{ "schema_version": 1, "source_compilation_context": { "pa": { "attribution": { "inventory": { "name": "Compute Atlas", "creator": "Edward Kubiak", "url": "https://www.compute-atlas.com/api", "license": "CC BY 4.0", "license_url": "https://creativecommons.org/licenses/by/4.0/", "snapshot_url": "https://www.compute-atlas.com/api/facilities", "retrieved": "2026-10-14", "sha256": "79ad432dab7c128e428234c9d0dd40933114b415a4a5d697db00095637d50f37", "changes": "Added provenance, publication-date distinctions, display-safe wording, quarantine flags and state partitioning. Original source records retained locally." }, "counties": "U.S. Census Bureau county boundaries (public domain)", "research": "Field-specific source context. See the linked source and limits on each record." }, "source_data_url": "https://datacentersatlas.com/data/pa.json", "updated": "2026-10-24" } }, "scope": "Source compiled state collection. Research records retain their sources, dates and location limits. Counts are not a census of operating buildings. Company name links alone do not establish ownership or operation.", "collection": { "kind": "states", "key": "pa", "label": "Pennsylvania" }, "records": [ { "id": "four-three-glenbrook-salem-township-luzerne-pa", "state": "pa", "kind": "facility", "name": "4-3 Glenbrook Group Salem Township Data Center Campus (Salem 3)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Luzerne" ], "city": "Salem Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.. The potential 1.2-billion-USD purchase is neither a closed transaction nor construction spending. Proposed demand is not secured IT. The earlier QTS closing is separate. The buyer is undisclosed and the expected community agreement is not executed. Current original approvals, disclosures and later outcomes take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.timesleader.com/news/1745226/1-2-billion-land-deal-for-second-data-center-project-in-salem-township-announced-by-4-3-group", "host": "timesleader.com", "date": "2026-06-13", "published": "2026-06-13", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.19461, "lng": -76.00851, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round26-2026-10-14.json", "scope": "Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.", "fields": { "reported_context": "Times Leader describes prospective Glen Brook land assembly, a 39-building concept and intended zoning applications.", "independently_verified_current_operating_status": null }, "notes": [ "The potential 1.2-billion-USD purchase is neither a closed transaction nor construction spending. Proposed demand is not secured IT. The earlier QTS closing is separate. The buyer is undisclosed and the expected community agreement is not executed.", "Current original approvals, disclosures and later outcomes take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.timesleader.com/news/1745226/1-2-billion-land-deal-for-second-data-center-project-in-salem-township-announced-by-4-3-group", "host": "timesleader.com", "date": "2026-06-13", "published": "2026-06-13", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "DEP names a Glen Brook Group Salem Township proposal, but the row does not recertify the inherited Salem 3 component or distinguish it from other Glen Brook land assembly phases. The broad company and municipality match remains context. A specific current individual phase is not adopted, and the earlier separate QTS transaction is not transferred. Existing identity, roles, quantities and locations remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "broad_company_and_municipality_row_without_accepted_individual_component_crosswalk", "scope": "DEP names a Glen Brook Group Salem Township proposal, but the row does not recertify the inherited Salem 3 component or distinguish it from other Glen Brook land assembly phases. The broad company and municipality match remains context. A specific current individual phase is not adopted, and the earlier separate QTS transaction is not transferred. Existing identity, roles, quantities and locations remain unchanged." }, "tracker_scope": { "project_id": "10000048", "original_project_and_related_permit_csv_read": true, "no_data_center_operation_inferred": true, "no_coordinate_or_role_promotion": true, "individual_component_crosswalk_accepted": false } }, "notes": [ "DEP names a Glen Brook Group Salem Township proposal, but the row does not recertify the inherited Salem 3 component or distinguish it from other Glen Brook land assembly phases. The broad company and municipality match remains context. A specific current individual phase is not adopted, and the earlier separate QTS transaction is not transferred. Existing identity, roles, quantities and locations remain unchanged.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Salem Township · Luzerne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42079" } }, { "id": "aws-falls-township-pa", "state": "pa", "kind": "facility", "name": "Amazon Web Services Innovation Campus, Falls Township", "group": "approved", "status": "Reported land use approval", "raw_status": "approved", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Bucks" ], "city": "Falls Township", "address": "", "who": "Amazon", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Falls municipal Amazon announcement and land-plan scopes. 20Band1250jobs statewide not Falls-only.1800ac entire redevelopment not DC footprint. Existingbuilding6distributionplan modified and247acphase2separate scopes;do not call all structures operating DCs. Preliminary/final land-development plans not observed customer service. No numeric ITMW, final current service date or actual spend. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2025-06-09", "Falls Township published its Amazon campus and revised land development approval account June 9, 2025. The Township describes earlier March approvals without an exact voting day in this account. This is the publication date, not a data center opening or precise construction start." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.fallstwp.com/resources/news/article/?id=10070", "host": "fallstwp.com", "date": "2025-06-09", "published": "2025-06-09", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-pennsylvania-investment-cloud-infrastructure-ai-innovation", "host": "www.aboutamazon.com", "published": "2025-06-09", "date": "2025-06-09", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "loc": { "lat": 40.33679, "lng": -75.10675, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Falls municipal Amazon announcement and land-plan scopes", "fields": { "agency": "Falls Township, Pennsylvania", "announcement_date": "2025-06-09", "operator": "Amazon", "regional_planned_investment_usd": 20000000000, "regional_expected_jobs": 1250, "regional_scope": "Pennsylvania multiple campuses", "broader_keystone_trade_center_acres": 1800, "phase2_digital_infrastructure_parcel_acres": 247, "modified_existing_plan_addresses": [ "1 Ben Fairless Drive", "700 SouthPortRoad" ], "phase2_planned_structures": 10, "phase2_total_planned_area_sqft_min_exclusive": 2000000, "phase2_individual_structure_sqft_range": [ 112000, 217000 ], "agency_described_plan_change_month": "2025-03" }, "notes": [ "20Band1250jobs statewide not Falls-only.1800ac entire redevelopment not DC footprint. Existingbuilding6distributionplan modified and247acphase2separate scopes;do not call all structures operating DCs. Preliminary/final land-development plans not observed customer service. No numeric ITMW, final current service date or actual spend.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.fallstwp.com/resources/news/article/?id=10070", "host": "fallstwp.com", "date": "2025-06-09", "published": "2025-06-09", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 27", "scope": "Falls Township June 9, 2025 account explicitly reports Supervisors approval in March of revised preliminary and final land development plans for the named NorthPoint portions of Keystone Trade Center that would become data center development. The same account identifies the Amazon campus announcement. Reported land use approval is limited to that Township account, not a building permit, physical start or operation of every future structure. March is not converted to an exact approval day. The statewide investment and job forecast are not local delivered quantities.", "fields": { "current_stage_evidence": { "outcome": "township_reported_named_revised_land_development_approval", "scope": "Falls Township June 9, 2025 account explicitly reports Supervisors approval in March of revised preliminary and final land development plans for the named NorthPoint portions of Keystone Trade Center that would become data center development. The same account identifies the Amazon campus announcement. Reported land use approval is limited to that Township account, not a building permit, physical start or operation of every future structure. March is not converted to an exact approval day. The statewide investment and job forecast are not local delivered quantities." } }, "notes": [ "Falls Township June 9, 2025 account explicitly reports Supervisors approval in March of revised preliminary and final land development plans for the named NorthPoint portions of Keystone Trade Center that would become data center development. The same account identifies the Amazon campus announcement. Reported land use approval is limited to that Township account, not a building permit, physical start or operation of every future structure. March is not converted to an exact approval day. The statewide investment and job forecast are not local delivered quantities.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://www.fallstwp.com/resources/news/article/?id=10070", "host": "www.fallstwp.com", "published": "2025-06-09", "date": "2025-06-09", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check69, October24,2026", "scope": "The June 9, 2025 Amazon announcement explicitly names Falls Township as a planned innovation campus community. Its separate Salem Township proposal is not merged with this record. Developer per source means the named project proponent, not legal property ownership, a construction contractor or a completed campus. The statewide investment is not a site cost or power figure. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred.", "fields": { "company_association": { "name": "Amazon", "role": "developer", "identity_scope": "provider_brand_only", "scope": "The June 9, 2025 Amazon announcement explicitly names Falls Township as a planned innovation campus community. Its separate Salem Township proposal is not merged with this record. Developer per source means the named project proponent, not legal property ownership, a construction contractor or a completed campus. The statewide investment is not a site cost or power figure. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred." }, "provider_role": "developer" }, "notes": [ "The June 9, 2025 Amazon announcement explicitly names Falls Township as a planned innovation campus community. Its separate Salem Township proposal is not merged with this record. Developer per source means the named project proponent, not legal property ownership, a construction contractor or a completed campus. The statewide investment is not a site cost or power figure. Only the previously empty provider brand and source role evidence are filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. No current operation, environmental effect or legal compliance is inferred." ], "sources": [ { "url": "https://www.aboutamazon.com/news/aws/amazon-pennsylvania-investment-cloud-infrastructure-ai-innovation", "host": "www.aboutamazon.com", "published": "2025-06-09", "date": "2025-06-09", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Falls Township · Bucks · Source context reviewed", "status_scope": "Falls Township June 9, 2025 account explicitly reports Supervisors approval in March of revised preliminary and final land development plans for the named NorthPoint portions of Keystone Trade Center that would become data center development. The same account identifies the Amazon campus announcement. Reported land use approval is limited to that Township account, not a building permit, physical start or operation of every future structure. March is not converted to an exact approval day. The statewide investment and job forecast are not local delivered quantities.", "event_evidence": [ { "date": "2025-06-09", "text": "Falls Township published its Amazon campus and revised land development approval account June 9, 2025. The Township describes earlier March approvals without an exact voting day in this account. This is the publication date, not a data center opening or precise construction start.", "kind": "announced", "sources": [ { "url": "https://www.fallstwp.com/resources/news/article/?id=10070", "host": "www.fallstwp.com", "published": "2025-06-09", "date": "2025-06-09", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42017" } }, { "id": "archbald-i-campus-1-eynon-jermyn-road-lackawanna-pa", "state": "pa", "kind": "facility", "name": "Archbald I Campus 1 Data Center (Eynon Jermyn Road)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lackawanna" ], "city": "Archbald", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. 22 buildings are not 22 campuses.150,000 squarefeet each is FOOTPRINT, not multi-story grossfloor area;7 million/1.5 millionimpervious areas include roads/parking, not datahallspace. Principally permitted zoning use is not an issued site/buildingpermit or executedutilityagreement. ProposedOctoberordinance failed to receive a second and was NOTadopted; its 120 acre/230 kV/height/setback/generationconditions are draft, not applicable law. Registered-agent address cannot identify operator. ProjectGravity, Boson, WildcatRidge and withdrawnBlakely are separate. October 2025 application context is notOctober 2026 event. Project/zoning sections personally read; no whole-recordcertification or exactcurrentoperatingstatus. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.yahoo.com/news/articles/developer-applies-22-more-data-035900249.html", "host": "yahoo.com", "date": "2025-11-01", "published": "2025-11-01", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.43639, "lng": -75.60926, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "TheTimes-Tribune viaYahoo describes ArchbaldILLCOctober 22 applications for two distinct campuses:18 buildings onroughly 408 acres andfourbuildings onroughly 66 acres, with corporate/end-user identity undisclosed.", "independently_verified_current_operating_status": null }, "notes": [ "22 buildings are not 22 campuses.150,000 squarefeet each is FOOTPRINT, not multi-story grossfloor area;7 million/1.5 millionimpervious areas include roads/parking, not datahallspace. Principally permitted zoning use is not an issued site/buildingpermit or executedutilityagreement. ProposedOctoberordinance failed to receive a second and was NOTadopted; its 120 acre/230 kV/height/setback/generationconditions are draft, not applicable law. Registered-agent address cannot identify operator. ProjectGravity, Boson, WildcatRidge and withdrawnBlakely are separate. October 2025 application context is notOctober 2026 event. Project/zoning sections personally read; no whole-recordcertification or exactcurrentoperatingstatus.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.yahoo.com/news/articles/developer-applies-22-more-data-035900249.html", "host": "yahoo.com", "date": "2025-11-01", "published": "2025-11-01", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "The DEP combined Archbald I and Archbald II row does not separate the two inherited campus components or their precise current physical phases. Its broad proposal classification is not assigned to each individual campus as a verified phase. No identity, jurisdiction, provider role, status or location change is adopted.", "fields": { "current_stage_evidence": { "outcome": "combined_or_different_project_row_or_current_legal_outcome_held", "scope": "The DEP combined Archbald I and Archbald II row does not separate the two inherited campus components or their precise current physical phases. Its broad proposal classification is not assigned to each individual campus as a verified phase. No identity, jurisdiction, provider role, status or location change is adopted." } }, "notes": [ "The DEP combined Archbald I and Archbald II row does not separate the two inherited campus components or their precise current physical phases. Its broad proposal classification is not assigned to each individual campus as a verified phase. No identity, jurisdiction, provider role, status or location change is adopted.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Archbald · Lackawanna · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42069" } }, { "id": "archbald-i-campus-2-washington-avenue-lackawanna-pa", "state": "pa", "kind": "facility", "name": "Archbald I Campus 2 Data Center (Eynon Jermyn Road at Washington Avenue)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lackawanna" ], "city": "Archbald", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.. 22 buildings are not 22 campuses.150,000 squarefeet each is FOOTPRINT, not multi-story grossfloor area;7 million/1.5 millionimpervious areas include roads/parking, not datahallspace. Principally permitted zoning use is not an issued site/buildingpermit or executedutilityagreement. ProposedOctoberordinance failed to receive a second and was NOTadopted; its 120 acre/230 kV/height/setback/generationconditions are draft, not applicable law. Registered-agent address cannot identify operator. ProjectGravity, Boson, WildcatRidge and withdrawnBlakely are separate. October 2025 application context is notOctober 2026 event. Project/zoning sections personally read; no whole-recordcertification or exactcurrentoperatingstatus. Later originals and observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.yahoo.com/news/articles/developer-applies-22-more-data-035900249.html", "host": "yahoo.com", "date": "2025-11-01", "published": "2025-11-01", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.44969, "lng": -75.62378, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round34-2026-10-14.json", "scope": "Personally read project-specific public context only; no whole-record certification. Regional, directory, legislative and membership sources do not verify an exact building.", "fields": { "reported_context": "TheTimes-Tribune viaYahoo describes ArchbaldILLCOctober 22 applications for two distinct campuses:18 buildings onroughly 408 acres andfourbuildings onroughly 66 acres, with corporate/end-user identity undisclosed.", "independently_verified_current_operating_status": null }, "notes": [ "22 buildings are not 22 campuses.150,000 squarefeet each is FOOTPRINT, not multi-story grossfloor area;7 million/1.5 millionimpervious areas include roads/parking, not datahallspace. Principally permitted zoning use is not an issued site/buildingpermit or executedutilityagreement. ProposedOctoberordinance failed to receive a second and was NOTadopted; its 120 acre/230 kV/height/setback/generationconditions are draft, not applicable law. Registered-agent address cannot identify operator. ProjectGravity, Boson, WildcatRidge and withdrawnBlakely are separate. October 2025 application context is notOctober 2026 event. Project/zoning sections personally read; no whole-recordcertification or exactcurrentoperatingstatus.", "Later originals and observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.yahoo.com/news/articles/developer-applies-22-more-data-035900249.html", "host": "yahoo.com", "date": "2025-11-01", "published": "2025-11-01", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "The DEP combined Archbald I and Archbald II row does not establish which application, building or current physical phase belongs to this second inherited campus. Another Archbald applicant is not substituted. No identity, jurisdiction, provider role, status or location change is adopted.", "fields": { "current_stage_evidence": { "outcome": "combined_or_different_project_row_or_current_legal_outcome_held", "scope": "The DEP combined Archbald I and Archbald II row does not establish which application, building or current physical phase belongs to this second inherited campus. Another Archbald applicant is not substituted. No identity, jurisdiction, provider role, status or location change is adopted." } }, "notes": [ "The DEP combined Archbald I and Archbald II row does not establish which application, building or current physical phase belongs to this second inherited campus. Another Archbald applicant is not substituted. No identity, jurisdiction, provider role, status or location change is adopted.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Archbald · Lackawanna · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42069" } }, { "id": "ardent-pittsburgh-mckees-rocks-pa", "state": "pa", "kind": "facility", "name": "Ardent Data Centers Pittsburgh (McKees Rocks)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Allegheny" ], "city": "McKees Rocks", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Limited named street-label/service context or issuer acquisition statement.. Original NorthernData issuer release January22,2024 states completed acquisition of McKeesRocks Pittsburgh7.5-acre/41000sf facility. Price undisclosed; no closing deed or exact parcel survey inspected. Existing5MW to full20MW targetH22025, with retrofit completionQ42024 separately targeted; not25MW additive or observed2026 energization. No explicitITbasis. PUE1.2orless is a target, not measured annual efficiency or independent most-efficient ranking. Under10ms regional latency/favorablepricing claims not audited currentperformance/all-in tariff. EuropeanBoden site is separate. Exact street number, ownership, critical IT, current commissioning and whole-record verification not implied.", "date": "", "events": [ [ "2025-06-04", "Northern Data published its Pittsburgh AI and HPC opening announcement June 4, 2025. The account describes phased future capacity. This records the company announcement and does not resolve the different scope of the later general State policy wording or certify current operation of every expansion phase." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.prnewswire.co.uk/news-releases/ardent-data-centers-a-northern-data-group-company-completes-acquisition-of-pennsylvania-data-center-302040653.html", "host": "prnewswire.co.uk", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://northerndata.de/eqs-news-test/northern-data-group-announces-opening-of-next-generation-ai-and-high-performance-68f477cf-en", "host": "northerndata.de", "published": "2025-06-04", "date": "2025-06-04", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.pa.gov/governor/topics/data-centers", "host": "www.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.pa.gov/content/dam/copapwp-pagov/en/governor/documents/eo2026_05_protecting%20pennsylvania%20consumers%20from%20data%20center%20impacts_final_executed.pdf", "host": "www.pa.gov", "published": "2026-08-18", "date": "2026-08-18", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.48509, "lng": -79.99917, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-management-system-scope-and-acquisition-stages-round88-2026-10-15.json", "scope": "Limited named street-label/service context or issuer acquisition statement.", "fields": {}, "notes": [ "Original NorthernData issuer release January22,2024 states completed acquisition of McKeesRocks Pittsburgh7.5-acre/41000sf facility. Price undisclosed; no closing deed or exact parcel survey inspected. Existing5MW to full20MW targetH22025, with retrofit completionQ42024 separately targeted; not25MW additive or observed2026 energization. No explicitITbasis.", "PUE1.2orless is a target, not measured annual efficiency or independent most-efficient ranking. Under10ms regional latency/favorablepricing claims not audited currentperformance/all-in tariff. EuropeanBoden site is separate.", "Exact street number, ownership, critical IT, current commissioning and whole-record verification not implied." ], "sources": [ { "url": "https://www.prnewswire.co.uk/news-releases/ardent-data-centers-a-northern-data-group-company-completes-acquisition-of-pennsylvania-data-center-302040653.html", "host": "prnewswire.co.uk", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 28", "scope": "Northern Data June 4, 2025 issuer announcement explicitly reports opening its Pittsburgh AI and HPC data center with later phased capacity. The current Governor data center policy page separately makes a general statement that no AI data center is currently operational. The classification and exact site scope of that broad statement have not been reconciled against the individual company account. The executive order uses a threshold over 25 MW for specified new DEP application review paths, which is not a site operating certificate. The company opening account is retained without treating the broad policy statement as an individual closure or certifying current exact component operation.", "fields": { "current_stage_evidence": { "outcome": "individual_company_opening_account_and_broad_state_classification_unreconciled", "scope": "Northern Data June 4, 2025 issuer announcement explicitly reports opening its Pittsburgh AI and HPC data center with later phased capacity. The current Governor data center policy page separately makes a general statement that no AI data center is currently operational. The classification and exact site scope of that broad statement have not been reconciled against the individual company account. The executive order uses a threshold over 25 MW for specified new DEP application review paths, which is not a site operating certificate. The company opening account is retained without treating the broad policy statement as an individual closure or certifying current exact component operation." }, "source_read_scope": { "original_executive_order_all_eight_pages_text_read": true, "detailed_legal_scope_receipt": "cohort-28-pennsylvania-order-read-scope.json", "generic_state_statement_not_individual_shutdown": true, "company_opening_not_all_future_capacity": true } }, "notes": [ "Northern Data June 4, 2025 issuer announcement explicitly reports opening its Pittsburgh AI and HPC data center with later phased capacity. The current Governor data center policy page separately makes a general statement that no AI data center is currently operational. The classification and exact site scope of that broad statement have not been reconciled against the individual company account. The executive order uses a threshold over 25 MW for specified new DEP application review paths, which is not a site operating certificate. The company opening account is retained without treating the broad policy statement as an individual closure or certifying current exact component operation.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://northerndata.de/eqs-news-test/northern-data-group-announces-opening-of-next-generation-ai-and-high-performance-68f477cf-en", "host": "northerndata.de", "published": "2025-06-04", "date": "2025-06-04", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.pa.gov/governor/topics/data-centers", "host": "www.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.pa.gov/content/dam/copapwp-pagov/en/governor/documents/eo2026_05_protecting%20pennsylvania%20consumers%20from%20data%20center%20impacts_final_executed.pdf", "host": "www.pa.gov", "published": "2026-08-18", "date": "2026-08-18", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "McKees Rocks · Allegheny · Source context reviewed", "event_evidence": [ { "date": "2025-06-04", "text": "Northern Data published its Pittsburgh AI and HPC opening announcement June 4, 2025. The account describes phased future capacity. This records the company announcement and does not resolve the different scope of the later general State policy wording or certify current operation of every expansion phase.", "kind": "announced", "sources": [ { "url": "https://northerndata.de/eqs-news-test/northern-data-group-announces-opening-of-next-generation-ai-and-high-performance-68f477cf-en", "host": "northerndata.de", "published": "2025-06-04", "date": "2025-06-04", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42003" } }, { "id": "aws-cumulus-salem-township-pa", "state": "pa", "kind": "facility", "name": "AWS Cumulus Data Center Campus, Salem Township", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Luzerne" ], "city": "Salem Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Statewide exemption-cost estimates are not a known Amazon award amount. Two-campus commitment is not per-site spending; labor and energy claims remain attributed and dated. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://technical.ly/civics/amazon-data-centers-tax-break/", "host": "technical.ly", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-pennsylvania-investment-cloud-infrastructure-ai-innovation", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 41.17689, "lng": -75.98916, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Spotlight PA reporting via Technical.ly describes Salem Township and Falls Township AWS investments, state sales-tax exemption and workforce support.", "independently_verified_current_operating_status": null }, "notes": [ "Statewide exemption-cost estimates are not a known Amazon award amount. Two-campus commitment is not per-site spending; labor and energy claims remain attributed and dated.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://technical.ly/civics/amazon-data-centers-tax-break/", "host": "technical.ly", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 28", "scope": "DEP original project CSV separately lists Salem Amazon Phase 1 as DEP Review Complete and Phase 2 as under review. Related Phase 1 permit rows still include pending amendments and a not yet submitted item, so the aggregate title is not every approval complete. Amazon current investment announcement describes future campuses and is not itself commissioning of the exact inherited Cumulus component. A water system operations approval is not data center operation. Existing power supply, a broader campus investment, individual permitted infrastructure and future expansion remain distinct. Exact current computing operation and the inherited component crosswalk remain unclear.", "fields": { "current_stage_evidence": { "outcome": "salem_phase_and_individual_permit_scopes_not_exact_cumulus_operation", "scope": "DEP original project CSV separately lists Salem Amazon Phase 1 as DEP Review Complete and Phase 2 as under review. Related Phase 1 permit rows still include pending amendments and a not yet submitted item, so the aggregate title is not every approval complete. Amazon current investment announcement describes future campuses and is not itself commissioning of the exact inherited Cumulus component. A water system operations approval is not data center operation. Existing power supply, a broader campus investment, individual permitted infrastructure and future expansion remain distinct. Exact current computing operation and the inherited component crosswalk remain unclear." }, "tracker_scope": { "project_ids": [ "10000002", "10000066" ], "phase1_aggregate_and_related_pending_rows_differ": true, "water_system_operations_not_data_center_operations": true, "no_site_or_jurisdiction_change": true } }, "notes": [ "DEP original project CSV separately lists Salem Amazon Phase 1 as DEP Review Complete and Phase 2 as under review. Related Phase 1 permit rows still include pending amendments and a not yet submitted item, so the aggregate title is not every approval complete. Amazon current investment announcement describes future campuses and is not itself commissioning of the exact inherited Cumulus component. A water system operations approval is not data center operation. Existing power supply, a broader campus investment, individual permitted infrastructure and future expansion remain distinct. Exact current computing operation and the inherited component crosswalk remain unclear.