energy Harbor announced a supply partnership for the Standard Power Coshocton mining project on July 12, 2021. The release forecasts a December 2021 supply start; neither the forecast nor this announcement dates an accomplished computing opening.", "kind": "announced", "sources": [ { "url": "https://www.prnewswire.com/news-releases/energy-harbor-partners-with-standard-power-to-provide-carbon-free-nuclear-power-to-new-ohio-bitcoin-blockchain-mining-center-301331473.html", "host": "www.prnewswire.com", "published": "2021-07-12", "date": "2021-07-12", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39031" } }, { "id": "stargate-lordstown-oh", "state": "oh", "kind": "facility", "name": "Stargate Lordstown Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Trumbull" ], "city": "Lordstown", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Originaloperator/localreporter orvisibleoriginalregulatorycopy, stage/date/numericalscopeexplicit.. WFMJ AllyRoss September25,2025 originalreport quotesSoftBankspokesperson thatLordstownStargateDCusesasmallpartofexistingFoxconnformerGMmanufacturingfootprint.1.5GW announcedfigure is COMBINEDwithMilamCountyTexas, notLordstownalone. InitialsiteMWnotdisclosed. Originalissuerannouncementbelow confirmsgroup scope. Inheritedplanned1500MWcalledlongtermLordstownceiling isnotestablishedbythesetwosources; recommendnullsitecapacityuntilsite-specificevidence. Closed-loop/design-not-use-waterclaims notmeasuredzeroannualwater. Proof-of-conceptshowroom/AIservermanufacturing anddatacenterare distinctuses, notwholeindustrialcomplexoperatingIT. CurrentRFSnotobserved. Notallfield/currentoperatingcensus/fullyexecutedcontract/actualpaymentorimpactcertification. OpenAI originalSeptember23,2025announcement confirmsLordstownandMilamCountyTWOsitescan scaleTOGETHERto1.5GWover18months, not1.5GWeach/Lordstownceiling. Lordstowngroundbreakingand2026operatingtargethistoricalnotobservedRFS. Pairedcapacityisnotsite-specificIT. Nearly7GWplanned/$400Boverthreeyears/500B10GWcommitmentcoverbroaderStargateportfolio, notspentLordstowncapex oroperatingUScensus.4.5GWOracleagreement/5.5GWincludingpotential600MWexpansionareoverlappingscopes, notadditiveeveryfigure. October22,2025updateidentifiesMidwestsiteWisconsin, separateLordstown. AuthorclaimsAbileneearlyworkloadsnotLordstownoperation.", "date": "", "events": [ [ "2025-09-23", "The original SoftBank joint issuer publication carries a Texas September 23, 2025 dateline announcing the Lordstown Stargate selection, with host publication on September 24. This dates the announcement account and does not establish the exact groundbreaking day or achievement of the projected 2026 opening." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wfmj.com/archives/data-center-to-occupy-small-part-of-lordstown-ai-hub-feature-advanced-design/article_533f268a-ec1d-5378-9ccb-ceec7d6d343e.html", "host": "wfmj.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://openai.com/index/five-new-stargate-sites/?trk=article-ssr-frontend-pulse_little-text-block", "host": "openai.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://group.softbank/en/news/press/20250924", "host": "group.softbank", "published": "2025-09-24", "date": "2025-09-24", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.lordstown.com/wp-content/uploads/April-6-2026-1.pdf", "host": "www.lordstown.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.supremecourt.ohio.gov/rod/docs/pdf/0/2026/2026-Ohio-4073.pdf", "host": "www.supremecourt.ohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.29107, "lng": -80.75894, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "border-state-permit-execution-and-capacity-scope-review-round71-2026-10-15.json", "scope": "Originaloperator/localreporter orvisibleoriginalregulatorycopy, stage/date/numericalscopeexplicit.", "fields": {}, "notes": [ "WFMJ AllyRoss September25,2025 originalreport quotesSoftBankspokesperson thatLordstownStargateDCusesasmallpartofexistingFoxconnformerGMmanufacturingfootprint.1.5GW announcedfigure is COMBINEDwithMilamCountyTexas, notLordstownalone. InitialsiteMWnotdisclosed. Originalissuerannouncementbelow confirmsgroup scope.", "Inheritedplanned1500MWcalledlongtermLordstownceiling isnotestablishedbythesetwosources; recommendnullsitecapacityuntilsite-specificevidence. Closed-loop/design-not-use-waterclaims notmeasuredzeroannualwater. Proof-of-conceptshowroom/AIservermanufacturing anddatacenterare distinctuses, notwholeindustrialcomplexoperatingIT. CurrentRFSnotobserved.", "Notallfield/currentoperatingcensus/fullyexecutedcontract/actualpaymentorimpactcertification." ], "sources": [ { "url": "https://www.wfmj.com/archives/data-center-to-occupy-small-part-of-lordstown-ai-hub-feature-advanced-design/article_533f268a-ec1d-5378-9ccb-ceec7d6d343e.html", "host": "wfmj.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "border-state-permit-execution-and-capacity-scope-review-round71-2026-10-15.json", "scope": "Originaloperator/localreporter orvisibleoriginalregulatorycopy, stage/date/numericalscopeexplicit.", "fields": {}, "notes": [ "OpenAI originalSeptember23,2025announcement confirmsLordstownandMilamCountyTWOsitescan scaleTOGETHERto1.5GWover18months, not1.5GWeach/Lordstownceiling. Lordstowngroundbreakingand2026operatingtargethistoricalnotobservedRFS. Pairedcapacityisnotsite-specificIT.", "Nearly7GWplanned/$400Boverthreeyears/500B10GWcommitmentcoverbroaderStargateportfolio, notspentLordstowncapex oroperatingUScensus.4.5GWOracleagreement/5.5GWincludingpotential600MWexpansionareoverlappingscopes, notadditiveeveryfigure. October22,2025updateidentifiesMidwestsiteWisconsin, separateLordstown. AuthorclaimsAbileneearlyworkloadsnotLordstownoperation.", "Notallfield/currentoperatingcensus/fullyexecutedcontract/actualpaymentorimpactcertification." ], "sources": [ { "url": "https://openai.com/index/five-new-stargate-sites/?trk=article-ssr-frontend-pulse_little-text-block", "host": "openai.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 62", "scope": "The complete original SoftBank publication is dated September 24, 2025 and carries a Texas September 23 dateline announcing the Lordstown Stargate selection. Its older reported groundbreaking and next year opening target do not independently establish present 2026 construction or computing service. Selected April 6, 2026 Village minutes distinguish a small Foxconn engineering demonstration, component manufacturing and storage from a full scale Stargate campus; the representative expressly limits his account to Foxconn property. The separately read October 20 Supreme Court opinion concerns Bristolville 25, not this inherited Stargate record. No factory activity, another project court outcome or old forecast becomes exact present computing status.", "fields": { "current_stage_evidence": { "outcome": "original_stargate_announcement_factory_and_bristolville_subjects_separate_current_stage_held", "scope": "The complete original SoftBank publication is dated September 24, 2025 and carries a Texas September 23 dateline announcing the Lordstown Stargate selection. Its older reported groundbreaking and next year opening target do not independently establish present 2026 construction or computing service. Selected April 6, 2026 Village minutes distinguish a small Foxconn engineering demonstration, component manufacturing and storage from a full scale Stargate campus; the representative expressly limits his account to Foxconn property. The separately read October 20 Supreme Court opinion concerns Bristolville 25, not this inherited Stargate record. No factory activity, another project court outcome or old forecast becomes exact present computing status." }, "source_read_scope": { "complete_original_softbank_joint_issuer_body_read": true, "texas_announcement_dateline_distinct_from_host_publication": true, "original_openai403_retained_without_alternate_openai_request": true, "original_lordstown_selected_physical_pages19_23_24_25_26_27_read": true, "foxconn_engineering_and_manufacturing_not_full_stargate_identity": true, "complete19page_original_october20_slip_opinion_read": true, "bristolville_case_not_stargate_outcome": true, "no_roles_locations_or_quantities_changed": true } }, "notes": [ "The complete original SoftBank publication is dated September 24, 2025 and carries a Texas September 23 dateline announcing the Lordstown Stargate selection. Its older reported groundbreaking and next year opening target do not independently establish present 2026 construction or computing service. Selected April 6, 2026 Village minutes distinguish a small Foxconn engineering demonstration, component manufacturing and storage from a full scale Stargate campus; the representative expressly limits his account to Foxconn property. The separately read October 20 Supreme Court opinion concerns Bristolville 25, not this inherited Stargate record. No factory activity, another project court outcome or old forecast becomes exact present computing status.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://group.softbank/en/news/press/20250924", "host": "group.softbank", "published": "2025-09-24", "date": "2025-09-24", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.lordstown.com/wp-content/uploads/April-6-2026-1.pdf", "host": "www.lordstown.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.supremecourt.ohio.gov/rod/docs/pdf/0/2026/2026-Ohio-4073.pdf", "host": "www.supremecourt.ohio.