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.aboutamazon.com/news/aws/amazon-pennsylvania-investment-cloud-infrastructure-ai-innovation", "host": "www.aboutamazon.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Salem Township · Luzerne · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42079" } }, { "id": "aws-kline-township-schuylkill-pa", "state": "pa", "kind": "facility", "name": "AWS Kline Township Data Center Campus", "group": "proposed", "status": "Permit review underway", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Schuylkill" ], "city": "Kline Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Extension is not preliminary/final land-development approval. Later deadline outcome remains unobserved; unrelated municipal spending in article is not project incentive. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-03-02", "Pennsylvania Office of Open Records issued its Kline Township records appeal determination March 2, 2026. It grants the appeal in part and dismisses part as moot. This is the dated records decision account, not an environmental permit ruling, project denial or proof of later compliance." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://shensentinel.com/news/kline-supervisors-grant-extension-for-consideration-of-amazon-data-center-plans/", "host": "shensentinel.com", "date": "2026-08-17", "published": "2026-08-17", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.openrecords.pa.gov/Appeals/DocketGetFile.cfm?id=257197", "host": "www.openrecords.pa.gov", "published": "2026-03-02", "date": "2026-03-02", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.70567, "lng": -76.21613, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "Shenandoah Sentinel reports AWS Kline plan consideration deadline extended to September 30, 2026.", "independently_verified_current_operating_status": null }, "notes": [ "Extension is not preliminary/final land-development approval. Later deadline outcome remains unobserved; unrelated municipal spending in article is not project incentive.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://shensentinel.com/news/kline-supervisors-grant-extension-for-consideration-of-amazon-data-center-plans/", "host": "shensentinel.com", "date": "2026-08-17", "published": "2026-08-17", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 28", "scope": "The current DEP tracker original project CSV identifies Kline Township Data Center Development as project 10000004 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed.", "fields": { "current_stage_evidence": { "outcome": "current_named_dep_project_permit_review_not_physical_operation", "scope": "The current DEP tracker original project CSV identifies Kline Township Data Center Development as project 10000004 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed." }, "tracker_scope": { "project_id": "10000004", "project_and_permit_csv_read_together": true, "aggregate_status_not_every_permit_complete": true, "source_coordinates_not_promoted": true, "submitted_day_not_issued_day": true } }, "notes": [ "The current DEP tracker original project CSV identifies Kline Township Data Center Development as project 10000004 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.openrecords.pa.gov/Appeals/DocketGetFile.cfm?id=257197", "host": "www.openrecords.pa.gov", "published": "2026-03-02", "date": "2026-03-02", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Kline Township · Schuylkill · Source context reviewed", "status_scope": "The current DEP tracker original project CSV identifies Kline Township Data Center Development as project 10000004 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed.", "event_evidence": [ { "date": "2026-03-02", "text": "Pennsylvania Office of Open Records issued its Kline Township records appeal determination March 2, 2026. It grants the appeal in part and dismisses part as moot. This is the dated records decision account, not an environmental permit ruling, project denial or proof of later compliance.", "kind": "announced", "sources": [ { "url": "https://www.openrecords.pa.gov/Appeals/DocketGetFile.cfm?id=257197", "host": "www.openrecords.pa.gov", "published": "2026-03-02", "date": "2026-03-02", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42107" } }, { "id": "switch-big-beaver-pa", "state": "pa", "kind": "facility", "name": "Big Beaver Campus", "group": "proposed", "status": "Project listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Beaver" ], "city": "Big Beaver", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. named operator source. Planned development, no site MW, capital amount or opening date supplied. Zero server-cooling water explicitly allows office/warehouse water connection. Ratepayer protection statement not independent tariff review. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-04-30", "Switch published its Big Beaver Borough campus development announcement April 30, 2026. The release describes planned facilities and company commitments, not completed construction or operation." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.switch.com/switch-announces-new-data-center-campus-in-beaver-county-pennsylvania/", "host": "switch.com", "date": "2026-04-30", "published": "2026-04-30", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 40.69498, "lng": -80.36328, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "captured-operator-review-round6-2026-10-14.json", "scope": "named operator source", "fields": { "development_announcement_date": "2026-04-30", "planned_campus_acres": 382, "published_municipality": "Big Beaver Borough", "published_county": "Beaver, Pennsylvania" }, "notes": [ "Planned development, no site MW, capital amount or opening date supplied. Zero server-cooling water explicitly allows office/warehouse water connection. Ratepayer protection statement not independent tariff review.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.switch.com/switch-announces-new-data-center-campus-in-beaver-county-pennsylvania/", "host": "switch.com", "date": "2026-04-30", "published": "2026-04-30", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 27", "scope": "Switch April 30, 2026 announcement describes plans to develop the named Big Beaver Borough campus in Beaver County. Proposed records that company development announcement. Existing Switch Prime campuses elsewhere do not establish operation here. Funding, cooling designs, future environmental benefits and local partnership commitments are company statements, not independently verified outcomes or current construction. No forecast quantities, role or location fields are promoted.", "fields": { "current_stage_evidence": { "outcome": "named_company_development_announcement_not_construction_or_operation", "scope": "Switch April 30, 2026 announcement describes plans to develop the named Big Beaver Borough campus in Beaver County. Proposed records that company development announcement. Existing Switch Prime campuses elsewhere do not establish operation here. Funding, cooling designs, future environmental benefits and local partnership commitments are company statements, not independently verified outcomes or current construction. No forecast quantities, role or location fields are promoted." } }, "notes": [ "Switch April 30, 2026 announcement describes plans to develop the named Big Beaver Borough campus in Beaver County. Proposed records that company development announcement. Existing Switch Prime campuses elsewhere do not establish operation here. Funding, cooling designs, future environmental benefits and local partnership commitments are company statements, not independently verified outcomes or current construction. No forecast quantities, role or location fields are promoted.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://www.switch.com/switch-announces-new-data-center-campus-in-beaver-county-pennsylvania/", "host": "www.switch.com", "published": "2026-04-30", "date": "2026-04-30", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Big Beaver · Beaver · Source context reviewed", "status_scope": "Switch April 30, 2026 announcement describes plans to develop the named Big Beaver Borough campus in Beaver County. Proposed records that company development announcement. Existing Switch Prime campuses elsewhere do not establish operation here. Funding, cooling designs, future environmental benefits and local partnership commitments are company statements, not independently verified outcomes or current construction. No forecast quantities, role or location fields are promoted.", "event_evidence": [ { "date": "2026-04-30", "text": "Switch published its Big Beaver Borough campus development announcement April 30, 2026. The release describes planned facilities and company commitments, not completed construction or operation.", "kind": "announced", "sources": [ { "url": "https://www.switch.com/switch-announces-new-data-center-campus-in-beaver-county-pennsylvania/", "host": "www.switch.com", "published": "2026-04-30", "date": "2026-04-30", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42007" } }, { "id": "bitfarms-sharon-pa", "state": "pa", "kind": "facility", "name": "Bitfarms Sharon Facility (former Westinghouse plant)", "group": "approved", "status": "Reported land use approval", "raw_status": "approved", "status_field": "current_status", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Mercer" ], "city": "Sharon", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Campus-level issuer context, not proof every imported plant/building ID is independently energized.. Two Panther Creek base labels can describe overlapping plant/campus history, not two independently established physical campuses. No site-by-site new lease or permit outcome inferred from fleet financial disclosure. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-08-10", "Keel published its second quarter development update August 10, 2026, reporting Sharon land use approvals and separately discussing mining decommissioning and future HPC construction. The publication does not supply an exact approval day or HPC commissioning date." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-first-quarter-2026-results", "host": "ir.keelinfra.com", "date": "2026-05-11", "published": "2026-05-11", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-second-quarter-2026-results", "host": "ir.keelinfra.com", "published": "2026-08-10", "date": "2026-08-10", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 41.30236, "lng": -80.25768, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Campus-level issuer context, not proof every imported plant/building ID is independently energized.", "fields": { "announcement_date": "2026-05-11", "quarter_ended": "2026-03-31", "company_claim": "Zoning obtained for Panther Creek, Sharon and Moses Lake; environmental/land-development permits still progressing.", "redomiciliation_parent_transaction_date": "2026-04-01" }, "notes": [ "Two Panther Creek base labels can describe overlapping plant/campus history, not two independently established physical campuses. No site-by-site new lease or permit outcome inferred from fleet financial disclosure.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-first-quarter-2026-results", "host": "ir.keelinfra.com", "date": "2026-05-11", "published": "2026-05-11", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 27", "scope": "Keel August 10, 2026 second quarter results explicitly identify Sharon among its development sites. The company reports Sharon zoning and land development approvals. Reported land use approval is limited to that company account. Environmental permit applications are still described as progressing. Company decommissioning of United States Bitcoin mining operations is separate from future HPC construction, customer leases and commissioned HPC service. Neither equipment delivery to another site nor aggregate legacy revenues establishes operation of this HPC proposal. Existing identity, crypto classification, roles and quantities remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "company_reported_named_land_use_approval_not_hpc_operation", "scope": "Keel August 10, 2026 second quarter results explicitly identify Sharon among its development sites. The company reports Sharon zoning and land development approvals. Reported land use approval is limited to that company account. Environmental permit applications are still described as progressing. Company decommissioning of United States Bitcoin mining operations is separate from future HPC construction, customer leases and commissioned HPC service. Neither equipment delivery to another site nor aggregate legacy revenues establishes operation of this HPC proposal. Existing identity, crypto classification, roles and quantities remain unchanged." } }, "notes": [ "Keel August 10, 2026 second quarter results explicitly identify Sharon among its development sites. The company reports Sharon zoning and land development approvals. Reported land use approval is limited to that company account. Environmental permit applications are still described as progressing. Company decommissioning of United States Bitcoin mining operations is separate from future HPC construction, customer leases and commissioned HPC service. Neither equipment delivery to another site nor aggregate legacy revenues establishes operation of this HPC proposal. Existing identity, crypto classification, roles and quantities remain unchanged.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-first-quarter-2026-results", "host": "ir.keelinfra.com", "published": "2026-05-11", "date": "2026-05-11", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-second-quarter-2026-results", "host": "ir.keelinfra.com", "published": "2026-08-10", "date": "2026-08-10", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Sharon · Mercer · Source context reviewed", "status_scope": "Keel August 10, 2026 second quarter results explicitly identify Sharon among its development sites. The company reports Sharon zoning and land development approvals. Reported land use approval is limited to that company account. Environmental permit applications are still described as progressing. Company decommissioning of United States Bitcoin mining operations is separate from future HPC construction, customer leases and commissioned HPC service. Neither equipment delivery to another site nor aggregate legacy revenues establishes operation of this HPC proposal. Existing identity, crypto classification, roles and quantities remain unchanged.", "event_evidence": [ { "date": "2026-08-10", "text": "Keel published its second quarter development update August 10, 2026, reporting Sharon land use approvals and separately discussing mining decommissioning and future HPC construction. The publication does not supply an exact approval day or HPC commissioning date.", "kind": "announced", "sources": [ { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-second-quarter-2026-results", "host": "ir.keelinfra.com", "published": "2026-08-10", "date": "2026-08-10", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42085" } }, { "id": "blakely-borough-data-center-lackawanna-pa", "state": "pa", "kind": "facility", "name": "Blakely Borough Data Center", "group": "stopped", "status": "Reported rezoning application withdrawn", "raw_status": "stopped", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lackawanna" ], "city": "Blakely", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Proposed land clearing/storage remained disputed; withdrawal does not resolve legality of other uses or imply all activity ceased. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://fox56.com/news/local/blakely-borough-data-center-plans-scrapped-amid-community-pushback-borough-responds", "host": "fox56.com", "date": "2025-09-15", "published": "2025-09-15", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 41.40865, "lng": -75.60683, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "WOLF reports Blakely rezoning application withdrawal and cancelled hearing; developer said data center no longer moving ahead.", "independently_verified_current_operating_status": null }, "notes": [ "Proposed land clearing/storage remained disputed; withdrawal does not resolve legality of other uses or imply all activity ceased.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://fox56.com/news/local/blakely-borough-data-center-plans-scrapped-amid-community-pushback-borough-responds", "host": "fox56.com", "date": "2025-09-15", "published": "2025-09-15", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-F1-label-review-2026-10-20", "scope": "WOLF reports withdrawal of the Blakely Borough rezoning application in September 2025 and reproduces the developer's statement that the data center project is not moving forward. The separate dispute about other site work and storage is not a completed data center or a resolved legal outcome.", "fields": { "identity_label_context": { "previous_name": "Blakely Borough Data Center (withdrawn)", "plain_name": "Blakely Borough Data Center", "interpretation": "WOLF reports withdrawal of the Blakely Borough rezoning application in September 2025 and reproduces the developer's statement that the data center project is not moving forward. The separate dispute about other site work and storage is not a completed data center or a resolved legal outcome.", "outcome_wording_is_not_identity": true }, "current_stage_evidence": { "outcome": "reported_rezoning_application_withdrawn", "scope": "WOLF reports withdrawal of the Blakely Borough rezoning application in September 2025 and reproduces the developer's statement that the data center project is not moving forward. The separate dispute about other site work and storage is not a completed data center or a resolved legal outcome." } }, "notes": [ "WOLF reports withdrawal of the Blakely Borough rezoning application in September 2025 and reproduces the developer's statement that the data center project is not moving forward. The separate dispute about other site work and storage is not a completed data center or a resolved legal outcome.", "Inherited inventory name: Blakely Borough Data Center (withdrawn). The wording is retained as provenance, not as an independently verified outcome.", "An application decision is separate from a current physical stage. No coordinate, address, parcel, company role, technical figure or physical milestone date is changed." ], "sources": [ { "url": "https://fox56.com/news/local/blakely-borough-data-center-plans-scrapped-amid-community-pushback-borough-responds", "host": "fox56.com", "published": "2025-09-15", "date": "2025-09-15", "checked": "2026-10-20", "label": "WOLF" } ], "checked": "2026-10-20", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Blakely · Lackawanna · Source context reviewed", "status_scope": "WOLF reports withdrawal of the Blakely Borough rezoning application in September 2025 and reproduces the developer's statement that the data center project is not moving forward. The separate dispute about other site work and storage is not a completed data center or a resolved legal outcome.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42069" } }, { "id": "pennsylvania-glacial-till-caughbaugh-road-tobyhanna-monroe-pa", "state": "pa", "kind": "facility", "name": "Caughbaugh Road Data Center (Pennsylvania Glacial Till site)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Monroe" ], "city": "", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Overlay adoption is not all construction/environmental permits; the developer counsel acknowledged more reviews. Proposed closed-loop cooling and described noise limits are not measured operation. No 2026 opening, IT MW or new building count inferred, and the generic legal duty to allow DCs is not adopted as independent legal analysis. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://fox56.com/news/local/tobyhanna-township-approves-second-data-center-zoning-overlay", "host": "fox56.com", "date": "2025-12-15", "published": "2025-12-15", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.07299, "lng": -75.35572, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round30-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "WOLF reports a December 15 Tobyhanna overlay vote for the Pennsylvania Glacial Till property along Caughbaugh Road, separate from the December 11 Pocono Manor ordinance.", "independently_verified_current_operating_status": null }, "notes": [ "Overlay adoption is not all construction/environmental permits; the developer counsel acknowledged more reviews. Proposed closed-loop cooling and described noise limits are not measured operation. No 2026 opening, IT MW or new building count inferred, and the generic legal duty to allow DCs is not adopted as independent legal analysis.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://fox56.com/news/local/tobyhanna-township-approves-second-data-center-zoning-overlay", "host": "fox56.com", "date": "2025-12-15", "published": "2025-12-15", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "The DEP snapshot contains a different unnamed Pocono Manor Investors proposal in Tobyhanna. No exact applicant or parcel crosswalk to Pennsylvania Glacial Till and Caughbaugh Road was established. Local proximity does not establish identity or current physical stage. No identity, jurisdiction, provider role, status or location change is adopted.", "fields": { "current_stage_evidence": { "outcome": "combined_or_different_project_row_or_current_legal_outcome_held", "scope": "The DEP snapshot contains a different unnamed Pocono Manor Investors proposal in Tobyhanna. No exact applicant or parcel crosswalk to Pennsylvania Glacial Till and Caughbaugh Road was established. Local proximity does not establish identity or current physical stage. No identity, jurisdiction, provider role, status or location change is adopted." } }, "notes": [ "The DEP snapshot contains a different unnamed Pocono Manor Investors proposal in Tobyhanna. No exact applicant or parcel crosswalk to Pennsylvania Glacial Till and Caughbaugh Road was established. Local proximity does not establish identity or current physical stage. No identity, jurisdiction, provider role, status or location change is adopted.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Monroe · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42089" } }, { "id": "air-products-cetronia-road-upper-macungie-pa", "state": "pa", "kind": "facility", "name": "Cetronia Road Data Center (former Air Products site)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lehigh" ], "city": "Trexlertown", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.. LehighValleyNews originalNov12/13,2025report:AirProducts194acformerHQproposal2.6Msf,applicationstillprocessed/notpublicthen. Originalwarehouse2023approvalnotDCpermit.22.2Mtaxassessedvalue notsaleprice/capex. Generic500000homescomparisonnotmeasuredsiteMW. Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations. WFMZMay27,2026hearingreportnames7300Cetronia/3buildings,denialofcontinuance andsimilar-use relief. OralhearingdenialdistinctfromwrittenJulydecision;45daywrittendecision/30dayappealreportedprocedure,notindependentlegaldeadlinecalculation. NoactualMWwaterorpermitcertification. Aug12,2026LehighValleyPublicMediaquotesAirProductsspokesman:companydidnotappeal,andhasnofuturepropertyuse/ownershipdecisiontoannounce. ReportedAug5appealdeadline,notcomputedlegaladvice;writtenJulydecisionafterMay27hearing.194ac2.6MsfDCproposalabandoned,notdemolitionofoperatingcampus. PrologisdealwasearlierWAREHOUSEplanandneverclosed,notDCoperator.95000gpd/930cars19truckstrafficwereSTUDYPROJECTIONSnotmeasureduse;23.2Massessmentnotcapex.22.2Moldassessmentdifferentdate.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.lehighvalleynews.com/business/giant-data-center-proposal-in-upper-macungie-township-is-in-the-works", "host": "lehighvalleynews.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.wfmz.com/news/area/lehighvalley/lehigh-county/western-lehigh-county/upper-macungie-zoners-reject-appeal-for-massive-data-center-campus-on-former-air-products-site/article_c531b72e-e928-4562-bcbf-3dbc7e9ce3e8.html", "host": "wfmz.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.lehighvalleypublicmedia.org/news/all/air-products-abandons-plan-for-data-center-at-former-upper-macungie-headquarters/", "host": "lehighvalleypublicmedia.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.61264, "lng": -75.59243, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "LehighValleyNews originalNov12/13,2025report:AirProducts194acformerHQproposal2.6Msf,applicationstillprocessed/notpublicthen. Originalwarehouse2023approvalnotDCpermit.22.2Mtaxassessedvalue notsaleprice/capex. Generic500000homescomparisonnotmeasuredsiteMW." }, "notes": [ "LehighValleyNews originalNov12/13,2025report:AirProducts194acformerHQproposal2.6Msf,applicationstillprocessed/notpublicthen. Originalwarehouse2023approvalnotDCpermit.22.2Mtaxassessedvalue notsaleprice/capex. Generic500000homescomparisonnotmeasuredsiteMW.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.lehighvalleynews.com/business/giant-data-center-proposal-in-upper-macungie-township-is-in-the-works", "host": "lehighvalleynews.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "WFMZMay27,2026hearingreportnames7300Cetronia/3buildings,denialofcontinuance andsimilar-use relief. OralhearingdenialdistinctfromwrittenJulydecision;45daywrittendecision/30dayappealreportedprocedure,notindependentlegaldeadlinecalculation. NoactualMWwaterorpermitcertification." }, "notes": [ "WFMZMay27,2026hearingreportnames7300Cetronia/3buildings,denialofcontinuance andsimilar-use relief. OralhearingdenialdistinctfromwrittenJulydecision;45daywrittendecision/30dayappealreportedprocedure,notindependentlegaldeadlinecalculation. NoactualMWwaterorpermitcertification.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.wfmz.com/news/area/lehighvalley/lehigh-county/western-lehigh-county/upper-macungie-zoners-reject-appeal-for-massive-data-center-campus-on-former-air-products-site/article_c531b72e-e928-4562-bcbf-3dbc7e9ce3e8.html", "host": "wfmz.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-outcome-and-source-scope-review-round48-2026-10-14.json", "scope": "Datedoriginalreporting/participantrepublicationcontext,notindependentlyverifiedsignedlaw/currentoperationorcriticalIT.", "fields": { "dated_reported_context": "Aug12,2026LehighValleyPublicMediaquotesAirProductsspokesman:companydidnotappeal,andhasnofuturepropertyuse/ownershipdecisiontoannounce. ReportedAug5appealdeadline,notcomputedlegaladvice;writtenJulydecisionafterMay27hearing.194ac2.6MsfDCproposalabandoned,notdemolitionofoperatingcampus. PrologisdealwasearlierWAREHOUSEplanandneverclosed,notDCoperator.95000gpd/930cars19truckstrafficwereSTUDYPROJECTIONSnotmeasureduse;23.2Massessmentnotcapex.22.2Moldassessmentdifferentdate." }, "notes": [ "Aug12,2026LehighValleyPublicMediaquotesAirProductsspokesman:companydidnotappeal,andhasnofuturepropertyuse/ownershipdecisiontoannounce. ReportedAug5appealdeadline,notcomputedlegaladvice;writtenJulydecisionafterMay27hearing.194ac2.6MsfDCproposalabandoned,notdemolitionofoperatingcampus. PrologisdealwasearlierWAREHOUSEplanandneverclosed,notDCoperator.95000gpd/930cars19truckstrafficwereSTUDYPROJECTIONSnotmeasureduse;23.2Massessmentnotcapex.22.2Moldassessmentdifferentdate.", "Consultrecordidentity,scope,date,power/waterandclaimed-versus-observedlimitations." ], "sources": [ { "url": "https://www.lehighvalleypublicmedia.org/news/all/air-products-abandons-plan-for-data-center-at-former-upper-macungie-headquarters/", "host": "lehighvalleypublicmedia.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Trexlertown · Lehigh · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42077" } }, { "id": "coreweave-lancaster-pa", "state": "pa", "kind": "facility", "name": "CoreWeave Lancaster Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lancaster" ], "city": "Lancaster", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. LancasterAIHub CBA summary andconditionalcommunity commitments. Officialsummary not fullsignedCBAor actualpayments. Twofunds10Meach not10Mperbuilding. Clean-energyrequirement expresslyallows lowerpercentlongtermcontracts with significantfundcontributions, not unqualified100percentrenewable.20kgpd is percampus cap, not measuredtotalwithdrawal. LocalnoLERTA not allstate/federalincentives. No newsiteMWoropening. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.cityoflancasterpa.gov/wp-content/uploads/2025/11/Community-Benefits-Agreement-Summary-1-1.pdf", "host": "cityoflancasterpa.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.cityoflancasterpa.gov/data-center/", "host": "www.cityoflancasterpa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.04271, "lng": -76.24791, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "LancasterAIHub CBA summary andconditionalcommunity commitments", "fields": { "described_water_cap_gallons_per_day_per_campus": 20000, "described_community_funds": 2, "described_contribution_usd_each_fund": 10000000, "payment_milestones": "construction financing andwithin30days ofoperations,phasedperbuilding", "city_tax_breaks_description": "ChirisaTechnologyParks affiliates not receivingCityofLancastertaxbreaks includingLERTA" }, "notes": [ "Officialsummary not fullsignedCBAor actualpayments. Twofunds10Meach not10Mperbuilding. Clean-energyrequirement expresslyallows lowerpercentlongtermcontracts with significantfundcontributions, not unqualified100percentrenewable.20kgpd is percampus cap, not measuredtotalwithdrawal. LocalnoLERTA not allstate/federalincentives. No newsiteMWoropening.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.cityoflancasterpa.gov/wp-content/uploads/2025/11/Community-Benefits-Agreement-Summary-1-1.pdf", "host": "cityoflancasterpa.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 27", "scope": "The City current information page describes two Chirisa data center developments and publishes a summary of proposed community benefit commitments. A commitment to design, construct, monitor, pay or operate is not proof of actual compliance, payment, completed construction or service. This overview and summary do not independently resolve current operation of the exact inherited CoreWeave component, and the second campus is not merged with the initial tenant component. No precise construction or opening day, physical capacity, provider role or measured environmental outcome is promoted.", "fields": { "current_stage_evidence": { "outcome": "city_development_overview_and_benefit_commitments_not_exact_component_operation", "scope": "The City current information page describes two Chirisa data center developments and publishes a summary of proposed community benefit commitments. A commitment to design, construct, monitor, pay or operate is not proof of actual compliance, payment, completed construction or service. This overview and summary do not independently resolve current operation of the exact inherited CoreWeave component, and the second campus is not merged with the initial tenant component. No precise construction or opening day, physical capacity, provider role or measured environmental outcome is promoted." } }, "notes": [ "The City current information page describes two Chirisa data center developments and publishes a summary of proposed community benefit commitments. A commitment to design, construct, monitor, pay or operate is not proof of actual compliance, payment, completed construction or service. This overview and summary do not independently resolve current operation of the exact inherited CoreWeave component, and the second campus is not merged with the initial tenant component. No precise construction or opening day, physical capacity, provider role or measured environmental outcome is promoted.