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lordstown · Trumbull · Source context reviewed", "event_evidence": [ { "date": "2025-09-23", "text": "The original SoftBank joint issuer publication carries a Texas September 23, 2025 dateline announcing the Lordstown Stargate selection, with host publication on September 24. This dates the announcement account and does not establish the exact groundbreaking day or achievement of the projected 2026 opening.", "kind": "announced", "sources": [ { "url": "https://group.softbank/en/news/press/20250924", "host": "group.softbank", "published": "2025-09-24", "date": "2025-09-24", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39155" } }, { "id": "state-of-ohio-computer-center-columbus-oh", "state": "oh", "kind": "facility", "name": "State of Ohio Computer Center (SOCC)", "group": "operating", "status": "Government-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Franklin" ], "city": "Columbus", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. SOCC host versus OSC tenant area/power and office-address separation. 1224KinnearRoad is explicitly OSC administrative building and must not automatically locate SOCC server rooms.10000tenantarea subset of225000raised/360000gross, not three facilities.1200kWtenantusable not measured whole-campus consumption. LargestMidwestclaim unverified ranking. No exact SOCC first opening or full IT MW established. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.osc.edu/about/visitOSC", "host": "osc.edu", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.oplin.ohio.gov/co-location-service", "host": "www.oplin.ohio.gov", "published": "", "date": "", "checked": "2026-10-19", "label": "Original source for the qualified stage" } ], "loc": { "lat": 40.01072, "lng": -83.02062, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "SOCC host versus OSC tenant area/power and office-address separation", "fields": { "institution": "Ohio Supercomputer Center", "host_facility": "State of Ohio Computer Center", "location": "west end of Ohio State University campus, Columbus, Ohio", "host_gross_area_sqft": 360000, "host_raised_floor_sqft": 225000, "osc_occupied_area_sqft_approx": 10000, "osc_usable_power_kw_approx": 1200, "power_basis": "OSC tenant usable power, not whole SOCC facility demand" }, "notes": [ "1224KinnearRoad is explicitly OSC administrative building and must not automatically locate SOCC server rooms.10000tenantarea subset of225000raised/360000gross, not three facilities.1200kWtenantusable not measured whole-campus consumption. LargestMidwestclaim unverified ranking. No exact SOCC first opening or full IT MW established.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.osc.edu/about/visitOSC", "host": "osc.edu", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "next-status-2026-10-19", "scope": "OPLIN describes its leased space at the State of Ohio Computer Center as housing its network equipment and offering colocation to public libraries.", "fields": { "current_stage_evidence": { "outcome": "government_listed_colocation_service", "scope": "OPLIN describes its leased space at the State of Ohio Computer Center as housing its network equipment and offering colocation to public libraries." } }, "notes": [ "This supports the named government service, not full-building commissioning or a measured capacity. Certifications, equipment claims, prices and an exact opening date are not independently established or adopted." ], "sources": [ { "url": "https://www.oplin.ohio.gov/co-location-service", "host": "www.oplin.ohio.gov", "published": "", "date": "", "checked": "2026-10-19", "label": "Original source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Columbus · Franklin · Source context reviewed", "status_scope": "OPLIN describes its leased space at the State of Ohio Computer Center as housing its network equipment and offering colocation to public libraries.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39049" } }, { "id": "vantage-oh1-new-albany-licking-county-oh", "state": "oh", "kind": "facility", "name": "Vantage Data Centers OH1", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Licking" ], "city": "Johnstown", "address": "", "who": "Vantage Data Centers", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. named operator source. Target does not prove delivery by2026. Combined construction/long-term jobs not permanent-only.", "date": "", "events": [ [ "2024-10-25", "Vantage published its OH1 campus announcement October 25, 2024 and reported an onsite groundbreaking ceremony that day. This is the dated company account, not independent proof of actual excavation or achievement of the later opening forecast." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=PID%3D96538&outFields=PID,Parcel,OwnerName,SiteAddress&returnGeometry=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://vantage-dc.com/news/vantage-data-centers-breaks-ground-on-192mw-campus-enters-growing-ohio-data-center-market-with-over-2-billion-investment-in-hyperscale-digital-infrastructure/", "host": "vantage-dc.com", "date": "2024-10-25", "published": "2024-10-25", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://vantage-dc.com/data-center-locations/north-america/new-albany-ohio", "host": "vantage-dc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.14721, "lng": -82.5222, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "neighbor-primary-review-round4-2026-10-14.json", "scope": "Field or source context only", "fields": { "cadastral_response_features": 1, "cadastral_error": null, "parcel_assertions": [ { "PID": 96538, "Parcel": "095-111756-00.009", "OwnerName": "VANTAGE DATA CENTERS OH11 LLC", "SiteAddress": "2914 HORIZON CT NW" } ] }, "notes": [ "Public cadastral attributes are ownership/address/assessment evidence, not operating data-center status, end-user identity or a surveyed building pin. Acres and building area retain original field basis. No geometry is promoted; broad company queries can include unrelated property.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://gis.lickingcounty.gov/server/rest/services/Auditor/Parcels/FeatureServer/0/query?where=PID%3D96538&outFields=PID,Parcel,OwnerName,SiteAddress&returnGeometry=true&outSR=4326&f=json", "host": "gis.lickingcounty.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "remaining-operators-review-round5-2026-10-14.json", "scope": "named operator source", "fields": { "groundbreaking_date": "2024-10-25", "planned_investment_usd_min_exclusive": 2000000000, "campus_acres": 70, "planned_it_capacity_mw": 192, "planned_area_sqft_min_exclusive": 1500000, "first_building_opening_target": "late2025", "forecast_combined_construction_operations_jobs_min_exclusive": 1500 }, "notes": [ "Target does not prove delivery by2026. Combined construction/long-term jobs not permanent-only.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://vantage-dc.com/news/vantage-data-centers-breaks-ground-on-192mw-campus-enters-growing-ohio-data-center-market-with-over-2-billion-investment-in-hyperscale-digital-infrastructure/", "host": "vantage-dc.com", "date": "2024-10-25", "published": "2024-10-25", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Company role source check 15, October 23, 2026", "scope": "Vantage Data Centers explicitly identifies the named campus or building in its own source. The developer role is an attributed provider brand relationship, not independently verified legal ownership or current operation of every phase. Proposed and delivered components remain separate. No status, location, address, physical date, quantity, certification, environmental outcome or incentive eligibility is promoted. The October 25, 2024 OH1 announcement describes New Albany development and a late 2025 first building target. The reported ceremony and target are not adopted as new timeline events or current operating status.", "fields": { "company_association": { "name": "Vantage Data Centers", "role": "developer", "identity_scope": "provider_brand_only", "scope": "Vantage Data Centers explicitly identifies the named campus or building in its own source. The developer role is an attributed provider brand relationship, not independently verified legal ownership or current operation of every phase. Proposed and delivered components remain separate. No status, location, address, physical date, quantity, certification, environmental outcome or incentive eligibility is promoted. The October 25, 2024 OH1 announcement describes New Albany development and a late 2025 first building target. The reported ceremony and target are not adopted as new timeline events or current operating status." }, "provider_role": "developer" }, "notes": [ "Vantage Data Centers explicitly identifies the named campus or building in its own source. The developer role is an attributed provider brand relationship, not independently verified legal ownership or current operation of every phase. Proposed and delivered components remain separate. No status, location, address, physical date, quantity, certification, environmental outcome or incentive eligibility is promoted. The October 25, 2024 OH1 announcement describes New Albany development and a late 2025 first building target. The reported ceremony and target are not adopted as new timeline events or current operating status.", "Publication dates and stated targets remain separate from actual physical milestones." ], "sources": [ { "url": "https://vantage-dc.com/news/vantage-data-centers-breaks-ground-on-192mw-campus-enters-growing-ohio-data-center-market-with-over-2-billion-investment-in-hyperscale-digital-infrastructure/", "host": "vantage-dc.com", "published": "2024-10-25", "date": "2024-10-25", "checked": "2026-10-23", "label": "First party exact campus or code text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "The current named OH1 page still forecasts its first building operational by December 2025 and later phases through 2028. The October 25, 2024 original release reports a celebratory groundbreaking. A past forecast, a ceremony and generic campus capabilities do not verify present individual building service or all campus completion. The existing exact physical phase remains unclear. Current address and quantity fields are not changed.", "fields": { "current_stage_evidence": { "outcome": "named_oh1_elapsed_opening_forecast_and_historic_ceremony_not_current_completion", "scope": "The current named OH1 page still forecasts its first building operational by December 2025 and later phases through 2028. The October 25, 2024 original release reports a celebratory groundbreaking. A past forecast, a ceremony and generic campus capabilities do not verify present individual building service or all campus completion. The existing exact physical phase remains unclear. Current address and quantity fields are not changed." } }, "notes": [ "The current named OH1 page still forecasts its first building operational by December 2025 and later phases through 2028. The October 25, 2024 original release reports a celebratory groundbreaking. A past forecast, a ceremony and generic campus capabilities do not verify present individual building service or all campus completion. The existing exact physical phase remains unclear. Current address and quantity fields are not changed.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://vantage-dc.com/data-center-locations/north-america/new-albany-ohio", "host": "vantage-dc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://vantage-dc.com/news/vantage-data-centers-breaks-ground-on-192mw-campus-enters-growing-ohio-data-center-market-with-over-2-billion-investment-in-hyperscale-digital-infrastructure/", "host": "vantage-dc.com", "published": "2024-10-25", "date": "2024-10-25", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Johnstown · Licking · Source context reviewed", "event_evidence": [ { "date": "2024-10-25", "text": "Vantage published its OH1 campus announcement October 25, 2024 and reported an onsite groundbreaking ceremony that day. This is the dated company account, not independent proof of actual excavation or achievement of the later opening forecast.", "kind": "announced", "sources": [ { "url": "https://vantage-dc.com/news/vantage-data-centers-breaks-ground-on-192mw-campus-enters-growing-ohio-data-center-market-with-over-2-billion-investment-in-hyperscale-digital-infrastructure/", "host": "vantage-dc.com", "published": "2024-10-25", "date": "2024-10-25", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39089" } }, { "id": "vantage-oh2-millersport-fairfield-oh", "state": "oh", "kind": "facility", "name": "Vantage Data Centers OH2 (Millersport Campus)", "group": "proposed", "status": "Project listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Fairfield" ], "city": "Millersport", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Vantage Millersport explicit IT and building/job categories. 2550headlinejobscombinesconstructionandoperations,not2550permanent.7totalbuildingsnot7DCs;up-to4DCs.696ITnotgasplantnameplate/currentenergizedIT.2.1Bplannedinfrastructureinvestmentnotactualspent/tenantcomputeinvestment. NoRFSdayorsignedpermits/sourceplantapprovalread. Ratepayerclaimnotindependentutilityfinding. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://vantagemillersportcampus.com/", "host": "vantagemillersportcampus.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://vantagemillersportcampus.com/construction-updates/", "host": "vantagemillersportcampus.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 39.76468, "lng": -82.64493, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "Vantage Millersport explicit IT and building/job categories", "fields": { "developer": "Vantage", "project": "OH2 Millersport campus", "location": "Lancaster Newark Road and Blacklick Road, Village of Millersport, Ohio", "planned_critical_it_mw": 696, "campus_acres": 352, "total_planned_buildings": 7, "data_center_buildings_max": 4, "planned_data_center_area_sqft": 2500000, "planned_investment_usd_min_exclusive": 2100000000, "expected_construction_jobs_min_exclusive": 2500, "expected_vantage_permanent_fulltime_positions_min_exclusive": 50, "power_plan": "adjacent natural gas facility" }, "notes": [ "2550headlinejobscombinesconstructionandoperations,not2550permanent.7totalbuildingsnot7DCs;up-to4DCs.696ITnotgasplantnameplate/currentenergizedIT.2.1Bplannedinfrastructureinvestmentnotactualspent/tenantcomputeinvestment. NoRFSdayorsignedpermits/sourceplantapprovalread. Ratepayerclaimnotindependentutilityfinding.