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://www.cityoflancasterpa.gov/data-center/", "host": "www.cityoflancasterpa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.cityoflancasterpa.gov/wp-content/uploads/2025/11/Community-Benefits-Agreement-Summary-1-1.pdf", "host": "www.cityoflancasterpa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lancaster · Lancaster · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42071" } }, { "id": "databank-pit1-pittsburgh-pa", "state": "pa", "kind": "facility", "name": "DataBank PIT1 (Downtown Pittsburgh)", "group": "operating", "status": "Operator-listed service", "raw_status": "partly operating", "status_field": "current_status", "crypto": false, "type": "Colocation", "counties": [ "Allegheny" ], "city": "Pittsburgh", "address": "100 S Commons #126 - Pittsburgh, PA 15212", "who": "DataBank", "end_user": "", "mw": null, "power": "", "power_note": "Operator-listed Critical IT Load for this facility code. The technical as-of date is not published. Advertised/design capacity does not establish current consumption, utilization or all phases energized.", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. 6.9MW market total covers both sites; notPIT1. Operator separates downtownPIT1 fromPIT2SummitPark. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.databank.com/data-centers/pittsburgh/", "host": "databank.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.databank.com/data-centers/pittsburgh/100-south-commons/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" }, { "url": "https://www.databank.com/data-centers/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=100+S+Commons%2C+Pittsburgh%2C+PA+15212&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://storage.pardot.com/1103952/1786640666ywwiNAFn/PIT1_datasheet.pdf", "host": "storage.pardot.com", "published": "", "date": "", "checked": "2026-10-22", "label": "DataBank current facility datasheet, page 1 address" }, { "url": "https://go.databank.com/l/1103952/2026-02-18/8z657g/1103952/1771463713YgAP5MqN/PIT1_datasheet.pdf", "host": "go.databank.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official datasheet PDF embed wrapper" } ], "loc": { "lat": 40.450159574533, "lng": -80.006042651633, "precision": "address", "basis": "Published DataBank facility datasheet address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite or property ownership finding." }, "reviewed_evidence": [ { "overlay": "field-verification-2026-10-14.json", "scope": "Field or source context only", "fields": { "street": "100 S Commons #126", "city": "Pittsburgh", "critical_it_capacity_mw": 1.9, "it_area_sqft": 30760 }, "notes": [ "6.9MW market total covers both sites; notPIT1.", "Operator separates downtownPIT1 fromPIT2SummitPark.", "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.databank.com/data-centers/pittsburgh/", "host": "databank.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "S4-DataBank-Existing-Depth-20261016", "scope": "Targeted existing-record DataBank code/service or project-stage, published-address and typed IT-capacity review. No admission, geocoding, physical-site certification or legal ownership finding.", "fields": { "operator_facility_code": "PIT1", "record_association_scope": "Existing research record associated by its DataBank facility code, state and named locality with the current operator page. The address is published service context, not independent parcel, municipal, ownership or physical-building identity verification.", "published_location_address": { "address": "100 S Commons #126 - Pittsburgh, PA 15212", "scope": "Operator location heading as printed, including suite and postal text. No geocoding or point movement." }, "published_technical_specs": { "IT Square Feet": "30,760", "Critical IT Load": "1.9MW", "Power Design": "2N", "Cooling Design": "N+1", "Cab Density Air": "10kW+" }, "technical_capacity_scope": "Critical IT Load is the named-code operator-listed capacity, not utility service, backup generation, current metered use or proof every advertised MW is energized. The page does not establish a technical as-of date. Floor area is labeled IT Square Feet, not gross building area; power/cooling designs and cabinet densities are descriptions, not water use or total IT demand.", "metro_campus_scope": "Metro/campus headline totals and future expansion envelopes are not assigned to this code or added to its capacity. Published street and postal locality do not independently resolve legal jurisdiction. SLA, certification and renewable-energy marketing are not verified operational outcomes.", "current_status_basis": "Current operator-listed PIT1 colocation service component, supported by its named facility page and current metro listing. The observation does not certify complete campus buildout, all advertised capacity energized, current availability, ownership or an exact opening day." }, "notes": [ "Partial field review only. Original name, point/precision, city/county/jurisdiction, opening field and legacy MW/financial values remain unchanged.", "Capacity is operator-listed Critical IT Load, not metered consumption or a utility/generator figure. No sum across overlapping code, campus or expansion envelopes is asserted." ], "sources": [ { "url": "https://www.databank.com/data-centers/pittsburgh/100-south-commons/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" }, { "url": "https://www.databank.com/data-centers/pittsburgh/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" }, { "url": "https://www.databank.com/data-centers/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" } ], "checked": "2026-10-16", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 3, October 22, 2026", "scope": "Published operator street reference only. No status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 40.450159574533, "lng": -80.006042651633, "precision": "address", "basis": "Published DataBank facility datasheet address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "100 S Commons #126 - Pittsburgh, PA 15212", "county_fips": [ "42003" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The official facility page links the retained PDF through its public PDF embed. The datasheet names the existing facility code and service address. Only address presentation punctuation is normalized for comparison; the canonical address remains unchanged.", "The datasheet version is retained as printed. No exact publication day is inferred from its quarter or version. Capacity, technical figures, source photographs and certifications are not adopted in this location review.", "Floors and suites remain address context. The Census reference is not a building, parcel boundary, legal title or exclusive occupancy finding. The response county and retained Census county geometry agree." ], "sources": [ { "url": "https://www.databank.com/data-centers/pittsburgh/100-south-commons/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-22", "label": "DataBank official facility page and datasheet link" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=100+S+Commons%2C+Pittsburgh%2C+PA+15212&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://storage.pardot.com/1103952/1786640666ywwiNAFn/PIT1_datasheet.pdf", "host": "storage.pardot.com", "published": "", "date": "", "checked": "2026-10-22", "label": "DataBank current facility datasheet, page 1 address" }, { "url": "https://go.databank.com/l/1103952/2026-02-18/8z657g/1103952/1771463713YgAP5MqN/PIT1_datasheet.pdf", "host": "go.databank.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Official datasheet PDF embed wrapper" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 33, October 23, 2026", "scope": "DataBank identifies the same named PIT1 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown.", "fields": { "company_association": { "name": "DataBank", "role": "operator", "identity_scope": "provider_brand_only", "scope": "DataBank identifies the same named PIT1 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." }, "provider_role": "operator" }, "notes": [ "DataBank identifies the same named PIT1 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." ], "sources": [ { "url": "https://www.databank.com/data-centers/pittsburgh/100-south-commons/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Pittsburgh · Allegheny · Source context reviewed", "status_scope": "Current operator-listed PIT1 colocation service component, supported by its named facility page and current metro listing. The observation does not certify complete campus buildout, all advertised capacity energized, current availability, ownership or an exact opening day.", "typed_power_facts": [ { "measure": "it_capacity", "value": 1.9, "unit": "MW", "as_of": null, "as_of_basis": "not_published", "observed_on": "2026-10-16", "basis": "operator_reported_capacity", "scope": "Current named-code operator-listed Critical IT Load, not utility capacity, backup generation or measured consumption. Technical as-of date and energized/occupied share are not published.", "sources": [ "https://www.databank.com/data-centers/pittsburgh/100-south-commons/" ] } ] }, { "id": "databank-pit2-summit-park-pittsburgh-pa", "state": "pa", "kind": "facility", "name": "DataBank PIT2 (Summit Park)", "group": "operating", "status": "Operator-listed service", "raw_status": "partly operating", "status_field": "current_status", "crypto": false, "type": "Colocation", "counties": [ "Allegheny" ], "city": "Pittsburgh", "address": "35 Summit Park Dr - Pittsburgh, PA 15275", "who": "DataBank", "end_user": "", "mw": null, "power": "", "power_note": "Operator-listed Critical IT Load for this facility code. The technical as-of date is not published. Advertised/design capacity does not establish current consumption, utilization or all phases energized.", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Catalog marketing establishes identity/specification; independently verify actual commissioning date and utilization. Current operator card explicitly names this facility and separates its specification from the market/campus totals. Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.databank.com/data-centers/pittsburgh/", "host": "databank.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.databank.com/data-centers/pittsburgh/summit-park-campus/summit-park/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" }, { "url": "https://www.databank.com/data-centers/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" }, { "url": "https://mapservices.pasda.psu.edu/server/rest/services/pasda/AlleghenyCounty/MapServer/25/query?where=PIN%3D%270497B00001000000%27&outFields=OBJECTID%2CPIN%2CMAPBLOCKLO%2CMUNICODE%2CPSEUDONO&returnGeometry=true&outSR=4326&resultRecordCount=25&f=json", "host": "mapservices.pasda.psu.edu", "published": "", "date": "", "checked": "2026-10-23", "label": "One exact public county or assessor reference parcel" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-80.19510178905163%2C40.44874591088753%2C-80.18683821094835%2C40.455034089112466&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting only, acquisition date unknown" }, { "url": "https://mapservices.pasda.psu.edu/server/rest/services/pasda/AlleghenyCounty/MapServer/25?f=pjson", "host": "mapservices.pasda.psu.edu", "published": "", "date": "", "checked": "2026-10-23", "label": "Official reference parcel field definitions and attribution" }, { "url": "https://mapservices.pasda.psu.edu/server/rest/services/pasda/AlleghenyCounty/MapServer/32/query?where=ADDR_NUM%3D%2735%27+AND+UPPER%28ST_NAME%29+LIKE+%27%25SUMMIT%25PARK%25%27&outFields=OBJECTID%2CADDRESS_ID%2CSTATUS%2CADDR_NUM%2CST_NAME%2CST_TYPE%2CFULL_ADDRE%2CMUNICIPALI%2CCOUNTY%2CSTATE%2CZIP_CODE%2CPARCELID%2CUNIT%2CFLOOR&returnGeometry=true&outSR=4326&resultRecordCount=25&f=json", "host": "mapservices.pasda.psu.edu", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact active county address point with matching parcel ID" }, { "url": "https://mapservices.pasda.psu.edu/server/rest/services/pasda/AlleghenyCounty/MapServer/32?f=pjson", "host": "mapservices.pasda.psu.edu", "published": "", "date": "", "checked": "2026-10-23", "label": "County address layer fields and distribution metadata" }, { "url": "https://www.alleghenycounty.us/Government/Department-Directory/Information-Technology/Address-Management", "host": "www.alleghenycounty.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Official dataset method, address or reference limitations" } ], "loc": { "lng": -80.19097, "lat": 40.45189, "precision": "approximate", "basis": "Approximate reference parcel center for DataBank service address 35 Summit Park Dr, Pittsburgh, PA 15275. Official reference 0497B00001000000 only, not a roof, surveyed title, tenant unit or full campus. Aerial acquisition date is unknown and may predate construction. Existing native status remains operating." }, "reviewed_evidence": [ { "overlay": "field-verification-2026-10-14.json", "scope": "Field or source context only", "fields": { "facility_code": "PIT2", "street": "35 SummitParkDr", "city": "Pittsburgh", "critical_it_capacity_mw": 5, "it_area_sqft": 47100, "power_basis": "operator advertised criticalIT specification, not measured consumption", "marketed_service": "colocation" }, "notes": [ "Catalog marketing establishes identity/specification; independently verify actual commissioning date and utilization.", "Current operator card explicitly names this facility and separates its specification from the market/campus totals.", "Only the listed fields were checked; imported geography, current operation, capacity and incentives require their own evidence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.databank.com/data-centers/pittsburgh/", "host": "databank.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.databank.com/data-centers/pittsburgh/", "host": "databank.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "S4-DataBank-Existing-Depth-20261016", "scope": "Targeted existing-record DataBank code/service or project-stage, published-address and typed IT-capacity review. No admission, geocoding, physical-site certification or legal ownership finding.", "fields": { "operator_facility_code": "PIT2", "record_association_scope": "Existing research record associated by its DataBank facility code, state and named locality with the current operator page. The address is published service context, not independent parcel, municipal, ownership or physical-building identity verification.", "published_location_address": { "address": "35 Summit Park Dr - Pittsburgh, PA 15275", "scope": "Operator location heading as printed, including suite and postal text. No geocoding or point movement." }, "published_technical_specs": { "IT Square Feet": "47,100", "Critical IT Load": "5MW", "Power Design": "N+1", "Cooling Design": "N+1", "Cab Density Air": "10kW+" }, "technical_capacity_scope": "Critical IT Load is the named-code operator-listed capacity, not utility service, backup generation, current metered use or proof every advertised MW is energized. The page does not establish a technical as-of date. Floor area is labeled IT Square Feet, not gross building area; power/cooling designs and cabinet densities are descriptions, not water use or total IT demand.", "metro_campus_scope": "Metro/campus headline totals and future expansion envelopes are not assigned to this code or added to its capacity. Published street and postal locality do not independently resolve legal jurisdiction. SLA, certification and renewable-energy marketing are not verified operational outcomes.", "current_status_basis": "Current operator-listed PIT2 colocation service component, supported by its named facility page and current metro listing. The observation does not certify complete campus buildout, all advertised capacity energized, current availability, ownership or an exact opening day." }, "notes": [ "Partial field review only. Original name, point/precision, city/county/jurisdiction, opening field and legacy MW/financial values remain unchanged.", "Capacity is operator-listed Critical IT Load, not metered consumption or a utility/generator figure. No sum across overlapping code, campus or expansion envelopes is asserted." ], "sources": [ { "url": "https://www.databank.com/data-centers/pittsburgh/summit-park-campus/summit-park/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" }, { "url": "https://www.databank.com/data-centers/pittsburgh/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" }, { "url": "https://www.databank.com/data-centers/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-16", "label": "DataBank current facility or company statement" } ], "checked": "2026-10-16", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 27, October 23, 2026", "scope": "Approximate remains approximate. One bounded official reference parcel only. Existing native status remains operating.", "fields": { "location_review_decision": { "location": { "lng": -80.19097, "lat": 40.45189, "precision": "approximate", "basis": "Approximate reference parcel center for DataBank service address 35 Summit Park Dr, Pittsburgh, PA 15275. Official reference 0497B00001000000 only, not a roof, surveyed title, tenant unit or full campus. Aerial acquisition date is unknown and may predate construction. Existing native status remains operating." }, "reference_method": "Approximate county reference parcel center", "reference_parcel": { "identifier": "0497B00001000000", "identifier_field": "PIN", "objectid": 18835, "agency": "Allegheny County GIS and Address Management, distributed by Pennsylvania Spatial Data Access at Penn State", "reference_method": "calculated_polygon_centroid", "not_survey_quality": true, "legal_title_verified": false, "independent_building_identity": false, "full_campus_verified": false, "operator_ownership_verified": false, "official_address_feature_sha256": "0b21cba14f07a005d2b31e5e785c08998b5141136bbf51bd81ba18ee927c21ca" }, "operator_coordinates_adopted": false, "census_range_adopted": false } }, "notes": [ "This is one explicitly reviewed approximate tax or fee reference parcel, not a surveyed roof, legal title, property ownership, tenant unit, independent building or complete campus boundary.", "All original identity, native status, physical dates, quantities, roles, canonical address and jurisdiction wrappers remain exact. No current operation, construction, technical quantity or physical milestone is adopted from the location evidence.", "Official aerial setting was actually viewed. Acquisition date is unknown and may predate construction. No residential roof is selected. Raw parcel geometry is not exported.", "The current named PIT2 Summit Park section gives 35 Summit Park Drive, Pittsburgh PA 15275. County address SSAP262722 gives the same numeric street in North Fayette Township, ZIP 15275 and parcel ID 0497B00001000000. The matching polygon is map block lot 497-B-1. The address point lies inside it. ACTIVE is the address record status, not facility operation. Pittsburgh is retained as the operator marketed postal context; no municipality or jurisdiction is changed. The county distinguishes physical location from owner mailing and tax bill addresses, and local municipalities assign or correct situs addresses.", "The inherited Compute Atlas point is an unreviewed general area, not an earlier accepted parcel or service street. The current named PIT2 Summit Park section gives 35 Summit Park Drive. The exact official county address SSAP262722 and parcel PIN 0497B00001000000 share the same physical situs, with the address point inside its parcel. The mathematical reference center is inside that polygon and retained Allegheny County, 2037.6 metres from the inherited point. Viewed imagery shows a commercial or industrial campus and acquisition date is unknown. No independent building, complete campus, legal title or current operation is certified." ], "sources": [ { "url": "https://www.databank.com/data-centers/pittsburgh/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Current named operator service address section" }, { "url": "https://mapservices.pasda.psu.edu/server/rest/services/pasda/AlleghenyCounty/MapServer/25/query?where=PIN%3D%270497B00001000000%27&outFields=OBJECTID%2CPIN%2CMAPBLOCKLO%2CMUNICODE%2CPSEUDONO&returnGeometry=true&outSR=4326&resultRecordCount=25&f=json", "host": "mapservices.pasda.psu.edu", "published": "", "date": "", "checked": "2026-10-23", "label": "One exact public county or assessor reference parcel" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-80.19510178905163%2C40.44874591088753%2C-80.18683821094835%2C40.455034089112466&bboxSR=4326&imageSR=3857&size=1000%2C1000&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting only, acquisition date unknown" }, { "url": "https://mapservices.pasda.psu.edu/server/rest/services/pasda/AlleghenyCounty/MapServer/25?f=pjson", "host": "mapservices.pasda.psu.edu", "published": "", "date": "", "checked": "2026-10-23", "label": "Official reference parcel field definitions and attribution" }, { "url": "https://mapservices.pasda.psu.edu/server/rest/services/pasda/AlleghenyCounty/MapServer/32/query?where=ADDR_NUM%3D%2735%27+AND+UPPER%28ST_NAME%29+LIKE+%27%25SUMMIT%25PARK%25%27&outFields=OBJECTID%2CADDRESS_ID%2CSTATUS%2CADDR_NUM%2CST_NAME%2CST_TYPE%2CFULL_ADDRE%2CMUNICIPALI%2CCOUNTY%2CSTATE%2CZIP_CODE%2CPARCELID%2CUNIT%2CFLOOR&returnGeometry=true&outSR=4326&resultRecordCount=25&f=json", "host": "mapservices.pasda.psu.edu", "published": "", "date": "", "checked": "2026-10-23", "label": "Exact active county address point with matching parcel ID" }, { "url": "https://mapservices.pasda.psu.edu/server/rest/services/pasda/AlleghenyCounty/MapServer/32?f=pjson", "host": "mapservices.pasda.psu.edu", "published": "", "date": "", "checked": "2026-10-23", "label": "County address layer fields and distribution metadata" }, { "url": "https://www.alleghenycounty.us/Government/Department-Directory/Information-Technology/Address-Management", "host": "www.alleghenycounty.us", "published": "", "date": "", "checked": "2026-10-23", "label": "Official dataset method, address or reference limitations" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Company role source check 33, October 23, 2026", "scope": "DataBank identifies the same named PIT2 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown.", "fields": { "company_association": { "name": "DataBank", "role": "operator", "identity_scope": "provider_brand_only", "scope": "DataBank identifies the same named PIT2 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." }, "provider_role": "operator" }, "notes": [ "DataBank identifies the same named PIT2 facility and street in its current first party location page and advertises its own colocation or interconnection services there. Operator per source records the advertised DataBank provider brand relationship. Marketing statements and old expansion videos do not independently establish current computing, commissioning, completion of every expansion, performance or whole campus operation. Legal title, sole control, tenant identity and a distinct corporate entity are not established. Existing status, location, address, county, quantities, dates, certification and component identity remain exact. The source publication date is unknown." ], "sources": [ { "url": "https://www.databank.com/data-centers/pittsburgh/summit-park-campus/summit-park/", "host": "www.databank.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Approximate reference parcel, not a surveyed building or full campus", "summary": "Pittsburgh · Allegheny · Source context reviewed", "status_scope": "Current operator-listed PIT2 colocation service component, supported by its named facility page and current metro listing. The observation does not certify complete campus buildout, all advertised capacity energized, current availability, ownership or an exact opening day.", "typed_power_facts": [ { "measure": "it_capacity", "value": 5, "unit": "MW", "as_of": null, "as_of_basis": "not_published", "observed_on": "2026-10-16", "basis": "operator_reported_capacity", "scope": "Current named-code operator-listed Critical IT Load, not utility capacity, backup generation or measured consumption. Technical as-of date and energized/occupied share are not published.", "sources": [ "https://www.databank.com/data-centers/pittsburgh/summit-park-campus/summit-park/" ] } ] }, { "id": "expedient-pit1-green-tree-pittsburgh-south-pa", "state": "pa", "kind": "facility", "name": "Expedient PIT1 (Green Tree / Pittsburgh South)", "group": "operating", "status": "Operating", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Allegheny" ], "city": "Pittsburgh", "address": "810 Parish St, Pittsburgh, PA 15220", "who": "Expedient", "end_user": "", "mw": null, "power": "", "power_note": "Operator-advertised PIT1 critical IT technical capacity, not measured consumption. The source calls it Critical IT Load in its facility specifications and gives no technical as-of date. Regional headlines, utility supply and generator capacity remain separate.", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Expedient Pittsburgh regional header and distinct site tables. BoundpreferredIDnamesPIT1,soPIT2is separate contextual site, notPIT1expansion.6MWregional total not each site. Generator3/8MW separate from IT. Exact municipal GreenTree jurisdiction not independently established by Pittsburgh postal label. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.expedient.com/data-centers/pittsburgh/", "host": "expedient.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.expedient.com/uploads/exp__sell_sheet-dc_greentree-1.pdf", "host": "www.expedient.com", "published": "", "date": "", "checked": "2026-10-15", "label": "Reviewed operator source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=810+Parish+St%2C+Pittsburgh%2C+PA+15220&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" } ], "loc": { "lat": 40.427934473708, "lng": -80.042920363923, "precision": "address", "basis": "Published Expedient facility address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite, entire campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "operator-discovery-review-round8-2026-10-14.json", "scope": "Expedient Pittsburgh regional header and distinct site tables", "fields": { "sites": [ { "code": "PIT1", "address": "810 Parish Street, Pittsburgh, PA15220", "critical_it_mw": 1.8, "total_area_sqft": 26000, "raised_floor_sqft": 12000 }, { "code": "PIT2", "address": "100 S Commons, Suite001, Pittsburgh, PA15212", "critical_it_mw": 4.2, "total_area_sqft": 50700, "raised_floor_sqft": 26000 } ], "regional_critical_it_mw": 6 }, "notes": [ "BoundpreferredIDnamesPIT1,soPIT2is separate contextual site, notPIT1expansion.6MWregional total not each site. Generator3/8MW separate from IT. Exact municipal GreenTree jurisdiction not independently established by Pittsburgh postal label.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.expedient.com/data-centers/pittsburgh/", "host": "expedient.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Operator-Jurisdiction-20261015", "scope": "Current operator listing for named PIT1 facility at its published address; current services support operating status, not a dated opening or parcel verification.", "fields": { "facility_designation": "PIT1", "operator_published_address": "810 Parish St, Pittsburgh, PA 15220", "current_status": "operating", "status_basis": "Current operator facility listing, facility-specific services/technical specifications and tour information.", "operator_facility_critical_it_spec_mw": 1.8 }, "notes": [ "Only the named facility is supported. The current operator page is a primary source for its own advertised services, not an independent inspection, parcel survey or legal-ownership verification.", "Source publication and technical as-of dates are not published; the review date does not become an opening or measurement date.", "Published postal/locality names do not certify an incorporated municipality. Original map point and approximate precision remain unchanged.", "The regional 6 MW headline covers PIT1 and PIT2. PIT1 uses only its own 1.8 MW technical specification; PIT2 is not admitted by this review." ], "sources": [ { "url": "https://www.expedient.com/data-centers/pittsburgh/", "host": "www.expedient.com", "published": "", "date": "", "checked": "2026-10-15", "label": "Reviewed operator source" }, { "url": "https://www.expedient.com/uploads/exp__sell_sheet-dc_greentree-1.pdf", "host": "www.expedient.com", "published": "", "date": "", "checked": "2026-10-15", "label": "Reviewed operator source" } ], "checked": "2026-10-15", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 4, October 22, 2026", "scope": "Published operator street reference only. No status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 40.427934473708, "lng": -80.042920363923, "precision": "address", "basis": "Published Expedient facility address matched to one Census street range within the existing record county. Calculated street reference, not a surveyed parcel, roof, suite, entire campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "810 Parish St, Pittsburgh, PA 15220", "county_fips": [ "42003" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The current named operator facility page publishes the reviewed street address. This identifies an address reference for the existing research record, not a legal parcel or exclusive whole building use. Corporate headquarters and operator template coordinates are not used.", "The Census result and retained Census county polygon agree with the existing record county. The current operating status, physical milestones, quantities, company roles and jurisdiction wrappers remain unchanged." ], "sources": [ { "url": "https://www.expedient.com/data-centers/pittsburgh/", "host": "www.expedient.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Current operator facility code and street address" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=810+Parish+St%2C+Pittsburgh%2C+PA+15220&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 19, October 23, 2026", "scope": "Expedient offers colocation and infrastructure service for this exact named facility on its own website. Operator describes the attributed provider brand relationship, not independent verification of the legal operating entity, property ownership or every building and phase. No stage, precise location, street evidence, date, capacity, water, emissions, safety, certifications or compliance is promoted. The Pittsburgh page separately lists PIT1 at 810 Parish Street and PIT2 at South Commons Suite 001. PIT2 and its quantities do not transfer to PIT1, and the market total is not a single building figure.", "fields": { "company_association": { "name": "Expedient", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Expedient offers colocation and infrastructure service for this exact named facility on its own website. Operator describes the attributed provider brand relationship, not independent verification of the legal operating entity, property ownership or every building and phase. No stage, precise location, street evidence, date, capacity, water, emissions, safety, certifications or compliance is promoted. The Pittsburgh page separately lists PIT1 at 810 Parish Street and PIT2 at South Commons Suite 001. PIT2 and its quantities do not transfer to PIT1, and the market total is not a single building figure." }, "provider_role": "operator" }, "notes": [ "Expedient offers colocation and infrastructure service for this exact named facility on its own website. Operator describes the attributed provider brand relationship, not independent verification of the legal operating entity, property ownership or every building and phase. No stage, precise location, street evidence, date, capacity, water, emissions, safety, certifications or compliance is promoted. The Pittsburgh page separately lists PIT1 at 810 Parish Street and PIT2 at South Commons Suite 001. PIT2 and its quantities do not transfer to PIT1, and the market total is not a single building figure.", "First publication dates are not established. Awards, specifications, current retrieval and stated plans are not physical milestones." ], "sources": [ { "url": "https://www.expedient.com/data-centers/pittsburgh/", "host": "www.expedient.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party exact building code and named service text, scoped provider relationship reviewed" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Pittsburgh · Allegheny · Source context reviewed", "typed_power_facts": [ { "measure": "it_capacity", "value": 1.8, "unit": "MW", "as_of": null, "observed_on": "2026-10-15", "as_of_basis": "not_published", "basis": "operator_reported_capacity", "scope": "PIT1 facility-specific advertised critical IT technical specification. The operator labels it Critical IT Load; this is an offered design-capacity specification, not a dated meter reading, utility-service approval or regional total.", "sources": [ "https://www.expedient.com/data-centers/pittsburgh/" ] } ] }, { "id": "flexential-allentown-data-center-abe01-pa", "state": "pa", "kind": "facility", "name": "Flexential Allentown Data Center (ABE01)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lehigh" ], "city": "Allentown", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Historical operator specification sheet; named Allentown facility, no address on these two pages.. Historical brochure remains publicly served; it does not independently verify October 2026 operations, current certification or actual annual PUE. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.flexential.com/system/files/file/2020-02/allentown-data-center-sheet.pdf", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2021-12/Flexential-2021-PCI-DSS-AOC-Cloud-Operations.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=744+Roble+Road%2C+Allentown%2C+Pennsylvania+18109&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-75.46226778340635%2C40.632091288537545%2C-75.44924621659366%2C40.64197271146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "loc": { "lng": -75.455757, "lat": 40.637032, "precision": "address", "basis": "Operator facility documents identify 744 Roble Road, Allentown, Pennsylvania 18109. One complete unique Census street range supports this calculated reference inside Lehigh County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round14-2026-10-14.json", "scope": "Historical operator specification sheet; named Allentown facility, no address on these two pages.", "fields": { "publisher_reported_footprint_sqft": 46800, "publisher_reported_critical_power_mw": 0.849, "original_power_value": { "value": 849, "unit": "kW", "conversion": "849 / 1000 = 0.849 MW" }, "publisher_pue_rating": 1.8, "current_measured_demand_mw": null, "commissioning_date": null }, "notes": [ "Historical brochure remains publicly served; it does not independently verify October 2026 operations, current certification or actual annual PUE.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2020-02/allentown-data-center-sheet.pdf", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 64", "scope": "The complete original Allentown data sheet describes colocation and cloud services, equipment and service commitments. The file path refers to an older archive and the body supplies no independently established publication day or current service confirmation. Current provider access was later denied and the same host roster was skipped. This retains historical service context without certifying present operation, closure, the current provider relationship or a first opening day. Marketing capacity, uptime and compliance descriptions are not measured results.", "fields": { "current_stage_evidence": { "outcome": "original_older_allentown_service_sheet_current_stage_held", "scope": "The complete original Allentown data sheet describes colocation and cloud services, equipment and service commitments. The file path refers to an older archive and the body supplies no independently established publication day or current service confirmation. Current provider access was later denied and the same host roster was skipped. This retains historical service context without certifying present operation, closure, the current provider relationship or a first opening day. Marketing capacity, uptime and compliance descriptions are not measured results." }, "source_read_scope": { "complete_original_datasheet_text_read": true, "source_publication_day_unverified": true, "archive_path_not_current_service_clock": true, "current_provider403_and_roster_skip_retained": true } }, "notes": [ "The complete original Allentown data sheet describes colocation and cloud services, equipment and service commitments. The file path refers to an older archive and the body supplies no independently established publication day or current service confirmation. Current provider access was later denied and the same host roster was skipped. This retains historical service context without certifying present operation, closure, the current provider relationship or a first opening day. Marketing capacity, uptime and compliance descriptions are not measured results.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2020-02/allentown-data-center-sheet.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 64, 2026-10-24", "scope": "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "fields": { "location_review_decision": { "location": { "lng": -75.455757, "lat": 40.637032, "precision": "address", "basis": "Operator facility documents identify 744 Roble Road, Allentown, Pennsylvania 18109. One complete unique Census street range supports this calculated reference inside Lehigh County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "744 Roble Road, Allentown, Pennsylvania 18109", "county_fips": [ "42077" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "The inherited general area coordinate was not an independently reviewed computing street reference. The original operator published computing location documents and complete unique literal Census street evidence support this bounded reference inside the retained county. The measured correction is 213.5 metres. All original source wordings, dates, predecessor coordinates and versions remain retained. Existing status group unknown and every other fact stay unchanged. This is a reference correction without physical relocation, a new operation, selected roof, tenant floor, legal title or complete campus certification.", "Commercial and industrial roofs and parking sit among roads, open land and a larger divided transport route. No particular building, floor or present computing use is selected." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2021-12/Flexential-2021-PCI-DSS-AOC-Cloud-Operations.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=744+Roble+Road%2C+Allentown%2C+Pennsylvania+18109&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-75.46226778340635%2C40.632091288537545%2C-75.44924621659366%2C40.64197271146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Calculated street reference, not a roof or tenant floor", "summary": "Allentown · Lehigh · Source context reviewed" }, { "id": "flexential-philadelphia-collegeville-phl01-pa", "state": "pa", "kind": "facility", "name": "Flexential Philadelphia - Collegeville (PHL01)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Montgomery" ], "city": "Collegeville", "address": "", "who": "Flexential", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.. Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2020-03/2019-type-2-SOC-3-final-report.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=101+Troutman+Road%2C+Collegeville%2C+Pennsylvania+19426&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-75.48115101937074%2C40.146708288537546%2C-75.46822298062926%2C40.15658971146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "loc": { "lng": -75.474687, "lat": 40.151649, "precision": "address", "basis": "Operator facility documents identify 101 Troutman Road, Collegeville, Pennsylvania 19426. One complete unique Census street range supports this calculated reference inside Montgomery County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round14-2026-10-14.json", "scope": "Named facility section; grouped base IDs remain grouped. Undated operator guide captured 2026-10-14.", "fields": { "operator_named_facility": "Flexential Philadelphia - Collegeville (PHL01)", "publisher_reported_footprint_sqft": 203703, "publisher_reported_critical_power_mw": 7.2, "power_basis": "operator critical load UPS capacity; Douglasville sections call it critical power", "current_measured_demand_mw": null, "commissioning_date": null, "exact_address_verified_by_this_document": false }, "notes": [ "Attribute ratings to the operator document. Do not treat as current energized IT load, available capacity, permits, independently verified compliance or observed uptime.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "flexential.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 64, 2026-10-24", "scope": "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "fields": { "location_review_decision": { "location": { "lng": -75.474687, "lat": 40.151649, "precision": "address", "basis": "Operator facility documents identify 101 Troutman Road, Collegeville, Pennsylvania 19426. One complete unique Census street range supports this calculated reference inside Montgomery County. This reference does not select a roof, tenant floor, surveyed parcel or complete campus. Source dates do not establish current operation. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "101 Troutman Road, Collegeville, Pennsylvania 19426", "county_fips": [ "42091" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "Original operator published computing street identity and calculated street reference only. The explicit Las Vegas street set remains approximate. Existing status, other facts and all historical source limitations stay unchanged. No current certification, technical figure, ownership, roof, floor or complete campus is certified.", "The inherited general area coordinate was not an independently reviewed computing street reference. The original operator published computing location documents and complete unique literal Census street evidence support this bounded reference inside the retained county. The measured correction is 257.5 metres. All original source wordings, dates, predecessor coordinates and versions remain retained. Existing status group unknown and every other fact stay unchanged. This is a reference correction without physical relocation, a new operation, selected roof, tenant floor, legal title or complete campus certification.", "A distinct large roof and surrounding roads lie beside broad fields, wooded strips and nearby commercial and residential areas. The source image is contextual and does not certify a roof coordinate, property boundary or current operation." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2024-01/Flexential%20-%202023%20ISO%2027001%20Surveillance%20-%20Certificate_1831866-4.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original issued certificate computing location table, historical street context only" }, { "url": "https://www.flexential.com/system/files/file/2020-03/2019-type-2-SOC-3-final-report.pdf", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original named computing facility list, historical location context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=101+Troutman+Road%2C+Collegeville%2C+Pennsylvania+19426&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete unique literal published street range, raw version retained" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-75.48115101937074%2C40.146708288537546%2C-75.46822298062926%2C40.15658971146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Company role source check65, October24,2026", "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 75 and 76. The Collegeville profile identifies a retained service location in the Philadelphia market. A building numeral in its photograph is not adopted as an address, coordinate or selected property boundary. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted.", "fields": { "company_association": { "name": "Flexential", "role": "operator", "identity_scope": "provider_brand_only", "scope": "Flexential identifies the named location in the original fleet guide, PDF pages 75 and 76. The Collegeville profile identifies a retained service location in the Philadelphia market. A building numeral in its photograph is not adopted as an address, coordinate or selected property boundary. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted." }, "provider_role": "operator" }, "notes": [ "Flexential identifies the named location in the original fleet guide, PDF pages 75 and 76. The Collegeville profile identifies a retained service location in the Philadelphia market. A building numeral in its photograph is not adopted as an address, coordinate or selected property boundary. Only the previously empty provider brand is filled. Existing status, location, address, county, quantities, dates and component identity remain exact. This does not newly admit a location, parcel or roof. Operator per source describes the guide profile only, not a current operating verification. The publication day is unknown; file metadata is not a physical or publication date. No technical, environmental, tenant or ownership claim is adopted." ], "sources": [ { "url": "https://www.flexential.com/system/files/file/2025-11/flexential-fleet-tour-guide-hvc.pdf?t=1775636396", "host": "www.flexential.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Reviewed operator source" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Calculated street reference, not a roof or tenant floor", "summary": "Collegeville · Montgomery · Source context reviewed" }, { "id": "gouldsboro-project-gold-clifton-covington-lackawanna-pa", "state": "pa", "kind": "facility", "name": "Gouldsboro Data Center Campus (Project Gold)", "group": "proposed", "status": "Agency listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lackawanna" ], "city": "Clifton Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Namedoriginalprojectparticipant,issuer,localreporterororiginalcourtcopy; transaction/stage/datescoped.. WVIA KatBolus January3,2026 original report of Cliftonsettlement approvedpreviousFriday describes1778RichPikeLLCProjectGold. SettlementgovernsZONINGonly; land-developmentstudies/approvals remain and solicitor saysitdoesNOTendunderlyingzoninglitigation. Residents' promisedlawsuit isnot filedcase/ruling. Jan2vote date isdated-articleweekdayinference,notoriginalminutesverification. Atleastsevenpropertiesbroaderproject vsTHREECliftonpropertiesinsettlement,390acres+144reportedpropertyscopes notallbuildableDCfootprint. Equitableownership isnotverifieddeedclosing. Fivebuildings/threeCliftonsubcampuses notnewindependentcompanypins.65ftbuilding+15ftequipment=80fttotal limits,85ftwatertanks separate;100ftparcel/400fthomes setbacks proposedconditionsnotasbuilt. 65/55dBAreportedday/night limits are two-decibel reductions from67/57, not2%lessnoise ormeasuredcompliance. No privatewellCOOLING whilewellDRINKINGallowed doesnotmeanzerogroundwater. Offsitewastewater/nuclear-gasabandonmentconditions on southeastcampus notstatewideenergyban. Covingtondifferentjurisdiction; proposedNDAenduserunnamed. Exactexecutedsettlement/currentcourtoutcome unread. Noallfield,currentoperatingbuilding,actualimpact,executedcontractorpaidfundscertification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wvia.org/news/local/2026-01-03/clifton-twp-supervisors-settle-with-data-center-developer-residents-promise-litigation", "host": "wvia.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.46345, "lng": -75.58851, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-original-transactions-and-legal-stage-review-round73-2026-10-15.json", "scope": "Namedoriginalprojectparticipant,issuer,localreporterororiginalcourtcopy; transaction/stage/datescoped.", "fields": {}, "notes": [ "WVIA KatBolus January3,2026 original report of Cliftonsettlement approvedpreviousFriday describes1778RichPikeLLCProjectGold. SettlementgovernsZONINGonly; land-developmentstudies/approvals remain and solicitor saysitdoesNOTendunderlyingzoninglitigation. Residents' promisedlawsuit isnot filedcase/ruling. Jan2vote date isdated-articleweekdayinference,notoriginalminutesverification.", "Atleastsevenpropertiesbroaderproject vsTHREECliftonpropertiesinsettlement,390acres+144reportedpropertyscopes notallbuildableDCfootprint. Equitableownership isnotverifieddeedclosing. Fivebuildings/threeCliftonsubcampuses notnewindependentcompanypins.65ftbuilding+15ftequipment=80fttotal limits,85ftwatertanks separate;100ftparcel/400fthomes setbacks proposedconditionsnotasbuilt.", "65/55dBAreportedday/night limits are two-decibel reductions from67/57, not2%lessnoise ormeasuredcompliance. No privatewellCOOLING whilewellDRINKINGallowed doesnotmeanzerogroundwater. Offsitewastewater/nuclear-gasabandonmentconditions on southeastcampus notstatewideenergyban. Covingtondifferentjurisdiction; proposedNDAenduserunnamed. Exactexecutedsettlement/currentcourtoutcome unread.", "Noallfield,currentoperatingbuilding,actualimpact,executedcontractorpaidfundscertification." ], "sources": [ { "url": "https://www.wvia.org/news/local/2026-01-03/clifton-twp-supervisors-settle-with-data-center-developer-residents-promise-litigation", "host": "wvia.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "The DEP row explicitly identifies Gouldsboro and Project Gold in Clifton and Covington. Its proposal listing does not determine a separate settlement, zoning appeal or current entitlement. The original DEP project CSV lists the named project as proposed with no applications received in that tracker account. This does not establish absence of every municipal or other agency application. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "exact_named_dep_proposal_account_not_physical_commissioning", "scope": "The DEP row explicitly identifies Gouldsboro and Project Gold in Clifton and Covington. Its proposal listing does not determine a separate settlement, zoning appeal or current entitlement. The original DEP project CSV lists the named project as proposed with no applications received in that tracker account. This does not establish absence of every municipal or other agency application. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged." }, "tracker_scope": { "project_id": "10000031", "original_project_and_related_permit_csv_read": true, "no_data_center_operation_inferred": true, "no_coordinate_or_role_promotion": true } }, "notes": [ "The DEP row explicitly identifies Gouldsboro and Project Gold in Clifton and Covington. Its proposal listing does not determine a separate settlement, zoning appeal or current entitlement. The original DEP project CSV lists the named project as proposed with no applications received in that tracker account. This does not establish absence of every municipal or other agency application. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Clifton Township · Lackawanna · Source context reviewed", "status_scope": "The DEP row explicitly identifies Gouldsboro and Project Gold in Clifton and Covington. Its proposal listing does not determine a separate settlement, zoning appeal or current entitlement. The original DEP project CSV lists the named project as proposed with no applications received in that tracker account. This does not establish absence of every municipal or other agency application. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42069" } }, { "id": "pa-data-center-partners-granville-township-mifflin-pa", "state": "pa", "kind": "facility", "name": "Granville Township Data Center Campus (Loop Road)", "group": "proposed", "status": "Listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Mifflin" ], "city": "Lewistown", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.. Filing and solicitor interpretation are not final site approval, construction or court ruling. Planned Sunday action, July15zoning meeting and July21townhall have no assumed outcomes. USD22.5millionproject tax forecast has no verified period and is neither annual collected taxes nor public subsidy. Proposed buffers/noise rules not adopted from this story; no actual water, IT or secured power. Historical observations and forecasts are dated; no later outcome assumed. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-07-16", "The original signed Granville Township letter dated July 16, 2026 informs the applicant that its submission is incomplete for a missing traffic study certification and requests another filing. This dates the official letter account rather than a merits denial, physical closure or computing opening." ], [ "2026-09-28", "The original signed and sealed Township attestation certifies adoption of Ordinance 2026 03 at the September 28, 2026 public hearing. This dates the separate general zoning action without certifying complete review of its legal provisions, exact current property eligibility or a computing opening." ], [ "2026-10-26", "Scheduled event: The original Granville Township calendar schedules the named zoning appeal hearing for October 26, 2026 at six PM. Its event fields list an end of nine PM and Granville Event Center. This is a scheduled appeal, without an accomplished decision, construction or service." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.yahoo.com/news/us/articles/plans-filed-mifflin-county-data-011151924.html", "host": "yahoo.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://granvilletwp.org/", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://granvilletwp.org/wp-content/uploads/2026/07/Giorgione.pdf", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://granvilletwp.org/wp-content/uploads/2026/07/Granville-Cond-Use-Narrative-v0.1.pdf", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://granvilletwp.org/wp-content/uploads/2026/09/Ordinance-2026-3-Attested.pdf", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://granvilletwp.org/events/event/zoning-hearing-board-appeal-lewistown-developers-llc/", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.61061, "lng": -77.61663, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round35-2026-10-14.json", "scope": "Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.", "fields": { "reported_context": "ABC27/WHTM report quotes GranvilleTownship solicitor saying PADataCenterPartners filed LoopRoad plans Friday before planned curative-amendment action, so review would proceed under current zoning. Public rendering depicts six proposed buildings.", "independently_verified_current_operating_status": null }, "notes": [ "Filing and solicitor interpretation are not final site approval, construction or court ruling. Planned Sunday action, July15zoning meeting and July21townhall have no assumed outcomes. USD22.5millionproject tax forecast has no verified period and is neither annual collected taxes nor public subsidy. Proposed buffers/noise rules not adopted from this story; no actual water, IT or secured power.", "Historical observations and forecasts are dated; no later outcome assumed.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.yahoo.com/news/us/articles/plans-filed-mifflin-county-data-011151924.html", "host": "yahoo.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 64", "scope": "The complete original Township project index and five page applicant narrative identify the Granville computing proposal and its conditional use submission. This supports a listed proposal. The original signed July 16, 2026 letter returns the submission as incomplete for a missing traffic study certification and requests refiling; this is not a merits denial or physical closure. Original ordinance page one and signed attestation page twenty one establish the separate September 28 ordinance adoption, without a claim that all legal provisions were read. The official October 26 appeal notice remains prospective. Applicant compliance assertions and infrastructure forecasts are not independently verified performance or final permission. Developer and Developers wording variants in the official index and notice are retained without changing roles.", "fields": { "current_stage_evidence": { "outcome": "official_named_granville_compute_proposal_and_distinct_administrative_actions", "scope": "The complete original Township project index and five page applicant narrative identify the Granville computing proposal and its conditional use submission. This supports a listed proposal. The original signed July 16, 2026 letter returns the submission as incomplete for a missing traffic study certification and requests refiling; this is not a merits denial or physical closure. Original ordinance page one and signed attestation page twenty one establish the separate September 28 ordinance adoption, without a claim that all legal provisions were read. The official October 26 appeal notice remains prospective. Applicant compliance assertions and infrastructure forecasts are not independently verified performance or final permission. Developer and Developers wording variants in the official index and notice are retained without changing roles." }, "source_read_scope": { "complete_original_home_and_appeal_notice_bodies_read": true, "complete_original_five_page_narrative_text_read": true, "complete_original_signed_july16_letter_scan_actually_viewed": true, "ordinance_physical_pages_actually_viewed": [ 1, 21 ], "remaining_ordinance_pages_not_claimed_read": true, "attestation_signature_and_seal_read": true, "private_landowner_details_excluded": true, "applicant_compliance_claim_not_final_official_approval": true, "official_development_developers_wording_variants_retained": true } }, "notes": [ "The complete original Township project index and five page applicant narrative identify the Granville computing proposal and its conditional use submission. This supports a listed proposal. The original signed July 16, 2026 letter returns the submission as incomplete for a missing traffic study certification and requests refiling; this is not a merits denial or physical closure. Original ordinance page one and signed attestation page twenty one establish the separate September 28 ordinance adoption, without a claim that all legal provisions were read. The official October 26 appeal notice remains prospective. Applicant compliance assertions and infrastructure forecasts are not independently verified performance or final permission. Developer and Developers wording variants in the official index and notice are retained without changing roles.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://granvilletwp.org/", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://granvilletwp.org/wp-content/uploads/2026/07/Giorgione.pdf", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://granvilletwp.org/wp-content/uploads/2026/07/Granville-Cond-Use-Narrative-v0.1.pdf", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://granvilletwp.org/wp-content/uploads/2026/09/Ordinance-2026-3-Attested.pdf", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://granvilletwp.org/events/event/zoning-hearing-board-appeal-lewistown-developers-llc/", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lewistown · Mifflin · Source context reviewed", "status_scope": "The complete original Township project index and five page applicant narrative identify the Granville computing proposal and its conditional use submission. This supports a listed proposal. The original signed July 16, 2026 letter returns the submission as incomplete for a missing traffic study certification and requests refiling; this is not a merits denial or physical closure. Original ordinance page one and signed attestation page twenty one establish the separate September 28 ordinance adoption, without a claim that all legal provisions were read. The official October 26 appeal notice remains prospective. Applicant compliance assertions and infrastructure forecasts are not independently verified performance or final permission. Developer and Developers wording variants in the official index and notice are retained without changing roles.", "event_evidence": [ { "date": "2026-07-16", "text": "The original signed Granville Township letter dated July 16, 2026 informs the applicant that its submission is incomplete for a missing traffic study certification and requests another filing. This dates the official letter account rather than a merits denial, physical closure or computing opening.", "kind": "announced", "sources": [ { "url": "https://granvilletwp.org/wp-content/uploads/2026/07/Giorgione.pdf", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] }, { "date": "2026-09-28", "text": "The original signed and sealed Township attestation certifies adoption of Ordinance 2026 03 at the September 28, 2026 public hearing. This dates the separate general zoning action without certifying complete review of its legal provisions, exact current property eligibility or a computing opening.", "kind": "approved", "sources": [ { "url": "https://granvilletwp.org/wp-content/uploads/2026/09/Ordinance-2026-3-Attested.pdf", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] }, { "date": "2026-10-26", "text": "Scheduled event: The original Granville Township calendar schedules the named zoning appeal hearing for October 26, 2026 at six PM. Its event fields list an end of nine PM and Granville Event Center. This is a scheduled appeal, without an accomplished decision, construction or service.", "kind": "scheduled_event", "sources": [ { "url": "https://granvilletwp.org/events/event/zoning-hearing-board-appeal-lewistown-developers-llc/", "host": "granvilletwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42087" } }, { "id": "homer-city-energy-campus-pa", "state": "pa", "kind": "facility", "name": "Homer City Energy Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Indiana" ], "city": "Homer City", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Homer City redevelopment site and agency permit index. 