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://vantagemillersportcampus.com/", "host": "vantagemillersportcampus.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 33", "scope": "The current named Millersport site describes a campus being developed and publishes a monthly activity calendar through December 2026. Project listed development applies to that explicit company proposal. The calendar mixes elapsed, current and future planned grading, utility and foundation activities; it is not a certified completed work log. No listed month becomes an accomplished construction start or completion day. The adjacent proposed gas generation facility, future benefits and forecast costs are separate from data center operation.", "fields": { "current_stage_evidence": { "outcome": "current_named_millersport_development_and_planned_activity_calendar", "scope": "The current named Millersport site describes a campus being developed and publishes a monthly activity calendar through December 2026. Project listed development applies to that explicit company proposal. The calendar mixes elapsed, current and future planned grading, utility and foundation activities; it is not a certified completed work log. No listed month becomes an accomplished construction start or completion day. The adjacent proposed gas generation facility, future benefits and forecast costs are separate from data center operation." } }, "notes": [ "The current named Millersport site describes a campus being developed and publishes a monthly activity calendar through December 2026. Project listed development applies to that explicit company proposal. The calendar mixes elapsed, current and future planned grading, utility and foundation activities; it is not a certified completed work log. No listed month becomes an accomplished construction start or completion day. The adjacent proposed gas generation facility, future benefits and forecast costs are separate from data center operation.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://vantagemillersportcampus.com/", "host": "vantagemillersportcampus.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://vantagemillersportcampus.com/construction-updates/", "host": "vantagemillersportcampus.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Millersport · Fairfield · Source context reviewed", "status_scope": "The current named Millersport site describes a campus being developed and publishes a monthly activity calendar through December 2026. Project listed development applies to that explicit company proposal. The calendar mixes elapsed, current and future planned grading, utility and foundation activities; it is not a certified completed work log. No listed month becomes an accomplished construction start or completion day. The adjacent proposed gas generation facility, future benefits and forecast costs are separate from data center operation.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39045" } }, { "id": "bitdeer-whitetail-creek-trumbull-county-oh", "state": "oh", "kind": "facility", "name": "Whitetail Creek Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Trumbull" ], "city": "Niles / Weathersfield Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. 300 MW is proposed secured/commissioning goal, not current IT usage. Plant demolition is not data center construction. Site use remains unclear; portfolio totals and other site fires not transferred. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://businessjournaldaily.com/bitdeer-eyes-energization-for-weathersfield-project-in-2029/", "host": "businessjournaldaily.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 41.31701, "lng": -80.76122, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Business Journal reports Bitdeer Whitetail Creek land/site plans at former Niles plant, with energization targeted Q1 2029.", "independently_verified_current_operating_status": null }, "notes": [ "300 MW is proposed secured/commissioning goal, not current IT usage. Plant demolition is not data center construction. Site use remains unclear; portfolio totals and other site fires not transferred.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://businessjournaldaily.com/bitdeer-eyes-energization-for-weathersfield-project-in-2029/", "host": "businessjournaldaily.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Niles / Weathersfield Township · Trumbull · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "39155" } } ], "compilation_license": "withheld_pending_owner_decision" }