2GW is decommissioned coal generation, not proposed IT capacity. Air-permit and demolition indexes do not establish completed new natural-gas plant or operational data-center buildings. No blanket environmental clearance from one listed permit. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2025-11-18", "Pennsylvania DEP issued its Homer City plan approval comment response document dated November 18, 2025. It expressly distinguishes the generating station authorization from any data center authorization. This records the dated agency document, not a data center approval or opening." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.pa.gov/agencies/dep/dep-regions/northwest-regional-office/homer-city-generation-redevelopment", "host": "pa.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://files.dep.state.pa.us/RegionalResources/NWRO/NWROPortalFiles/Homer-City/Air/Final-AQ-Plan-Approval/Final%20Comment%20Response%20Document%2020251118.pdf", "host": "files.dep.state.pa.us", "published": "2025-11-18", "date": "2025-11-18", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://files.dep.state.pa.us/RegionalResources/NWRO/NWROPortalFiles/Homer-City/Air/Final-AQ-Title-V/Final%20Comment%20Response%20Document%20-%20Homer%20City%20TVOP%20Renewal%2032-00055%20260226.pdf", "host": "files.dep.state.pa.us", "published": "2026-02-26", "date": "2026-02-26", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.65183, "lng": -79.08768, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "government-primary-review-round7-2026-10-14.json", "scope": "Homer City redevelopment site and agency permit index", "fields": { "agency_page_updated": "2026-10-05", "published_site_address": "1750 Powerplant Road,HomerCity,PA15748", "published_municipality_county": "Center Township,IndianaCounty,Pennsylvania", "redevelopment_site_acres_min_exclusive": 3200, "former_coal_generation_gw": 2, "former_coal_plant_ceased_operations_year": 2023, "listed_air_plan_approval_date": "2025-11-18", "listed_titlev_renewal_date": "2026-02-26" }, "notes": [ "2GW is decommissioned coal generation, not proposed IT capacity. Air-permit and demolition indexes do not establish completed new natural-gas plant or operational data-center buildings. No blanket environmental clearance from one listed permit.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.pa.gov/agencies/dep/dep-regions/northwest-regional-office/homer-city-generation-redevelopment", "host": "pa.gov", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 27", "scope": "Pennsylvania DEP November 18, 2025 comment response explicitly states that air plan approval 32 00457A authorizes a natural gas electrical generating station and does not authorize data center construction or operation. The agency described possible adjacent data center use without a confirmed specific use in that reviewed record. The separate February 26, 2026 Title V renewal response concerns legacy coal cessation, removal of unused sources and remaining source conditions, not a finding that a new data center is operating. Demolition, blasting and power plant permits on the current agency index do not establish a data center physical phase. Current exact data center stage remains unclear.", "fields": { "current_stage_evidence": { "outcome": "power_generation_approval_and_legacy_permit_not_data_center_authorization", "scope": "Pennsylvania DEP November 18, 2025 comment response explicitly states that air plan approval 32 00457A authorizes a natural gas electrical generating station and does not authorize data center construction or operation. The agency described possible adjacent data center use without a confirmed specific use in that reviewed record. The separate February 26, 2026 Title V renewal response concerns legacy coal cessation, removal of unused sources and remaining source conditions, not a finding that a new data center is operating. Demolition, blasting and power plant permits on the current agency index do not establish a data center physical phase. Current exact data center stage remains unclear." }, "source_read_scope": { "november_document_pdf_cover_and_pages_visually_read": [ 1, 14, 49 ], "november_document_sections_are_bounded_not_complete_63_page_audit": true, "february_document_project_description_page_read": 2, "power_generation_not_data_center_permit": true, "coal_cessation_not_new_hpc_commissioning": true } }, "notes": [ "Pennsylvania DEP November 18, 2025 comment response explicitly states that air plan approval 32 00457A authorizes a natural gas electrical generating station and does not authorize data center construction or operation. The agency described possible adjacent data center use without a confirmed specific use in that reviewed record. The separate February 26, 2026 Title V renewal response concerns legacy coal cessation, removal of unused sources and remaining source conditions, not a finding that a new data center is operating. Demolition, blasting and power plant permits on the current agency index do not establish a data center physical phase. Current exact data center stage remains unclear.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://www.pa.gov/agencies/dep/dep-regions/northwest-regional-office/homer-city-generation-redevelopment", "host": "www.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://files.dep.state.pa.us/RegionalResources/NWRO/NWROPortalFiles/Homer-City/Air/Final-AQ-Plan-Approval/Final%20Comment%20Response%20Document%2020251118.pdf", "host": "files.dep.state.pa.us", "published": "2025-11-18", "date": "2025-11-18", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://files.dep.state.pa.us/RegionalResources/NWRO/NWROPortalFiles/Homer-City/Air/Final-AQ-Title-V/Final%20Comment%20Response%20Document%20-%20Homer%20City%20TVOP%20Renewal%2032-00055%20260226.pdf", "host": "files.dep.state.pa.us", "published": "2026-02-26", "date": "2026-02-26", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Homer City · Indiana · Source context reviewed", "event_evidence": [ { "date": "2025-11-18", "text": "Pennsylvania DEP issued its Homer City plan approval comment response document dated November 18, 2025. It expressly distinguishes the generating station authorization from any data center authorization. This records the dated agency document, not a data center approval or opening.", "kind": "announced", "sources": [ { "url": "https://files.dep.state.pa.us/RegionalResources/NWRO/NWROPortalFiles/Homer-City/Air/Final-AQ-Plan-Approval/Final%20Comment%20Response%20Document%2020251118.pdf", "host": "files.dep.state.pa.us", "published": "2025-11-18", "date": "2025-11-18", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42063" } }, { "id": "iron-city-wells-karthaus-township-clearfield-pa", "state": "pa", "kind": "facility", "name": "Iron City Wells A.I. Data Center", "group": "proposed", "status": "Listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Clearfield" ], "city": "Karthaus Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site context, with limited previews/corridor crosswalks explicitly identified.. Original Pennsylvania Bulletin volume 56 number 5, January 31, 2026: only PDF page 89/printed page 671 read in text and pixels. DEP plan approval 17-00078A issued January 16, 2026, application received June 23, 2025, expiry July 15, 2027, for construction of FIFTEEN natural-gas engine-gensets powering Iron City No. 1 Power Generator and Compute Center, Karthaus Township/Clearfield County. Not an operating certificate, all-site permits, installed/energized engines or 15 MW. Frenchville PO Box is company mailing address, not verified facility parcel. Notice says conditions include emissions/monitoring/testing, but contains NO numeric emissions table; blog amounts are not silently promoted to this original. Full underlying approval not inspected. Other 207 PDF pages not reviewed. Not all fields, current operation, precise parcel or critical IT independently certified.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.pacodeandbulletin.gov/secure/pabulletin/data/vol56/56-5/56-5.pdf", "host": "pacodeandbulletin.gov", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://clearfieldcountypa.gov/AgendaCenter/ViewFile/Agenda/_05282025-332", "host": "clearfieldcountypa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.00017, "lng": -78.47429, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-permit-scope-operator-crosswalks-and-work-resumption-round82-2026-10-15.json", "scope": "Named-site context, with limited previews/corridor crosswalks explicitly identified.", "fields": {}, "notes": [ "Original Pennsylvania Bulletin volume 56 number 5, January 31, 2026: only PDF page 89/printed page 671 read in text and pixels. DEP plan approval 17-00078A issued January 16, 2026, application received June 23, 2025, expiry July 15, 2027, for construction of FIFTEEN natural-gas engine-gensets powering Iron City No. 1 Power Generator and Compute Center, Karthaus Township/Clearfield County. Not an operating certificate, all-site permits, installed/energized engines or 15 MW. Frenchville PO Box is company mailing address, not verified facility parcel. Notice says conditions include emissions/monitoring/testing, but contains NO numeric emissions table; blog amounts are not silently promoted to this original. Full underlying approval not inspected. Other 207 PDF pages not reviewed.", "Not all fields, current operation, precise parcel or critical IT independently certified." ], "sources": [ { "url": "https://www.pacodeandbulletin.gov/secure/pabulletin/data/vol56/56-5/56-5.pdf", "host": "pacodeandbulletin.gov", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 64", "scope": "Selected original May 28, 2025 County agenda pages five and six identify Iron City Wells and a new DEP air authorization for Iron City number one Power Generator and Compute Center in Karthaus Township. This supports a listed computing proposal. The separately listed Beccaria number two and Woodward number three projects are not merged. The agenda is a prospective meeting record and does not establish an accomplished County vote, current permit disposition, commissioned computing or actual generator operation. The original later Pennsylvania Bulletin remains held by robots restrictions.", "fields": { "current_stage_evidence": { "outcome": "official_named_karthaus_ironcity1_compute_proposal", "scope": "Selected original May 28, 2025 County agenda pages five and six identify Iron City Wells and a new DEP air authorization for Iron City number one Power Generator and Compute Center in Karthaus Township. This supports a listed computing proposal. The separately listed Beccaria number two and Woodward number three projects are not merged. The agenda is a prospective meeting record and does not establish an accomplished County vote, current permit disposition, commissioned computing or actual generator operation. The original later Pennsylvania Bulletin remains held by robots restrictions." }, "source_read_scope": { "original_agenda_selected_pages5and6_text_read": true, "karthaus_number1_not_beccaria2_or_woodward3": true, "prospective_agenda_not_accomplished_vote": true, "air_authorization_not_computing_operation": true, "original_later_bulletin_access_hold_retained": true } }, "notes": [ "Selected original May 28, 2025 County agenda pages five and six identify Iron City Wells and a new DEP air authorization for Iron City number one Power Generator and Compute Center in Karthaus Township. This supports a listed computing proposal. The separately listed Beccaria number two and Woodward number three projects are not merged. The agenda is a prospective meeting record and does not establish an accomplished County vote, current permit disposition, commissioned computing or actual generator operation. The original later Pennsylvania Bulletin remains held by robots restrictions.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://clearfieldcountypa.gov/AgendaCenter/ViewFile/Agenda/_05282025-332", "host": "clearfieldcountypa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Karthaus Township · Clearfield · Source context reviewed", "status_scope": "Selected original May 28, 2025 County agenda pages five and six identify Iron City Wells and a new DEP air authorization for Iron City number one Power Generator and Compute Center in Karthaus Township. This supports a listed computing proposal. The separately listed Beccaria number two and Woodward number three projects are not merged. The agenda is a prospective meeting record and does not establish an accomplished County vote, current permit disposition, commissioned computing or actual generator operation. The original later Pennsylvania Bulletin remains held by robots restrictions.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42033" } }, { "id": "iron-mountain-wpa-1-boyers-butler-county-pa", "state": "pa", "kind": "facility", "name": "Iron Mountain WPA-1 (Boyers underground data center)", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Butler" ], "city": "Boyers", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named operator facility specification, not current metered demand, permit, parcel survey or whole-record certification.. Marketing landing page includes company-wide 20 locations / 3 continents / 3.5 million sq ft, not WPA1-only metrics. Current date, exact street, metered capacity, actual efficiency and independently verified certifications not established. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://datacenter.ironmountain.com/western-pennsylvania-data-center", "host": "datacenter.ironmountain.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 40.912, "lng": -79.91325, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round19-2026-10-14.json", "scope": "Named operator facility specification, not current metered demand, permit, parcel survey or whole-record certification.", "fields": { "operator_named_facility": "WPA1 near Boyers, Pennsylvania", "publisher_area_sqft": 333000, "total_potential_capacity_mw": 40, "capacity_basis": "Potential, explicit critical IT basis not supplied", "operator_campus_acres": 200, "operator_underground_depth_feet": 220, "source_copyright_year": 2023, "current_operational_capacity_mw": null }, "notes": [ "Marketing landing page includes company-wide 20 locations / 3 continents / 3.5 million sq ft, not WPA1-only metrics. Current date, exact street, metered capacity, actual efficiency and independently verified certifications not established.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://datacenter.ironmountain.com/western-pennsylvania-data-center", "host": "datacenter.ironmountain.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "Iron Mountain offers current cabinets, cages, suites and data-hall services at its named WPA-1 underground Western Pennsylvania facility. Federal-grade and customer-testimonial claims are not independently certified. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "Iron Mountain offers current cabinets, cages, suites and data-hall services at its named WPA-1 underground Western Pennsylvania facility. Federal-grade and customer-testimonial claims are not independently certified. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "Iron Mountain offers current cabinets, cages, suites and data-hall services at its named WPA-1 underground Western Pennsylvania facility. Federal-grade and customer-testimonial claims are not independently certified." ], "sources": [ { "url": "https://datacenter.ironmountain.com/western-pennsylvania-data-center", "host": "datacenter.ironmountain.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Boyers · Butler · Source context reviewed", "status_scope": "Iron Mountain offers current cabinets, cages, suites and data-hall services at its named WPA-1 underground Western Pennsylvania facility. Federal-grade and customer-testimonial claims are not independently certified. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42019" } }, { "id": "klondike-wyalusing-data-center-bradford-pa", "state": "pa", "kind": "facility", "name": "Klondike Wyalusing Data Center", "group": "proposed", "status": "Permit review underway", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Bradford" ], "city": "Wyalusing", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. The 248 MW turbine sum and 218 MW described electric delivery are not critical IT and must not be added. Original permit has not been read. Emissions allowances are not actual emissions. Reported July 9 county ordinance adoption and unsigned development/community-benefit templates do not prove this project's applicability or executed commitments. Prior LNG approval and other withdrawn projects are separate. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.northcentralpa.com/business/bradford-county-adopts-data-center-rules-wyalusing-hyperscale-projects-air-permit-issued/article_b09783c0-fc03-416b-b0a7-c6881f9616fd.html", "host": "northcentralpa.com", "date": "2026-07-20", "published": "2026-07-20", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.78871, "lng": -76.51554, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round27-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "NorthcentralPA reports an October 9, 2025 DEP plan approval for Klondike's gas-generation project, nominally eight 31 MW turbines with up to 218 MW electric delivery to a future Wyalusing data center.", "independently_verified_current_operating_status": null }, "notes": [ "The 248 MW turbine sum and 218 MW described electric delivery are not critical IT and must not be added. Original permit has not been read. Emissions allowances are not actual emissions. Reported July 9 county ordinance adoption and unsigned development/community-benefit templates do not prove this project's applicability or executed commitments. Prior LNG approval and other withdrawn projects are separate.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.northcentralpa.com/business/bradford-county-adopts-data-center-rules-wyalusing-hyperscale-projects-air-permit-issued/article_b09783c0-fc03-416b-b0a7-c6881f9616fd.html", "host": "northcentralpa.com", "date": "2026-07-20", "published": "2026-07-20", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "The DEP row explicitly identifies Wyalusing Energy Center and Klondike Digital Infrastructure in Wyalusing Township. Power plant activity and individual issued permits do not establish a commissioned computing campus. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "exact_named_dep_proposal_account_not_physical_commissioning", "scope": "The DEP row explicitly identifies Wyalusing Energy Center and Klondike Digital Infrastructure in Wyalusing Township. Power plant activity and individual issued permits do not establish a commissioned computing campus. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged." }, "tracker_scope": { "project_id": "10000016", "original_project_and_related_permit_csv_read": true, "no_data_center_operation_inferred": true, "no_coordinate_or_role_promotion": true } }, "notes": [ "The DEP row explicitly identifies Wyalusing Energy Center and Klondike Digital Infrastructure in Wyalusing Township. Power plant activity and individual issued permits do not establish a commissioned computing campus. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Wyalusing · Bradford · Source context reviewed", "status_scope": "The DEP row explicitly identifies Wyalusing Energy Center and Klondike Digital Infrastructure in Wyalusing Township. Power plant activity and individual issued permits do not establish a commissioned computing campus. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42015" } }, { "id": "mcd7-limerick-township-montgomery-county-pa", "state": "pa", "kind": "facility", "name": "Limerick Township Data Center Campus (MCD 7)", "group": "proposed", "status": "Application under review", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Montgomery" ], "city": "Limerick Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. The automated excerpt selected an unrelated October website notice; the retained main article was read separately. This association brief cites January 12 Pottstown Mercury reporting. Up to 750 MW has no critical-IT basis; 1.3 MGD is projected cooling demand, not measured use. Tax and jobs are developer forecasts; presentation is not approval. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-04-14", "The Township May 5 agenda packet includes April 14, 2026 minutes reporting that the MCD 7 conditional use hearing opened and would continue later. This records that published minutes account, not certification of later approved minutes, a final permit vote or full testimony." ], [ "2026-10-27", "Scheduled event: Limerick Township lists an MCD 7 conditional use hearing continuation October 27, 2026. The future date remains scheduled at this check and is not an accomplished hearing, approval or construction milestone." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.suburbanrealtorsalliance.com/news/2026/01/16/montgomery-county/limerick-gets-first-look-at-1.4m-square-foot-data-center-proposal/", "host": "suburbanrealtorsalliance.com", "date": "2026-01-16", "published": "2026-01-16", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.limerickpa.org/437/Conditional-Use-Hearings", "host": "www.limerickpa.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.limerickpa.org/AgendaCenter/ViewFile/Agenda/_05052026-625", "host": "www.limerickpa.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.21085, "lng": -75.36727, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round28-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "The Suburban Realtors Alliance summarizes a Limerick proposal by MCD 7 LLC: eight server buildings on 192 acres, replacing a warehouse concept.", "independently_verified_current_operating_status": null }, "notes": [ "The automated excerpt selected an unrelated October website notice; the retained main article was read separately. This association brief cites January 12 Pottstown Mercury reporting. Up to 750 MW has no critical-IT basis; 1.3 MGD is projected cooling demand, not measured use. Tax and jobs are developer forecasts; presentation is not approval.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.suburbanrealtorsalliance.com/news/2026/01/16/montgomery-county/limerick-gets-first-look-at-1.4m-square-foot-data-center-proposal/", "host": "suburbanrealtorsalliance.com", "date": "2026-01-16", "published": "2026-01-16", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "Limerick Township current hearing page explicitly lists MCD 7 application CU 25 04 with an October 27, 2026 continuation, and separately lists the later MCD 7 phased applications CU 26 05 and CU 26 06 as pending. Application under review describes these named proceedings, not a final conditional use approval, land development approval, construction or service. The separate Limerick Town Center applicant CU 26 03 and its cooling description are not merged with MCD 7. The May 5 agenda packet includes April 14 meeting minutes reporting the opening of the MCD 7 hearing; the reviewed packet is not certification of later adopted minutes or complete hearing testimony. An attempted larger engineering packet exceeded both local document byte limits, so its technical findings are not adopted from cached search text.", "fields": { "current_stage_evidence": { "outcome": "current_named_mcd7_conditional_use_proceedings_not_final_approval", "scope": "Limerick Township current hearing page explicitly lists MCD 7 application CU 25 04 with an October 27, 2026 continuation, and separately lists the later MCD 7 phased applications CU 26 05 and CU 26 06 as pending. Application under review describes these named proceedings, not a final conditional use approval, land development approval, construction or service. The separate Limerick Town Center applicant CU 26 03 and its cooling description are not merged with MCD 7. The May 5 agenda packet includes April 14 meeting minutes reporting the opening of the MCD 7 hearing; the reviewed packet is not certification of later adopted minutes or complete hearing testimony. An attempted larger engineering packet exceeded both local document byte limits, so its technical findings are not adopted from cached search text." }, "source_read_scope": { "current_application_ids": [ "CU 25 04", "CU 26 05", "CU 26 06" ], "separate_cu26_03_applicant_not_merged": true, "may5_packet_minutes_pdf_pages_read": [ 15, 16 ], "larger_technical_packet_local_byte_holds_retained": true, "later_minutes_adoption_and_transcript_not_verified": true } }, "notes": [ "Limerick Township current hearing page explicitly lists MCD 7 application CU 25 04 with an October 27, 2026 continuation, and separately lists the later MCD 7 phased applications CU 26 05 and CU 26 06 as pending. Application under review describes these named proceedings, not a final conditional use approval, land development approval, construction or service. The separate Limerick Town Center applicant CU 26 03 and its cooling description are not merged with MCD 7. The May 5 agenda packet includes April 14 meeting minutes reporting the opening of the MCD 7 hearing; the reviewed packet is not certification of later adopted minutes or complete hearing testimony. An attempted larger engineering packet exceeded both local document byte limits, so its technical findings are not adopted from cached search text.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://www.limerickpa.org/437/Conditional-Use-Hearings", "host": "www.limerickpa.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.limerickpa.org/AgendaCenter/ViewFile/Agenda/_05052026-625", "host": "www.limerickpa.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Limerick Township · Montgomery · Source context reviewed", "status_scope": "Limerick Township current hearing page explicitly lists MCD 7 application CU 25 04 with an October 27, 2026 continuation, and separately lists the later MCD 7 phased applications CU 26 05 and CU 26 06 as pending. Application under review describes these named proceedings, not a final conditional use approval, land development approval, construction or service. The separate Limerick Town Center applicant CU 26 03 and its cooling description are not merged with MCD 7. The May 5 agenda packet includes April 14 meeting minutes reporting the opening of the MCD 7 hearing; the reviewed packet is not certification of later adopted minutes or complete hearing testimony. An attempted larger engineering packet exceeded both local document byte limits, so its technical findings are not adopted from cached search text.", "event_evidence": [ { "date": "2026-04-14", "text": "The Township May 5 agenda packet includes April 14, 2026 minutes reporting that the MCD 7 conditional use hearing opened and would continue later. This records that published minutes account, not certification of later approved minutes, a final permit vote or full testimony.", "kind": "hearing", "sources": [ { "url": "https://www.limerickpa.org/AgendaCenter/ViewFile/Agenda/_05052026-625", "host": "www.limerickpa.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] }, { "date": "2026-10-27", "text": "Scheduled event: Limerick Township lists an MCD 7 conditional use hearing continuation October 27, 2026. The future date remains scheduled at this check and is not an accomplished hearing, approval or construction milestone.", "kind": "scheduled_event", "sources": [ { "url": "https://www.limerickpa.org/437/Conditional-Use-Hearings", "host": "www.limerickpa.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42091" } }, { "id": "diversified-longhorn-pad-a-horton-township-elk-pa", "state": "pa", "kind": "facility", "name": "Longhorn Pad A Wellhead Bitcoin Mine", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Elk" ], "city": "Horton Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.. LonghornPadC separate. Violations and permit conditions based on reporting, not independently retained original orders. Predicted67foldemissions not measuredactual/noisehealthcausation. No present operational certification. Subsequent original decisions and current operator disclosures take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://capitalandmain.com/in-rural-pennsylvania-crypto-mining-offers-a-lifeline-for-dying-gas-wells", "host": "capitalandmain.com", "date": "2024-06-03", "published": "2024-06-03", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 41.42513, "lng": -78.64895, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round24-2026-10-14.json", "scope": "Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.", "fields": { "reported_context": "Capital and Main reports LonghornPadA historic unpermitted operation followed byDecember permit, with full-time operation awaiting noise mitigation at report date.", "independently_verified_current_operating_status": null }, "notes": [ "LonghornPadC separate. Violations and permit conditions based on reporting, not independently retained original orders. Predicted67foldemissions not measuredactual/noisehealthcausation. No present operational certification.", "Subsequent original decisions and current operator disclosures take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://capitalandmain.com/in-rural-pennsylvania-crypto-mining-offers-a-lifeline-for-dying-gas-wells", "host": "capitalandmain.com", "date": "2024-06-03", "published": "2024-06-03", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Horton Township · Elk · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42047" } }, { "id": "prospect-rd-misty-hollow-forward-township-butler-pa", "state": "pa", "kind": "facility", "name": "Misty Hollow Energy and Data Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Butler" ], "city": "Prospect", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Visible publication is September 19, not the URL's September 18. Data-center footprint, separate treatment/office areas and possible future expansion are different scopes. Water/discharge design was still being developed, and no tenant was named. A prospective November SALDO vote and assumptions about prior submission are not adopted law or a final grandfathering decision. No creek withdrawals or exact capacity inferred. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.butlereagle.com/20260918/massive-data-center-proposed-in-forward-township/", "host": "butlereagle.com", "date": "2026-09-19", "published": "2026-09-19", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 40.92812, "lng": -79.93084, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round30-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "Butler Eagle describes Misty Hollow's preliminary Forward Township plan and a developer target for approval in early 2027 and possible mid-2029 completion.", "independently_verified_current_operating_status": null }, "notes": [ "Visible publication is September 19, not the URL's September 18. Data-center footprint, separate treatment/office areas and possible future expansion are different scopes. Water/discharge design was still being developed, and no tenant was named. A prospective November SALDO vote and assumptions about prior submission are not adopted law or a final grandfathering decision. No creek withdrawals or exact capacity inferred.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.butlereagle.com/20260918/massive-data-center-proposed-in-forward-township/", "host": "butlereagle.com", "date": "2026-09-19", "published": "2026-09-19", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Prospect · Butler · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42019" } }, { "id": "mlp-ventures-plymouth-township-conshohocken-pa", "state": "pa", "kind": "facility", "name": "MLP Ventures Plymouth Township Data Center (former Cleveland-Cliffs Conshohocken plant)", "group": "proposed", "status": "Agency listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Montgomery" ], "city": "Conshohocken", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Participant status and a contingent property sale are not project approval or a closed acquisition. Other O'Neill proposals across the river are separate. Protest signs' diesel equivalence and neighbors' health concerns are not measured emissions or established causation. Future July hearing dates have no assumed outcome; tax-payment allegations are not adopted as findings. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-05-01", "Plymouth Township published its receipt of the new 900 Conshohocken Road data center application May 1, 2026. It distinguishes an earlier withdrawn application and describes further review requirements. The publication date is not a permit approval, an exact application filing day or current construction." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://metrophiladelphia.com/stories/plymouth-township-data-center-proposal,145572", "host": "metrophiladelphia.com", "date": "2026-06-29", "published": "2026-06-29", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.plymouthtownship.org/plymouth-township-receives-zoning-hearing-board-application-for-proposed-data-center/", "host": "www.plymouthtownship.org", "published": "2026-05-01", "date": "2026-05-01", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.22673, "lng": -75.3846, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round28-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "Metro Philadelphia reports a new MLP Ventures zoning application after an earlier withdrawal for the former Cleveland-Cliffs property at 900 Conshohocken Road, with June 25 proceedings granting participant status.", "independently_verified_current_operating_status": null }, "notes": [ "Participant status and a contingent property sale are not project approval or a closed acquisition. Other O'Neill proposals across the river are separate. Protest signs' diesel equivalence and neighbors' health concerns are not measured emissions or established causation. Future July hearing dates have no assumed outcome; tax-payment allegations are not adopted as findings.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://metrophiladelphia.com/stories/plymouth-township-data-center-proposal,145572", "host": "metrophiladelphia.com", "date": "2026-06-29", "published": "2026-06-29", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "The DEP row explicitly identifies the MLP Ventures proposal at 900 Conshohocken Road in Plymouth Township. It does not establish a completed conversion of every former steel plant structure. The original DEP project CSV lists the named project as proposed with no applications received in that tracker account. This does not establish absence of every municipal or other agency application. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged. An original Township May 1, 2026 notice independently identifies the former steel mill at 900 Conshohocken Road and a second application after a prior withdrawal. The earlier application withdrawal is not applied to the new proposal. The notice says land development review would still be required after any special exception approval.", "fields": { "current_stage_evidence": { "outcome": "exact_named_dep_proposal_account_not_physical_commissioning", "scope": "The DEP row explicitly identifies the MLP Ventures proposal at 900 Conshohocken Road in Plymouth Township. It does not establish a completed conversion of every former steel plant structure. The original DEP project CSV lists the named project as proposed with no applications received in that tracker account. This does not establish absence of every municipal or other agency application. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged. An original Township May 1, 2026 notice independently identifies the former steel mill at 900 Conshohocken Road and a second application after a prior withdrawal. The earlier application withdrawal is not applied to the new proposal. The notice says land development review would still be required after any special exception approval." }, "tracker_scope": { "project_id": "10000059", "original_project_and_related_permit_csv_read": true, "no_data_center_operation_inferred": true, "no_coordinate_or_role_promotion": true }, "municipal_scope": { "original_page_published_on": "2026-05-01", "publication_metadata_read": true, "former_steel_plant_crosswalk_explicit": true, "prior_application_withdrawal_not_new_proposal_withdrawal": true, "further_land_development_review_after_special_exception": true, "independent_full_statutory_audit": false } }, "notes": [ "The DEP row explicitly identifies the MLP Ventures proposal at 900 Conshohocken Road in Plymouth Township. It does not establish a completed conversion of every former steel plant structure. The original DEP project CSV lists the named project as proposed with no applications received in that tracker account. This does not establish absence of every municipal or other agency application. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged. An original Township May 1, 2026 notice independently identifies the former steel mill at 900 Conshohocken Road and a second application after a prior withdrawal. The earlier application withdrawal is not applied to the new proposal. The notice says land development review would still be required after any special exception approval.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.plymouthtownship.org/plymouth-township-receives-zoning-hearing-board-application-for-proposed-data-center/", "host": "www.plymouthtownship.org", "published": "2026-05-01", "date": "2026-05-01", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Conshohocken · Montgomery · Source context reviewed", "status_scope": "The DEP row explicitly identifies the MLP Ventures proposal at 900 Conshohocken Road in Plymouth Township. It does not establish a completed conversion of every former steel plant structure. The original DEP project CSV lists the named project as proposed with no applications received in that tracker account. This does not establish absence of every municipal or other agency application. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "event_evidence": [ { "date": "2026-05-01", "text": "Plymouth Township published its receipt of the new 900 Conshohocken Road data center application May 1, 2026. It distinguishes an earlier withdrawn application and describes further review requirements. The publication date is not a permit approval, an exact application filing day or current construction.", "kind": "announced", "sources": [ { "url": "https://www.plymouthtownship.org/plymouth-township-receives-zoning-hearing-board-application-for-proposed-data-center/", "host": "www.plymouthtownship.org", "published": "2026-05-01", "date": "2026-05-01", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42091" } }, { "id": "mudiita-ransom-township-lackawanna-pa", "state": "pa", "kind": "facility", "name": "Mudiita Ransom Township Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lackawanna" ], "city": "Ransom Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. This is not a formal countywide denial or verified permanent abandonment. Scranton Materials' separate quarry overlay denial/appeal and a pumped-storage study are other proceedings. Mudiita's 930-plus-acre marketing and a smaller acquired land area are not reconciled. Property price is not DC capex; no current tenant, service agreement or approval is established. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wvia.org/news/local/2026-07-27/future-of-ransom-twp-property-uncertain-as-carbon-county-developer-says-no-plans-for-data-center-campus", "host": "wvia.org", "date": "2026-07-27", "published": "2026-07-27", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://ransomtownshippa.gov/data-center-documents", "host": "ransomtownshippa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.42953, "lng": -75.64804, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round28-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "WVIA reports uncertainty at Mudiita's Ransom Township property: a former shareholder says there are no present data-center plans, websites are down and current shareholders are unidentified.", "independently_verified_current_operating_status": null }, "notes": [ "This is not a formal countywide denial or verified permanent abandonment. Scranton Materials' separate quarry overlay denial/appeal and a pumped-storage study are other proceedings. Mudiita's 930-plus-acre marketing and a smaller acquired land area are not reconciled. Property price is not DC capex; no current tenant, service agreement or approval is established.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.wvia.org/news/local/2026-07-27/future-of-ransom-twp-property-uncertain-as-carbon-county-developer-says-no-plans-for-data-center-campus", "host": "wvia.org", "date": "2026-07-27", "published": "2026-07-27", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 64", "scope": "The complete original Township data center document index names Scranton Materials zoning and exhibit submissions. The index does not independently establish the exact inherited Mudiita property or legal identity, present computing stage or a current final outcome. Private accounts of a land purchase and lack of plans are not adopted. A separate Scranton Materials application, Township wide policy and Mudiita proposal are not merged.", "fields": { "current_stage_evidence": { "outcome": "official_ransom_index_exact_mudiita_crosswalk_held", "scope": "The complete original Township data center document index names Scranton Materials zoning and exhibit submissions. The index does not independently establish the exact inherited Mudiita property or legal identity, present computing stage or a current final outcome. Private accounts of a land purchase and lack of plans are not adopted. A separate Scranton Materials application, Township wide policy and Mudiita proposal are not merged." }, "source_read_scope": { "complete_original_township_document_index_body_read": true, "linked_application_bodies_unread": true, "separate_scranton_materials_not_forced_mudiita": true } }, "notes": [ "The complete original Township data center document index names Scranton Materials zoning and exhibit submissions. The index does not independently establish the exact inherited Mudiita property or legal identity, present computing stage or a current final outcome. Private accounts of a land purchase and lack of plans are not adopted. A separate Scranton Materials application, Township wide policy and Mudiita proposal are not merged.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://ransomtownshippa.gov/data-center-documents", "host": "ransomtownshippa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Ransom Township · Lackawanna · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42069" } }, { "id": "muncy-data-center-lycoming-county-pa", "state": "pa", "kind": "facility", "name": "Muncy Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lycoming" ], "city": "Muncy", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named original reporter/issuer context with current versus historical stage explicit.. PatCrossley SunGazette July18,2026 originalreportquotes developerlegalnotice CLAIMING deemedapproval ofconditionaluse onYetterRoad. This is applicantposition afterallegedmissedhearingdeadline, not inspectedcourtjudgment or automaticall-permitcertification. Originalnotice/currentMPC/courtdocketunread; do notgivepresentlegaladvice. ArticleinitialApril28filingvs laterApril22applicationdates remainunresolved; do notinventoneprecisestartutorydeadline. Townshipmoratorium/curativeamendmentdisputes notverifiedcurrentlaw. Litigationanticipatednotprovedfiled/ruling. No ITMW/capex/currentoperations established. Not everyfield/currentphysicaloperation/paidfunds/issuedpermit/exactITcertified.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.sungazette.com/news/top-news/2026/07/legal-notice-claims-deemed-approval-for-muncy-township-data-center/", "host": "sungazette.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.muncytwp.org/data-center-ordinance-agenda/", "host": "www.muncytwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.34332, "lng": -77.06453, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-opening-land-and-approval-stage-review-round77-2026-10-15.json", "scope": "Named original reporter/issuer context with current versus historical stage explicit.", "fields": {}, "notes": [ "PatCrossley SunGazette July18,2026 originalreportquotes developerlegalnotice CLAIMING deemedapproval ofconditionaluse onYetterRoad. This is applicantposition afterallegedmissedhearingdeadline, not inspectedcourtjudgment or automaticall-permitcertification. Originalnotice/currentMPC/courtdocketunread; do notgivepresentlegaladvice.", "ArticleinitialApril28filingvs laterApril22applicationdates remainunresolved; do notinventoneprecisestartutorydeadline. Townshipmoratorium/curativeamendmentdisputes notverifiedcurrentlaw. Litigationanticipatednotprovedfiled/ruling. No ITMW/capex/currentoperations established.", "Not everyfield/currentphysicaloperation/paidfunds/issuedpermit/exactITcertified." ], "sources": [ { "url": "https://www.sungazette.com/news/top-news/2026/07/legal-notice-claims-deemed-approval-for-muncy-township-data-center/", "host": "sungazette.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 64", "scope": "The complete retained original Township notice schedules a November 4, 2026 hearing at seven PM on proposed Data Center Ordinance 2026 01 and lists earlier resolutions and review meetings. This retains municipal policy context without independently deciding the exact inherited Muncy computing application. A private deemed approval account is not a read final official disposition. The new request remained held by unavailable robots, so the retained capture keeps its original October 23 retrieval time and is not recertified. The future hearing is not an accomplished vote or permit.", "fields": { "current_stage_evidence": { "outcome": "retained_official_muncy_policy_notice_exact_site_stage_held", "scope": "The complete retained original Township notice schedules a November 4, 2026 hearing at seven PM on proposed Data Center Ordinance 2026 01 and lists earlier resolutions and review meetings. This retains municipal policy context without independently deciding the exact inherited Muncy computing application. A private deemed approval account is not a read final official disposition. The new request remained held by unavailable robots, so the retained capture keeps its original October 23 retrieval time and is not recertified. The future hearing is not an accomplished vote or permit." }, "source_read_scope": { "complete_retained_original_notice_body_read": true, "archival_capture_not_recertified_after_new_transport_hold": true, "municipal_ordinance_hearing_not_exact_site_permission": true, "private_deemed_approval_account_not_adopted": true } }, "notes": [ "The complete retained original Township notice schedules a November 4, 2026 hearing at seven PM on proposed Data Center Ordinance 2026 01 and lists earlier resolutions and review meetings. This retains municipal policy context without independently deciding the exact inherited Muncy computing application. A private deemed approval account is not a read final official disposition. The new request remained held by unavailable robots, so the retained capture keeps its original October 23 retrieval time and is not recertified. The future hearing is not an accomplished vote or permit.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://www.muncytwp.org/data-center-ordinance-agenda/", "host": "www.muncytwp.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Muncy · Lycoming · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42081" } }, { "id": "netrality-401-north-broad-philadelphia-pa", "state": "pa", "kind": "facility", "name": "Netrality 401 North Broad", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Philadelphia" ], "city": "Philadelphia", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Carrier-published label/address context only. Physical operating status, exclusive operator, ownership, IT load and code remain unverified by this source.. Named provider/address context; no current title, capacity, exact suite or whole-building owner independently inspected. List gives no MW, actual occupancy, commissioning dates, title deeds, contracts or independent physical inspections. Listing is not a guarantee of presently deliverable service. Coming Soon labels on Vancouver1050Pender and Watertown486Arsenal have unspecified scope; not adopted as data-center construction or commissioning statuses. Vancouver is outside the United States cohort. Address rows can represent multiple service providers or tenants in one building. Never sum rows as distinct physical buildings or replace ownership/operator fields automatically. Source has ZIP/name spelling inconsistencies, including LumenSunnyvale98108, QTS SantaClara98054, Cambridge02451 and DigitalFortess. Raw values retained; no postal corrections or geocodes inferred. No issue date printed. Filename 20260206 and PDF modification metadata February6,2026 are file/version indicators, not proof of issue date, site commissioning or a field survey that day. PDF title still references November2025 spreadsheet.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.astound.com/business/wp-content/uploads/2026/02/Astound-Business-Data-Center-List-20260206.pdf", "host": "astound.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://netrality.com/data-center/401-north-broad-philadelphia/", "host": "netrality.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Original explicitly identified computing property street" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=401+North+Broad+Street%2C+Suite+210%2C+Philadelphia%2C+PA+19108&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete literal street response and retained county" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-75.1683188303176%2C39.954677288537546%2C-75.1554271696824%2C39.96455871146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting with unknown image acquisition date" } ], "loc": { "lng": -75.161873, "lat": 39.959618, "precision": "address", "basis": "The original Netrality Data Centers source explicitly identifies the computing property street 401 North Broad Street, Suite 210, Philadelphia, PA 19108. One complete unique literal Census street range gives a calculated reference inside the retained county. Existing status group unknown remains unchanged. No roof, tenant floor, title or complete campus is selected. Imagery acquisition date is unknown and may predate construction." }, "reviewed_evidence": [ { "overlay": "national-carrier-list-address-crosswalk-round92-2026-10-15.json", "scope": "Carrier-published label/address context only. Physical operating status, exclusive operator, ownership, IT load and code remain unverified by this source.", "fields": { "listed_label": "Netrality", "listed_address": "401 N Broad St", "listed_city": "Philadelphia", "listed_state": "PA" }, "notes": [ "Named provider/address context; no current title, capacity, exact suite or whole-building owner independently inspected.", "List gives no MW, actual occupancy, commissioning dates, title deeds, contracts or independent physical inspections. Listing is not a guarantee of presently deliverable service.", "Coming Soon labels on Vancouver1050Pender and Watertown486Arsenal have unspecified scope; not adopted as data-center construction or commissioning statuses. Vancouver is outside the United States cohort.", "Address rows can represent multiple service providers or tenants in one building. Never sum rows as distinct physical buildings or replace ownership/operator fields automatically.", "Source has ZIP/name spelling inconsistencies, including LumenSunnyvale98108, QTS SantaClara98054, Cambridge02451 and DigitalFortess. Raw values retained; no postal corrections or geocodes inferred.", "No issue date printed. Filename 20260206 and PDF modification metadata February6,2026 are file/version indicators, not proof of issue date, site commissioning or a field survey that day. PDF title still references November2025 spreadsheet." ], "sources": [ { "url": "https://www.astound.com/business/wp-content/uploads/2026/02/Astound-Business-Data-Center-List-20260206.pdf", "host": "astound.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 59, October 23, 2026", "scope": "Explicit original computing property street and calculated Census range only. Existing status group unknown remains unchanged. No current operation, source role, title, tenant floor, surveyed roof, physical milestone or entire campus is certified.", "fields": { "location_review_decision": { "location": { "lng": -75.161873, "lat": 39.959618, "precision": "address", "basis": "The original Netrality Data Centers source explicitly identifies the computing property street 401 North Broad Street, Suite 210, Philadelphia, PA 19108. One complete unique literal Census street range gives a calculated reference inside the retained county. Existing status group unknown remains unchanged. No roof, tenant floor, title or complete campus is selected. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "401 North Broad Street, Suite 210, Philadelphia, PA 19108", "county_fips": [ "42101" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "Original operator facility body and address block independently identify401NorthBroadPhiladelphia. Suite210is retained as source context, never a floor coordinate, separate building or operation determination.", "Explicit original computing property street and calculated Census range only. Existing status group unknown remains unchanged. No current operation, source role, title, tenant floor, surveyed roof, physical milestone or entire campus is certified.", "Dense urban blocks, roads and large mixed building roofs around the published street. The source computing property is independently named. The imagery establishes only broad setting; no suite coordinate, selected roof, title, operator presence, current physical stage or acquisition date is inferred.", "The inherited area coordinate and county display were not independently reviewed computing property destinations. The original explicitly identified computing property street and complete unique literal Census response support only a calculated range reference inside the retained county. Earlier coordinates and source versions remain intact. This changes the destination reference without physical relocation, a selected roof, title, current computing operation or complete campus certification." ], "sources": [ { "url": "https://netrality.com/data-center/401-north-broad-philadelphia/", "host": "netrality.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Original explicitly identified computing property street" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=401+North+Broad+Street%2C+Suite+210%2C+Philadelphia%2C+PA+19108&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Complete literal street response and retained county" }, { "url": "https://basemap.nationalmap.gov/arcgis/rest/services/USGSImageryOnly/MapServer/export?bbox=-75.1683188303176%2C39.954677288537546%2C-75.1554271696824%2C39.96455871146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "basemap.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Actually viewed setting with unknown image acquisition date" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Calculated official source street reference, not a surveyed roof or parcel", "summary": "Philadelphia · Philadelphia · Source context reviewed" }, { "id": "nova-energy-cryptomine-frenchcreek-venango-county-pa", "state": "pa", "kind": "facility", "name": "Nova Energy Natural Gas-Powered Cryptomine (Frenchcreek Township)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Venango" ], "city": "", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.. Preview only: original permit number, exact location, conditions and Bulletin not inspected. Air permit is not operating proof, all environmental approvals or executed utility service. No MW, actual water, investment, construction or current operation adopted; subscriber material not accessed or decoded. Historical observations and forecasts are dated; no later outcome assumed. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://marcellusdrilling.com/2025/03/gas-fired-cryptocurrency-data-center-coming-to-venango-county-pa/", "host": "marcellusdrilling.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 41.41604, "lng": -79.77449, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round35-2026-10-14.json", "scope": "Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.", "fields": { "reported_context": "Public Marcellus Drilling News preview reports Pennsylvania DEP air-quality permit for Nova Energy LLC cryptocurrency data center, FrenchcreekTownship, VenangoCounty, announced inMarch1PennsylvaniaBulletin.", "independently_verified_current_operating_status": null }, "notes": [ "Preview only: original permit number, exact location, conditions and Bulletin not inspected. Air permit is not operating proof, all environmental approvals or executed utility service. No MW, actual water, investment, construction or current operation adopted; subscriber material not accessed or decoded.", "Historical observations and forecasts are dated; no later outcome assumed.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://marcellusdrilling.com/2025/03/gas-fired-cryptocurrency-data-center-coming-to-venango-county-pa/", "host": "marcellusdrilling.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Venango · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42121" } }, { "id": "panther-creek-hpc-ai-campus-nesquehoning-pa", "state": "pa", "kind": "facility", "name": "Panther Creek HPC/AI Data Center Campus", "group": "approved", "status": "Reported land use approval", "raw_status": "approved", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Carbon" ], "city": "Nesquehoning", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Campus-level issuer context, not proof every imported plant/building ID is independently energized.. Two Panther Creek base labels can describe overlapping plant/campus history, not two independently established physical campuses. No site-by-site new lease or permit outcome inferred from fleet financial disclosure. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-08-10", "Keel published its second quarter development update August 10, 2026, reporting Panther Creek land use approvals and separately discussing mining decommissioning and future HPC construction. The publication does not supply an exact approval day or HPC commissioning date." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-first-quarter-2026-results", "host": "ir.keelinfra.com", "date": "2026-05-11", "published": "2026-05-11", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-second-quarter-2026-results", "host": "ir.keelinfra.com", "published": "2026-08-10", "date": "2026-08-10", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.93162, "lng": -75.72361, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Campus-level issuer context, not proof every imported plant/building ID is independently energized.", "fields": { "announcement_date": "2026-05-11", "quarter_ended": "2026-03-31", "company_claim": "Zoning obtained for Panther Creek, Sharon and Moses Lake; environmental/land-development permits still progressing.", "redomiciliation_parent_transaction_date": "2026-04-01" }, "notes": [ "Two Panther Creek base labels can describe overlapping plant/campus history, not two independently established physical campuses. No site-by-site new lease or permit outcome inferred from fleet financial disclosure.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-first-quarter-2026-results", "host": "ir.keelinfra.com", "date": "2026-05-11", "published": "2026-05-11", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 27", "scope": "Keel August 10, 2026 second quarter results explicitly identify Panther Creek among its development sites. The company expressly qualifies Panther Creek land development approval as conditional. Reported land use approval is limited to that company account. Environmental permit applications are still described as progressing. Company decommissioning of United States Bitcoin mining operations is separate from future HPC construction, customer leases and commissioned HPC service. Neither equipment delivery to another site nor aggregate legacy revenues establishes operation of this HPC proposal. Existing identity, crypto classification, roles and quantities remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "company_reported_named_land_use_approval_not_hpc_operation", "scope": "Keel August 10, 2026 second quarter results explicitly identify Panther Creek among its development sites. The company expressly qualifies Panther Creek land development approval as conditional. Reported land use approval is limited to that company account. Environmental permit applications are still described as progressing. Company decommissioning of United States Bitcoin mining operations is separate from future HPC construction, customer leases and commissioned HPC service. Neither equipment delivery to another site nor aggregate legacy revenues establishes operation of this HPC proposal. Existing identity, crypto classification, roles and quantities remain unchanged." } }, "notes": [ "Keel August 10, 2026 second quarter results explicitly identify Panther Creek among its development sites. The company expressly qualifies Panther Creek land development approval as conditional. Reported land use approval is limited to that company account. Environmental permit applications are still described as progressing. Company decommissioning of United States Bitcoin mining operations is separate from future HPC construction, customer leases and commissioned HPC service. Neither equipment delivery to another site nor aggregate legacy revenues establishes operation of this HPC proposal. Existing identity, crypto classification, roles and quantities remain unchanged.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-first-quarter-2026-results", "host": "ir.keelinfra.com", "published": "2026-05-11", "date": "2026-05-11", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-second-quarter-2026-results", "host": "ir.keelinfra.com", "published": "2026-08-10", "date": "2026-08-10", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Nesquehoning · Carbon · Source context reviewed", "status_scope": "Keel August 10, 2026 second quarter results explicitly identify Panther Creek among its development sites. The company expressly qualifies Panther Creek land development approval as conditional. Reported land use approval is limited to that company account. Environmental permit applications are still described as progressing. Company decommissioning of United States Bitcoin mining operations is separate from future HPC construction, customer leases and commissioned HPC service. Neither equipment delivery to another site nor aggregate legacy revenues establishes operation of this HPC proposal. Existing identity, crypto classification, roles and quantities remain unchanged.", "event_evidence": [ { "date": "2026-08-10", "text": "Keel published its second quarter development update August 10, 2026, reporting Panther Creek land use approvals and separately discussing mining decommissioning and future HPC construction. The publication does not supply an exact approval day or HPC commissioning date.", "kind": "announced", "sources": [ { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-second-quarter-2026-results", "host": "ir.keelinfra.com", "published": "2026-08-10", "date": "2026-08-10", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42025" } }, { "id": "bitfarms-panther-creek-nesquehoning-pa", "state": "pa", "kind": "facility", "name": "Panther Creek Plant", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Carbon" ], "city": "Nesquehoning", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Campus-level issuer context, not proof every imported plant/building ID is independently energized.. Two Panther Creek base labels can describe overlapping plant/campus history, not two independently established physical campuses. No site-by-site new lease or permit outcome inferred from fleet financial disclosure. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-first-quarter-2026-results", "host": "ir.keelinfra.com", "date": "2026-05-11", "published": "2026-05-11", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-second-quarter-2026-results", "host": "ir.keelinfra.com", "published": "2026-08-10", "date": "2026-08-10", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.91816, "lng": -75.70891, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Campus-level issuer context, not proof every imported plant/building ID is independently energized.", "fields": { "announcement_date": "2026-05-11", "quarter_ended": "2026-03-31", "company_claim": "Zoning obtained for Panther Creek, Sharon and Moses Lake; environmental/land-development permits still progressing.", "redomiciliation_parent_transaction_date": "2026-04-01" }, "notes": [ "Two Panther Creek base labels can describe overlapping plant/campus history, not two independently established physical campuses. No site-by-site new lease or permit outcome inferred from fleet financial disclosure.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-first-quarter-2026-results", "host": "ir.keelinfra.com", "date": "2026-05-11", "published": "2026-05-11", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 27", "scope": "Keel second quarter results report decommissioning all United States Bitcoin mining operations in preparation for future HPC construction and conditional land development approval for the Panther Creek development. The inherited Panther Creek Plant record is not merged with the separate HPC campus record. Mining decommissioning does not establish physical closure of a power generating plant, and company aggregate legacy revenues do not prove this component current operation. Exact current component phase and the generating plant relationship remain unclear.", "fields": { "current_stage_evidence": { "outcome": "company_mining_decommissioning_not_generating_plant_shutdown_or_new_hpc_operation", "scope": "Keel second quarter results report decommissioning all United States Bitcoin mining operations in preparation for future HPC construction and conditional land development approval for the Panther Creek development. The inherited Panther Creek Plant record is not merged with the separate HPC campus record. Mining decommissioning does not establish physical closure of a power generating plant, and company aggregate legacy revenues do not prove this component current operation. Exact current component phase and the generating plant relationship remain unclear." } }, "notes": [ "Keel second quarter results report decommissioning all United States Bitcoin mining operations in preparation for future HPC construction and conditional land development approval for the Panther Creek development. The inherited Panther Creek Plant record is not merged with the separate HPC campus record. Mining decommissioning does not establish physical closure of a power generating plant, and company aggregate legacy revenues do not prove this component current operation. Exact current component phase and the generating plant relationship remain unclear.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-first-quarter-2026-results", "host": "ir.keelinfra.com", "published": "2026-05-11", "date": "2026-05-11", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://ir.keelinfra.com/news-releases/news-release-details/keel-infrastructure-reports-second-quarter-2026-results", "host": "ir.keelinfra.com", "published": "2026-08-10", "date": "2026-08-10", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Nesquehoning · Carbon · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42025" } }, { "id": "powerhouse-pax-carlisle-pa", "state": "pa", "kind": "facility", "name": "PAX - Pennsylvania Digital I", "group": "proposed", "status": "Operator listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Cumberland" ], "city": "Carlisle", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.. Original adopted instruments not reviewed here. By-right use and laydown-yard action are not full campus building permit, utility agreement or operation. Site figures694/700/715acres represent differing source scopes; no single canonical parcel footprint selected. Three450MWsubstations/1.35GWinitial/1.8GWexpandable are planned infrastructure figures, not verified criticalIT. USD44millionland purchase not USD15billionbuildout spending; regional USD90billion summit not project capex. September future2025meetings have no assumed outcome; advocacy concerns are attributed. Historical observations and forecasts are dated; no later outcome assumed. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://protectcumberlandcountypa.org/middlesex/", "host": "protectcumberlandcountypa.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.powerhousedata.com/data-center/pax-1", "host": "www.powerhousedata.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.cumberlandcountypa.gov/DocumentCenter/View/54948/Pennsylvania-Digital-PAX-1-Final-SD-Review-Report-2026-03-05", "host": "www.cumberlandcountypa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.16353, "lng": -77.26513, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round35-2026-10-14.json", "scope": "Personally read public named-project context, not whole-record certification. Excluded generic, circular or mismatched sources do not receive manual exact-site credit.", "fields": { "reported_context": "Protect Cumberland County advocacy page reports May30,2025 unanimous3-0 Ordinance3-2025 data-center overlay and September3 comprehensive zoning action for ProjectBolt/PennsylvaniaDigitalI. August11 sketch discussion had no formal submission/no action; August25 recommendation concerned PPLsubstation laydown yard only.", "independently_verified_current_operating_status": null }, "notes": [ "Original adopted instruments not reviewed here. By-right use and laydown-yard action are not full campus building permit, utility agreement or operation. Site figures694/700/715acres represent differing source scopes; no single canonical parcel footprint selected. Three450MWsubstations/1.35GWinitial/1.8GWexpandable are planned infrastructure figures, not verified criticalIT. USD44millionland purchase not USD15billionbuildout spending; regional USD90billion summit not project capex. September future2025meetings have no assumed outcome; advocacy concerns are attributed.", "Historical observations and forecasts are dated; no later outcome assumed.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://protectcumberlandcountypa.org/middlesex/", "host": "protectcumberlandcountypa.org", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 20", "scope": "The current PowerHouse PAX 1 page describes a development timeline, prospective construction and delivery quarters and a future power delivery target. Operator listed development describes that planning claim. Past timeline quarters are not proof that physical construction began. The County subdivision review received March 5, 2026 and reviewed March 16 lists recommendations; Final identifies plan type and does not establish municipal approval or a building permit. No exact current physical building phase, utility delivery or operation is certified.", "fields": { "current_stage_evidence": { "outcome": "operator_timeline_and_subdivision_review_not_accomplished_construction", "scope": "The current PowerHouse PAX 1 page describes a development timeline, prospective construction and delivery quarters and a future power delivery target. Operator listed development describes that planning claim. Past timeline quarters are not proof that physical construction began. The County subdivision review received March 5, 2026 and reviewed March 16 lists recommendations; Final identifies plan type and does not establish municipal approval or a building permit. No exact current physical building phase, utility delivery or operation is certified." }, "source_scope": { "county_plan_number": "P26 147", "county_received_on": "2026-03-05", "county_reviewed_on": "2026-03-16", "filename_date_not_review_date": true, "county_report_pages_read": [ 1, 2 ], "county_report_page_visually_read": 1, "final_plan_type_not_final_approval": true, "expired_forecast_not_accomplished_phase": true } }, "notes": [ "The current PowerHouse PAX 1 page describes a development timeline, prospective construction and delivery quarters and a future power delivery target. Operator listed development describes that planning claim. Past timeline quarters are not proof that physical construction began. The County subdivision review received March 5, 2026 and reviewed March 16 lists recommendations; Final identifies plan type and does not establish municipal approval or a building permit. No exact current physical building phase, utility delivery or operation is certified.", "The review preserves existing physical identity, locations, roles, quantities and opening fields. Source issue dates, review checks and physical milestones remain distinct." ], "sources": [ { "url": "https://www.powerhousedata.com/data-center/pax-1", "host": "www.powerhousedata.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://www.cumberlandcountypa.gov/DocumentCenter/View/54948/Pennsylvania-Digital-PAX-1-Final-SD-Review-Report-2026-03-05", "host": "www.cumberlandcountypa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Carlisle · Cumberland · Source context reviewed", "status_scope": "The current PowerHouse PAX 1 page describes a development timeline, prospective construction and delivery quarters and a future power delivery target. Operator listed development describes that planning claim. Past timeline quarters are not proof that physical construction began. The County subdivision review received March 5, 2026 and reviewed March 16 lists recommendations; Final identifies plan type and does not establish municipal approval or a building permit. No exact current physical building phase, utility delivery or operation is certified.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42041" } }, { "id": "stonebridge-powder-mills-lawrence-county-pa", "state": "pa", "kind": "facility", "name": "Powder Mills Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lawrence" ], "city": "", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. One assessor parcel, not the whole proposed campus.. County GIS returns control 26132000 / tax map 26-1409-102, Powder Mill Works LLC, situs 3478 Howard, assessed acreage 297.06 and calculated acreage 299.12982886. These are different measures on one parcel; neither independently verifies or disproves the inherited 569-acre combined campus. Assessor fields show nominal sale price 1, total assessed value 728000, year built 1967 and square feet 312. Do not promote these to campus acquisition price, investment, data-center opening year or total proposed floor space. No deed, assessment methodology, second parcel, Stonebridge corporate relationship, zoning ruling, remediation clearance or construction approval inspected. Original coordinate system is Pennsylvania State Plane 2272; no unverified conversion or replacement map pin made. Limited context, not full technical or current operating verification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://gis.leoc.net:6443/arcgis/rest/services/LAWRENCEGIS/TaxParcelCAMA/MapServer/1/query?where=CONTROLNUM%3D%2726132000%27&outFields=*&f=json", "host": "gis.leoc.net:6443", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://mahoningtownship.net/author/mahoningtownship1/", "host": "mahoningtownship.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.99123, "lng": -80.33474, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-campus-totals-parcel-scope-and-developer-roles-round89-2026-10-15.json", "scope": "One assessor parcel, not the whole proposed campus.", "fields": {}, "notes": [ "County GIS returns control 26132000 / tax map 26-1409-102, Powder Mill Works LLC, situs 3478 Howard, assessed acreage 297.06 and calculated acreage 299.12982886. These are different measures on one parcel; neither independently verifies or disproves the inherited 569-acre combined campus.", "Assessor fields show nominal sale price 1, total assessed value 728000, year built 1967 and square feet 312. Do not promote these to campus acquisition price, investment, data-center opening year or total proposed floor space. No deed, assessment methodology, second parcel, Stonebridge corporate relationship, zoning ruling, remediation clearance or construction approval inspected.", "Original coordinate system is Pennsylvania State Plane 2272; no unverified conversion or replacement map pin made.", "Limited context, not full technical or current operating verification." ], "sources": [ { "url": "https://gis.leoc.net:6443/arcgis/rest/services/LAWRENCEGIS/TaxParcelCAMA/MapServer/1/query?where=CONTROLNUM%3D%2726132000%27&outFields=*&f=json", "host": "gis.leoc.net:6443", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 64", "scope": "The complete original Township author page contains a past September 15, 2026 notice for an SS Penn appeal concerning its preliminary plan and a June 4 zoning letter for Powder Mill Works property. The selected notice does not identify a final decision or independently describe a computing use. The exact Stonebridge relationship and current computing stage remain unverified. A preliminary plan, promised past vote, parcel ownership account and similarly named properties are not final facility permission, accomplished hearing outcome or physical operation.", "fields": { "current_stage_evidence": { "outcome": "official_powder_mill_plan_appeal_context_exact_compute_stage_held", "scope": "The complete original Township author page contains a past September 15, 2026 notice for an SS Penn appeal concerning its preliminary plan and a June 4 zoning letter for Powder Mill Works property. The selected notice does not identify a final decision or independently describe a computing use. The exact Stonebridge relationship and current computing stage remain unverified. A preliminary plan, promised past vote, parcel ownership account and similarly named properties are not final facility permission, accomplished hearing outcome or physical operation." }, "source_read_scope": { "complete_original_author_notice_and_index_body_read": true, "past_september15_notice_not_accomplished_outcome": true, "notice_not_independent_compute_use_or_stonebridge_role": true, "private_owner_contacts_excluded": true } }, "notes": [ "The complete original Township author page contains a past September 15, 2026 notice for an SS Penn appeal concerning its preliminary plan and a June 4 zoning letter for Powder Mill Works property. The selected notice does not identify a final decision or independently describe a computing use. The exact Stonebridge relationship and current computing stage remain unverified. A preliminary plan, promised past vote, parcel ownership account and similarly named properties are not final facility permission, accomplished hearing outcome or physical operation.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://mahoningtownship.net/author/mahoningtownship1/", "host": "mahoningtownship.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Lawrence · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42073" } }, { "id": "cde-acquisitions-project-atlas-south-whitehall-lehigh-pa", "state": "pa", "kind": "facility", "name": "Project Atlas Data Center Campus (South Whitehall Township)", "group": "proposed", "status": "Permit review underway", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lehigh" ], "city": "South Whitehall Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.. Introductory presentation is not approval; nine-billion-USD investment and sixteen-million annual tax are projections. Claimed avoided cooling water is a modeled comparison, not measured water use; no-cost-to-ratepayer promise not executed utility terms. Subsequent original decisions and current operator disclosures take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.lehighvalleypublicmedia.org/news/local/residents-push-for-public-hearing-as-south-whitehall-takes-new-look-at-hyperscale-data-center/", "host": "lehighvalleypublicmedia.org", "date": "2026-07-14", "published": "2026-07-14", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.6251, "lng": -75.60603, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round24-2026-10-14.json", "scope": "Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.", "fields": { "reported_context": "Lehigh Valley Public Media reports revised South Whitehall Atlas concept of three roughly500000-square-foot buildings instead of six.", "independently_verified_current_operating_status": null }, "notes": [ "Introductory presentation is not approval; nine-billion-USD investment and sixteen-million annual tax are projections. Claimed avoided cooling water is a modeled comparison, not measured water use; no-cost-to-ratepayer promise not executed utility terms.", "Subsequent original decisions and current operator disclosures take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.lehighvalleypublicmedia.org/news/local/residents-push-for-public-hearing-as-south-whitehall-takes-new-look-at-hyperscale-data-center/", "host": "lehighvalleypublicmedia.org", "date": "2026-07-14", "published": "2026-07-14", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "The DEP row explicitly identifies Project Atlas, Edged US and CDE Acquisitions in South Whitehall. Pending environmental review is distinct from final local land use action. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "exact_named_dep_proposal_account_not_physical_commissioning", "scope": "The DEP row explicitly identifies Project Atlas, Edged US and CDE Acquisitions in South Whitehall. Pending environmental review is distinct from final local land use action. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged." }, "tracker_scope": { "project_id": "10000006", "original_project_and_related_permit_csv_read": true, "no_data_center_operation_inferred": true, "no_coordinate_or_role_promotion": true } }, "notes": [ "The DEP row explicitly identifies Project Atlas, Edged US and CDE Acquisitions in South Whitehall. Pending environmental review is distinct from final local land use action. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "South Whitehall Township · Lehigh · Source context reviewed", "status_scope": "The DEP row explicitly identifies Project Atlas, Edged US and CDE Acquisitions in South Whitehall. Pending environmental review is distinct from final local land use action. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42077" } }, { "id": "project-gravity-archbald-lackawanna-county-pa", "state": "pa", "kind": "facility", "name": "Project Gravity", "group": "proposed", "status": "Permit review underway", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lackawanna" ], "city": "Archbald", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named original reporter/issuer context with current versus historical stage explicit.. KatBolus WVIA January8,2026 originalDEPmeetingreport identifiesArchbald25ProjectGravity; developerNOtenantyet andwouldnotconstructwithoutone. Seven135000sftwo-storybuildings/186acres areoneproposedcampus, notsevennewfacilityIDs. TuesdayJanuary6meetingdateinferredfromdatedreport. SeptemberpreliminaryCONDITIONALplanningapproval differsfromfinalconstructionauthorization. Chapter105administrativelycomplete/technicalreview,Chapter102completenessreview,404pending; AIRAPPLICATIONNOTYETRECEIVEDperDEPatmeeting. Laterapproval/currenttenantstatusunknown. Underlyingapplications/minutesnotdirectlyread. 360000gpd isdeveloperESTIMATE, utilityabilitytosupplynotapprovedwithdrawal/actualconsumption. LakeScrantonwater/pumpimprovementsconditional;coolingsystemtenant-specific/notchosen.55/45dBAdeveloperpromise notmeasurednoise.7wetlands/2streams/31waterbodies/2.25acrewetlandsare overlappinglandfeatures, notadditivecampusareas. Mine-spoiledlanddoesnotmeanhazardfree; noactualgroundwater/wildlifeharm inferred. CorporateoldWesternHospitalityPartners-Jermynname notsameascanceledKYproject. Not everyfield/currentphysicaloperation/paidfunds/issuedpermit/exactITcertified.", "date": "", "events": [ [ "2025-12-22", "Pennsylvania DEP published its Project Gravity informational meeting notice December 22, 2025. The notice scheduled a January 6, 2026 meeting and a comment deadline. A past scheduled date does not establish that the meeting occurred or that permits were approved." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wvia.org/news/local/2026-01-08/no-tenant-yet-archbald-data-center-developer-answers-questions-about-project-applications-at-dep-meeting", "host": "wvia.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.pa.gov/agencies/dep/newsroom/2025-12-22-dep-to-host-informational-public-meeting-for-project-gravity-data-center-in-lackawanna-county", "host": "www.pa.gov", "published": "2025-12-22", "date": "2025-12-22", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.41276, "lng": -75.57211, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-opening-land-and-approval-stage-review-round77-2026-10-15.json", "scope": "Named original reporter/issuer context with current versus historical stage explicit.", "fields": {}, "notes": [ "KatBolus WVIA January8,2026 originalDEPmeetingreport identifiesArchbald25ProjectGravity; developerNOtenantyet andwouldnotconstructwithoutone. Seven135000sftwo-storybuildings/186acres areoneproposedcampus, notsevennewfacilityIDs. TuesdayJanuary6meetingdateinferredfromdatedreport.", "SeptemberpreliminaryCONDITIONALplanningapproval differsfromfinalconstructionauthorization. Chapter105administrativelycomplete/technicalreview,Chapter102completenessreview,404pending; AIRAPPLICATIONNOTYETRECEIVEDperDEPatmeeting. Laterapproval/currenttenantstatusunknown. Underlyingapplications/minutesnotdirectlyread.", "360000gpd isdeveloperESTIMATE, utilityabilitytosupplynotapprovedwithdrawal/actualconsumption. LakeScrantonwater/pumpimprovementsconditional;coolingsystemtenant-specific/notchosen.55/45dBAdeveloperpromise notmeasurednoise.7wetlands/2streams/31waterbodies/2.25acrewetlandsare overlappinglandfeatures, notadditivecampusareas. Mine-spoiledlanddoesnotmeanhazardfree; noactualgroundwater/wildlifeharm inferred. CorporateoldWesternHospitalityPartners-Jermynname notsameascanceledKYproject.", "Not everyfield/currentphysicaloperation/paidfunds/issuedpermit/exactITcertified." ], "sources": [ { "url": "https://www.wvia.org/news/local/2026-01-08/no-tenant-yet-archbald-data-center-developer-answers-questions-about-project-applications-at-dep-meeting", "host": "wvia.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 28", "scope": "The current DEP tracker original project CSV identifies Project Gravity as project 10000003 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed.", "fields": { "current_stage_evidence": { "outcome": "current_named_dep_project_permit_review_not_physical_operation", "scope": "The current DEP tracker original project CSV identifies Project Gravity as project 10000003 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed." }, "tracker_scope": { "project_id": "10000003", "project_and_permit_csv_read_together": true, "aggregate_status_not_every_permit_complete": true, "source_coordinates_not_promoted": true, "submitted_day_not_issued_day": true } }, "notes": [ "The current DEP tracker original project CSV identifies Project Gravity as project 10000003 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.pa.gov/agencies/dep/newsroom/2025-12-22-dep-to-host-informational-public-meeting-for-project-gravity-data-center-in-lackawanna-county", "host": "www.pa.gov", "published": "2025-12-22", "date": "2025-12-22", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Archbald · Lackawanna · Source context reviewed", "status_scope": "The current DEP tracker original project CSV identifies Project Gravity as project 10000003 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed.", "event_evidence": [ { "date": "2025-12-22", "text": "Pennsylvania DEP published its Project Gravity informational meeting notice December 22, 2025. The notice scheduled a January 6, 2026 meeting and a comment deadline. A past scheduled date does not establish that the meeting occurred or that permits were approved.", "kind": "announced", "sources": [ { "url": "https://www.pa.gov/agencies/dep/newsroom/2025-12-22-dep-to-host-informational-public-meeting-for-project-gravity-data-center-in-lackawanna-county", "host": "www.pa.gov", "published": "2025-12-22", "date": "2025-12-22", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42069" } }, { "id": "project-hazelnut-hazle-township-pa", "state": "pa", "kind": "facility", "name": "Project Hazelnut", "group": "proposed", "status": "Project listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Luzerne" ], "city": "Hazle Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Hazelnut contingent developer community funding and jobs conflict. 45+15+105=165Mpledgecomponentsnot330M. Fundsnotpaid/grantsnotuniversallyeligible. Jobheadlineversusdetailedtotalconflict,holdcanonical. Noobservedconservationdeed,currentoperations,ITMWorbuildingarea. Eventyearnotinbanner;do notcalendarOctober22,2026withoutdatedcorroborationorcallitgovernmenthearing. No RSVP/petition/formsubmitted. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://projecthazelnut.com/", "host": "projecthazelnut.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "loc": { "lat": 41.13993, "lng": -75.98592, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "operator-primary-review-round10-2026-10-14.json", "scope": "Hazelnut contingent developer community funding and jobs conflict", "fields": { "developer": "NorthPoint", "project": "Project Hazelnut", "location": "Hazle Township, Pennsylvania", "community_benefit_commitment_total_usd": 165000000, "resident_grant_fund_usd": 45000000, "per_eligible_household_grant_usd": 10000, "community_support_fund_usd": 15000000, "longterm_community_commitment_usd": 105000000, "annual_longterm_component_usd": 7000000, "longterm_years": 15, "benefit_availability_trigger": "first building operational", "planned_conserved_forest_open_space_acres_approx": 1100, "jobs_forecast_conflict": [ "2000constructionandoperationalcombined", "1300plusconstructionand950pluspermanent" ], "undated_event_banner": { "month_day": "10-22", "time": "17:00to19:00", "venue": "Maple Manor Elementary School", "event_type": "community open house", "year": null } }, "notes": [ "45+15+105=165Mpledgecomponentsnot330M. Fundsnotpaid/grantsnotuniversallyeligible. Jobheadlineversusdetailedtotalconflict,holdcanonical. Noobservedconservationdeed,currentoperations,ITMWorbuildingarea. Eventyearnotinbanner;do notcalendarOctober22,2026withoutdatedcorroborationorcallitgovernmenthearing. No RSVP/petition/formsubmitted.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://projecthazelnut.com/", "host": "projecthazelnut.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 27", "scope": "The current Project Hazelnut site describes the NorthPoint campus project and future community benefits that would begin when its first building becomes operational. Proposed records that named development account, not actual commissioning, grant payments or independently measured water, forest or jobs outcomes. An October 22 open house banner is not proof the event occurred and supplies no year in the captured substantive banner. No accomplished hearing, opening or precise physical start is inferred.", "fields": { "current_stage_evidence": { "outcome": "current_named_hazelnut_development_account_with_conditional_future_benefits", "scope": "The current Project Hazelnut site describes the NorthPoint campus project and future community benefits that would begin when its first building becomes operational. Proposed records that named development account, not actual commissioning, grant payments or independently measured water, forest or jobs outcomes. An October 22 open house banner is not proof the event occurred and supplies no year in the captured substantive banner. No accomplished hearing, opening or precise physical start is inferred." } }, "notes": [ "The current Project Hazelnut site describes the NorthPoint campus project and future community benefits that would begin when its first building becomes operational. Proposed records that named development account, not actual commissioning, grant payments or independently measured water, forest or jobs outcomes. An October 22 open house banner is not proof the event occurred and supplies no year in the captured substantive banner. No accomplished hearing, opening or precise physical start is inferred.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://projecthazelnut.com/", "host": "projecthazelnut.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Hazle Township · Luzerne · Source context reviewed", "status_scope": "The current Project Hazelnut site describes the NorthPoint campus project and future community benefits that would begin when its first building becomes operational. Proposed records that named development account, not actual commissioning, grant payments or independently measured water, forest or jobs outcomes. An October 22 open house banner is not proof the event occurred and supplies no year in the captured substantive banner. No accomplished hearing, opening or precise physical start is inferred.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42079" } }, { "id": "iep-hummingbird-data-center-campus-greene-county-pa", "state": "pa", "kind": "facility", "name": "Project Hummingbird Data Center Campus (former Robena Mine)", "group": "proposed", "status": "Project listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Greene" ], "city": "Greensboro", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. Observed earthwork is described as ordinary owner reclamation, not data-center construction. The 910 MW figure is planned generation; 18 MGD is treatment capacity serving generation and computing, not measured DC consumption. The community-benefit agreement is unfinished and no end tenant is identified. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.observer-reporter.com/news/local-news/2026/sep/25/monongahela-township-residents-seek-more-chances-for-input-on-data-center-project/", "host": "observer-reporter.com", "date": "2026-09-25", "published": "2026-09-25", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://iepwr.com/227-2/", "host": "iepwr.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 39.85382, "lng": -80.22282, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round27-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "The Observer-Reporter reports the Hummingbird proposal at the Robena Mine property, while the township says project work has not advanced since the December reclamation approval.", "independently_verified_current_operating_status": null }, "notes": [ "Observed earthwork is described as ordinary owner reclamation, not data-center construction. The 910 MW figure is planned generation; 18 MGD is treatment capacity serving generation and computing, not measured DC consumption. The community-benefit agreement is unfinished and no end tenant is identified.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.observer-reporter.com/news/local-news/2026/sep/25/monongahela-township-residents-seek-more-chances-for-input-on-data-center-project/", "host": "observer-reporter.com", "date": "2026-09-25", "published": "2026-09-25", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 28", "scope": "International Electric Power current Hummingbird page describes future data center and power development with later power and turbine delivery targets. DEP original project CSV identifies project 10000017 as proposed with no applications received in that tracker account. Proposed records that specific company and agency proposal account. The tracker does not establish absence of every local or other agency application. Future delivery, grid reliability, utility cost and job claims are not accomplished outcomes. Exact phase, coordinates, end user, provider roles and technical quantities are not promoted from marketing.", "fields": { "current_stage_evidence": { "outcome": "named_hummingbird_proposal_with_bounded_dep_no_application_account", "scope": "International Electric Power current Hummingbird page describes future data center and power development with later power and turbine delivery targets. DEP original project CSV identifies project 10000017 as proposed with no applications received in that tracker account. Proposed records that specific company and agency proposal account. The tracker does not establish absence of every local or other agency application. Future delivery, grid reliability, utility cost and job claims are not accomplished outcomes. Exact phase, coordinates, end user, provider roles and technical quantities are not promoted from marketing." } }, "notes": [ "International Electric Power current Hummingbird page describes future data center and power development with later power and turbine delivery targets. DEP original project CSV identifies project 10000017 as proposed with no applications received in that tracker account. Proposed records that specific company and agency proposal account. The tracker does not establish absence of every local or other agency application. Future delivery, grid reliability, utility cost and job claims are not accomplished outcomes. Exact phase, coordinates, end user, provider roles and technical quantities are not promoted from marketing.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://iepwr.com/227-2/", "host": "iepwr.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Greensboro · Greene · Source context reviewed", "status_scope": "International Electric Power current Hummingbird page describes future data center and power development with later power and turbine delivery targets. DEP original project CSV identifies project 10000017 as proposed with no applications received in that tracker account. Proposed records that specific company and agency proposal account. The tracker does not establish absence of every local or other agency application. Future delivery, grid reliability, utility cost and job claims are not accomplished outcomes. Exact phase, coordinates, end user, provider roles and technical quantities are not promoted from marketing.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42059" } }, { "id": "prologis-allen-township-northampton-pa", "state": "pa", "kind": "facility", "name": "Prologis Allen Township Data Center (2500 Liberty Drive)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Northampton" ], "city": "Allen Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. The regional letter recommendation is not the same vote or all permits. Existing warehouse floor area does not establish powered/occupied DC area. Water, cooling, noise and electrical demands were still questions. A likely-first regional description is not an independently verified superlative or operating status. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.lehighvalleypublicmedia.org/northampton-county/allen-township-warehouse-could-become-lehigh-valleys-first-hyperscale-data-center", "host": "lehighvalleypublicmedia.org", "date": "2026-04-22", "published": "2026-04-22", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.75455, "lng": -75.30748, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round30-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "Lehigh Valley Public Media reports Allen Township's March approval for a Prologis warehouse conversion and a regional planning committee's request for more operational/resource details.", "independently_verified_current_operating_status": null }, "notes": [ "The regional letter recommendation is not the same vote or all permits. Existing warehouse floor area does not establish powered/occupied DC area. Water, cooling, noise and electrical demands were still questions. A likely-first regional description is not an independently verified superlative or operating status.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.lehighvalleypublicmedia.org/northampton-county/allen-township-warehouse-could-become-lehigh-valleys-first-hyperscale-data-center", "host": "lehighvalleypublicmedia.org", "date": "2026-04-22", "published": "2026-04-22", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "DEP lists an unnamed Verdantas and Prologis proposal in Allen Township without the inherited 2500 Liberty Drive address. An accepted original exact component crosswalk was not established. A shared company and municipality alone does not prove current physical stage at that individual warehouse conversion. Regional permit context remains separate from the individual project. Existing identity, roles, quantities and locations remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "broad_company_and_municipality_row_without_accepted_individual_component_crosswalk", "scope": "DEP lists an unnamed Verdantas and Prologis proposal in Allen Township without the inherited 2500 Liberty Drive address. An accepted original exact component crosswalk was not established. A shared company and municipality alone does not prove current physical stage at that individual warehouse conversion. Regional permit context remains separate from the individual project. Existing identity, roles, quantities and locations remain unchanged." }, "tracker_scope": { "project_id": "10000034", "original_project_and_related_permit_csv_read": true, "no_data_center_operation_inferred": true, "no_coordinate_or_role_promotion": true, "individual_component_crosswalk_accepted": false } }, "notes": [ "DEP lists an unnamed Verdantas and Prologis proposal in Allen Township without the inherited 2500 Liberty Drive address. An accepted original exact component crosswalk was not established. A shared company and municipality alone does not prove current physical stage at that individual warehouse conversion. Regional permit context remains separate from the individual project. Existing identity, roles, quantities and locations remain unchanged.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Allen Township · Northampton · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42095" } }, { "id": "qts-salem-township-luzerne-pa", "state": "pa", "kind": "facility", "name": "QTS Salem Township Data Center Campus (Salem 2)", "group": "proposed", "status": "Developer-listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Luzerne" ], "city": "Salem Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.. The reported more-than500-million-USD Salem2land proceeds are not full construction cost or Salem3spending. Salem3land-value descriptions differ at1.2/1.4billion; retain conflict. Developer survey results are self-reported from78respondents, not an independent regional economic-impact study. Generic pay ranges and statewide forecasts are not actual site jobs. Later hearing outcomes, critical IT and contractual nuclear supply are not independently verified. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.timesleader.com/news/1752841/developers-tout-impacts-of-3-data-center-campuses-zoning-meeting-set-for-wednesday-on-4-3-glenbrook-group-project", "host": "timesleader.com", "date": "2026-08-22", "published": "2026-08-22", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://q.com/data-centers/salem-township/", "host": "q.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "loc": { "lat": 41.21295, "lng": -75.96152, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round32-2026-10-14.json", "scope": "Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.", "fields": { "reported_context": "The Times Leader separates Salem's AWS campus, QTS/4-3Salem2land transaction and proposed4-3GlennbrookSalem3campus, with the latter awaiting an overlay decision.", "independently_verified_current_operating_status": null }, "notes": [ "The reported more-than500-million-USD Salem2land proceeds are not full construction cost or Salem3spending. Salem3land-value descriptions differ at1.2/1.4billion; retain conflict. Developer survey results are self-reported from78respondents, not an independent regional economic-impact study. Generic pay ranges and statewide forecasts are not actual site jobs. Later hearing outcomes, critical IT and contractual nuclear supply are not independently verified.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.timesleader.com/news/1752841/developers-tout-impacts-of-3-data-center-campuses-zoning-meeting-set-for-wednesday-on-4-3-glenbrook-group-project", "host": "timesleader.com", "date": "2026-08-22", "published": "2026-08-22", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 5", "scope": "QTS describes its named Salem Township campus as proposed and in early planning. This is the QTS proposal only, separate from the AWS campus and the 4 3 Glenbrook proposal. It does not establish final permitting, a construction start, operation or the fulfillment of forecast investment and jobs.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_proposal", "scope": "QTS describes its named Salem Township campus as proposed and in early planning. This is the QTS proposal only, separate from the AWS campus and the 4 3 Glenbrook proposal. It does not establish final permitting, a construction start, operation or the fulfillment of forecast investment and jobs." } }, "notes": [ "QTS describes its named Salem Township campus as proposed and in early planning. This is the QTS proposal only, separate from the AWS campus and the 4 3 Glenbrook proposal. It does not establish final permitting, a construction start, operation or the fulfillment of forecast investment and jobs.", "An agency decision or a source publication date does not certify an opening, a physical site count or a technical quantity." ], "sources": [ { "url": "https://q.com/data-centers/salem-township/", "host": "q.com", "published": "", "date": "", "checked": "2026-10-22", "label": "Reviewed operator source" } ], "checked": "2026-10-22", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Salem Township · Luzerne · Source context reviewed", "status_scope": "QTS describes its named Salem Township campus as proposed and in early planning. This is the QTS proposal only, separate from the AWS campus and the 4 3 Glenbrook proposal. It does not establish final permitting, a construction start, operation or the fulfillment of forecast investment and jobs.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42079" } }, { "id": "renaissance-park-upper-merion-king-of-prussia-pa", "state": "pa", "kind": "facility", "name": "Renaissance Park and Innovation Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Montgomery" ], "city": "King of Prussia", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.. LelandPinder WPVI July23,2026 originalUpperMerionmeetingreport: Renaissancefive-site4.6Msfproposal,THREErevisedapplicationsreviewedWednesdayJuly22,remainingtwoAugust12future. Notfiveapprovedcampuses/permits/RFS. TownshipmanagerassertsapplicationsvestedbeforeMarchordinance; originalfilings/ordinance/courtvalidityunread, notcurrentlegalcertification. Publicoppositiondoesnotestablishhealthharm. No ITMW/capex/nameenduserconfirmed. Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://6abc.com/post/proposed-king-prussia-data-center-campus-faces-renewed-scrutiny-review-continues/19560357/", "host": "6abc.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.17774, "lng": -75.36437, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-acquisitions-regulatory-stage-and-site-crosswalks-round81-2026-10-15.json", "scope": "Original named-site/context, some road-and-footprint crosswalks limited; not independently certified operator/parcel.", "fields": {}, "notes": [ "LelandPinder WPVI July23,2026 originalUpperMerionmeetingreport: Renaissancefive-site4.6Msfproposal,THREErevisedapplicationsreviewedWednesdayJuly22,remainingtwoAugust12future. Notfiveapprovedcampuses/permits/RFS.", "TownshipmanagerassertsapplicationsvestedbeforeMarchordinance; originalfilings/ordinance/courtvalidityunread, notcurrentlegalcertification. Publicoppositiondoesnotestablishhealthharm. No ITMW/capex/nameenduserconfirmed.", "Acquisition/proposeduse/phasepower/regulatorreview/explicitstagepreserved, not allfields/IT/currentoperationcertified." ], "sources": [ { "url": "https://6abc.com/post/proposed-king-prussia-data-center-campus-faces-renewed-scrutiny-review-continues/19560357/", "host": "6abc.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "The DEP snapshot separately lists several MLP Ventures Upper Merion street components. No accepted exact crosswalk binds the inherited combined Renaissance Park and Innovation campus to all or only some of those rows. Multiple current street proposals do not become a single verified campus physical phase. No identity, jurisdiction, provider role, status or location change is adopted.", "fields": { "current_stage_evidence": { "outcome": "combined_or_different_project_row_or_current_legal_outcome_held", "scope": "The DEP snapshot separately lists several MLP Ventures Upper Merion street components. No accepted exact crosswalk binds the inherited combined Renaissance Park and Innovation campus to all or only some of those rows. Multiple current street proposals do not become a single verified campus physical phase. No identity, jurisdiction, provider role, status or location change is adopted." } }, "notes": [ "The DEP snapshot separately lists several MLP Ventures Upper Merion street components. No accepted exact crosswalk binds the inherited combined Renaissance Park and Innovation campus to all or only some of those rows. Multiple current street proposals do not become a single verified campus physical phase. No identity, jurisdiction, provider role, status or location change is adopted.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "King of Prussia · Montgomery · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42091" } }, { "id": "bitfarms-scrubgrass-kennerdell-pa", "state": "pa", "kind": "facility", "name": "Scrubgrass Generating Plant", "group": "proposed", "status": "AI redevelopment planned", "raw_status": "proposed", "status_field": "current_status", "crypto": true, "type": "Crypto/HPC (inventory classification)", "counties": [ "Venango" ], "city": "Kennerdell", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.. Potential expansion, studies and behind-the-meter generation are not energized AI capacity. September2026 ash-removal deadline is not proof completion; issuer original sources reviewed separately. Original executed approvals, current operator disclosures and subsequent decisions take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building. Potential operator development scale, not actual critical IT demand.. Scrubgrass page repeats project-update cards explicitly labelled Moses Lake or Sharon. Those concrete pours, piping and equipment deliveries are not Scrubgrass milestones. No project partners announced in this page.", "date": "", "events": [ [ "2026-06-29", "Keel’s second-quarter filing reports that Bitcoin mining at Scrubgrass ceased on June 29, 2026 while energy sales continued. This closes the mining activity, not the entire power site; future HPC/AI development is separate." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.exploreclarion.com/local/2026/06/02/scrubgrass-could-become-areas-largest-ai-data-center-campus-866965/", "host": "exploreclarion.com", "date": "2026-06-02", "published": "2026-06-02", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.keelinfra.com/campuses/scrubgrass", "host": "keelinfra.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://ir.keelinfra.com/static-files/8ca60e67-771d-4b01-9f19-725026877e1a", "host": "ir.keelinfra.com", "published": "", "date": "", "checked": "2026-10-16", "label": "Reviewed primary filing" } ], "loc": { "lat": 41.40074, "lng": -79.75779, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Named-site excerpt/source review; historical or proposed claims remain attributed. No entire-record certification.", "fields": { "reported_context": "ExploreClarion describes Keel/Bitfarms Scrubgrass AI development opportunity alongside existing crypto/power activity.", "independently_verified_current_operating_status": null }, "notes": [ "Potential expansion, studies and behind-the-meter generation are not energized AI capacity. September2026 ash-removal deadline is not proof completion; issuer original sources reviewed separately.", "Original executed approvals, current operator disclosures and subsequent decisions take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.exploreclarion.com/local/2026/06/02/scrubgrass-could-become-areas-largest-ai-data-center-campus-866965/", "host": "exploreclarion.com", "date": "2026-06-02", "published": "2026-06-02", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "regional-development-review-round22-2026-10-14.json", "scope": "Potential operator development scale, not actual critical IT demand.", "fields": { "operator_advertised_expansion_capacity_gw_up_to": 1.3, "advertised_site_acres": 650, "stage": "Long-term pre-development and power planning", "current_commissioned_hpc_capacity_mw": null }, "notes": [ "Scrubgrass page repeats project-update cards explicitly labelled Moses Lake or Sharon. Those concrete pours, piping and equipment deliveries are not Scrubgrass milestones. No project partners announced in this page.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.keelinfra.com/campuses/scrubgrass", "host": "keelinfra.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "overnight-status-2026-10-16", "scope": "Named project and operator-service status review; phase and source limits retained.", "fields": { "current_stage_evidence": { "outcome": "supported_label", "label": "AI redevelopment planned", "basis": "Keel’s current Scrubgrass page describes pre-development and power planning for future HPC/AI infrastructure. Its signed second-quarter filing states that Scrubgrass Bitcoin mining ceased on June 29, 2026 while energy sales continued.", "checked_on": "2026-10-16" }, "stage_review_limits": "The mining cessation is not closure of the entire power site. Energy-generation capacity is not IT capacity, and the long-term expansion envelope is not operating AI service. The older Bitfarms label remains in identity history; no physical-site merge or provider-role promotion is made." }, "notes": [ "The mining cessation is not closure of the entire power site. Energy-generation capacity is not IT capacity, and the long-term expansion envelope is not operating AI service. The older Bitfarms label remains in identity history; no physical-site merge or provider-role promotion is made.", "Current service and project labels are source-scoped research contexts. No entire record, physical site, technical quantity or exact parcel is certified." ], "sources": [ { "url": "https://www.keelinfra.com/campuses/scrubgrass", "host": "www.keelinfra.com", "published": "", "date": "", "checked": "2026-10-16", "label": "Reviewed current operator evidence" }, { "url": "https://ir.keelinfra.com/static-files/8ca60e67-771d-4b01-9f19-725026877e1a", "host": "ir.keelinfra.com", "published": "", "date": "", "checked": "2026-10-16", "label": "Reviewed primary filing" } ], "checked": "2026-10-16", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Kennerdell · Venango · Source context reviewed", "status_scope": "Primary source review checked 2026-10-16. Keel’s current Scrubgrass page describes pre-development and power planning for future HPC/AI infrastructure. Its signed second-quarter filing states that Scrubgrass Bitcoin mining ceased on June 29, 2026 while energy sales continued. The mining cessation is not closure of the entire power site. Energy-generation capacity is not IT capacity, and the long-term expansion envelope is not operating AI service. The older Bitfarms label remains in identity history; no physical-site merge or provider-role promotion is made.", "event_evidence": [ { "date": "2026-06-29", "text": "Keel’s second-quarter filing reports that Bitcoin mining at Scrubgrass ceased on June 29, 2026 while energy sales continued. This closes the mining activity, not the entire power site; future HPC/AI development is separate.", "kind": "closed", "sources": [ { "url": "https://ir.keelinfra.com/static-files/8ca60e67-771d-4b01-9f19-725026877e1a", "host": "ir.keelinfra.com", "published": "", "date": "", "checked": "2026-10-16", "label": "Reviewed primary filing" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42121" } }, { "id": "sentinel-east-whiteland-chester-county-pa", "state": "pa", "kind": "facility", "name": "Sentinel East Whiteland Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Chester" ], "city": "East Whiteland Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named-site context, with limited previews/corridor crosswalks explicitly identified.. Brooke Schultz, Inquirer June 11, 2026 original court/developer reporting: two appeals over East Whiteland 2018 zoning and 2024 plans quashed as untimely/nonappealable; not a merits finding of no environmental risk or every permit approved. Original orders/case numbers not inspected. 1.5 million square feet is a proposal; former attempt to add 600,000 square feet was abandoned, not additive current floor space. Stormwater work in adjacent West Whiteland and perimeter work do not establish all building construction complete. July 30 follow-up source 27 changes the work-stage narrative. Not all fields, current operation, precise parcel or critical IT independently certified. Brooke Schultz, Inquirer July 30, 2026 original township/developer interviews: work RESUMED Wednesday July 29 (calendar inference), following a temporary July stop. Township erosion/sedimentation permit allows EARTHMOVING with monitoring/dust/remedy conditions; footing/foundation construction permits still needed. No blanket all-construction approval. Possible redesign from 1.5 million to 536,000 square feet and lower-water air chillers was TABLED July 8; August 19 future meeting, not an adopted redesign/outcome. 3 million gallons/day belongs to the earlier water-cooled design, not measured current use or final new design. No implication Superfund cleanup or health impacts independently certified.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.inquirer.com/news/pennsylvania/east-whiteland-data-center-judge-denial-challenges-20260611.html", "host": "inquirer.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.inquirer.com/news/pennsylvania/east-whiteland-data-center-project-20260730.html", "host": "inquirer.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 39.97312, "lng": -75.74824, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-permit-scope-operator-crosswalks-and-work-resumption-round82-2026-10-15.json", "scope": "Named-site context, with limited previews/corridor crosswalks explicitly identified.", "fields": {}, "notes": [ "Brooke Schultz, Inquirer June 11, 2026 original court/developer reporting: two appeals over East Whiteland 2018 zoning and 2024 plans quashed as untimely/nonappealable; not a merits finding of no environmental risk or every permit approved. Original orders/case numbers not inspected. 1.5 million square feet is a proposal; former attempt to add 600,000 square feet was abandoned, not additive current floor space. Stormwater work in adjacent West Whiteland and perimeter work do not establish all building construction complete. July 30 follow-up source 27 changes the work-stage narrative.", "Not all fields, current operation, precise parcel or critical IT independently certified." ], "sources": [ { "url": "https://www.inquirer.com/news/pennsylvania/east-whiteland-data-center-judge-denial-challenges-20260611.html", "host": "inquirer.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "national-permit-scope-operator-crosswalks-and-work-resumption-round82-2026-10-15.json", "scope": "Named-site context, with limited previews/corridor crosswalks explicitly identified.", "fields": {}, "notes": [ "Brooke Schultz, Inquirer July 30, 2026 original township/developer interviews: work RESUMED Wednesday July 29 (calendar inference), following a temporary July stop. Township erosion/sedimentation permit allows EARTHMOVING with monitoring/dust/remedy conditions; footing/foundation construction permits still needed. No blanket all-construction approval. Possible redesign from 1.5 million to 536,000 square feet and lower-water air chillers was TABLED July 8; August 19 future meeting, not an adopted redesign/outcome. 3 million gallons/day belongs to the earlier water-cooled design, not measured current use or final new design. No implication Superfund cleanup or health impacts independently certified.", "Not all fields, current operation, precise parcel or critical IT independently certified." ], "sources": [ { "url": "https://www.inquirer.com/news/pennsylvania/east-whiteland-data-center-project-20260730.html", "host": "inquirer.com", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "DEP lists Project Forge and Sentinel Green Fig under permit review, but that regulatory listing does not resolve the separately reported current zoning litigation or local entitlement. A captured primary current court disposition was not obtained. An older Superior Court mechanics lien opinion concerns a different issue and is not substituted. Current exact project stage remains unclear. No identity, jurisdiction, provider role, status or location change is adopted.", "fields": { "current_stage_evidence": { "outcome": "combined_or_different_project_row_or_current_legal_outcome_held", "scope": "DEP lists Project Forge and Sentinel Green Fig under permit review, but that regulatory listing does not resolve the separately reported current zoning litigation or local entitlement. A captured primary current court disposition was not obtained. An older Superior Court mechanics lien opinion concerns a different issue and is not substituted. Current exact project stage remains unclear. No identity, jurisdiction, provider role, status or location change is adopted." } }, "notes": [ "DEP lists Project Forge and Sentinel Green Fig under permit review, but that regulatory listing does not resolve the separately reported current zoning litigation or local entitlement. A captured primary current court disposition was not obtained. An older Superior Court mechanics lien opinion concerns a different issue and is not substituted. Current exact project stage remains unclear. No identity, jurisdiction, provider role, status or location change is adopted.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "East Whiteland Township · Chester · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42029" } }, { "id": "aligned-shippingport-pa", "state": "pa", "kind": "facility", "name": "Shippingport Industrial Park", "group": "proposed", "status": "Permit review underway", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Beaver" ], "city": "Shippingport", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Shippingport guest opinion source-role correction. Opinionarticleisnotagencyapproval/order. Claimedthreeapprovals requireoriginalpermitinspection; no adopteddate/powerbasisfromopinion. Generalhealthrisksnotproofsite-specificillness,airviolation oractualbills. No exactAlignedoperatorcrosswalk,currentcommissioning orcriticalITMW. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-09-10", "Aligned published its Project Phoenix Shippingport groundbreaking announcement September 10, 2026. This records the dated company announcement and ceremony account, not independent verification of excavation, completion of planned blasting or operating data center service." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://community.triblive.com/news/3990268", "host": "community.triblive.com", "date": "2026-02-26", "published": "2026-02-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://aligneddc.com/press-release/project-phoenix-data-center-shippingport-pa/", "host": "aligneddc.com", "published": "2026-09-10", "date": "2026-09-10", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://aligneddc.com/shippingport-pa-data-center/", "host": "aligneddc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.68235, "lng": -80.34949, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round13-2026-10-14.json", "scope": "Shippingport guest opinion source-role correction", "fields": { "publisher_role": "guest opinion by EnvironmentalHealthProject communications manager", "reported_project_location": "nearformerBruceMansfieldplant, Shippingport, BeaverCounty, Pennsylvania", "reported_proposed_buildings_max": 3, "reported_each_building_sqft_min_exclusive": 600000, "reported_components": [ "data centers", "warehouse", "natural-gas generation pad" ] }, "notes": [ "Opinionarticleisnotagencyapproval/order. Claimedthreeapprovals requireoriginalpermitinspection; no adopteddate/powerbasisfromopinion. Generalhealthrisksnotproofsite-specificillness,airviolation oractualbills. No exactAlignedoperatorcrosswalk,currentcommissioning orcriticalITMW.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://community.triblive.com/news/3990268", "host": "community.triblive.com", "date": "2026-02-26", "published": "2026-02-26", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 28", "scope": "DEP original project CSV separately lists Aligned Shippingport Phase 1 and Phase 2 under permit review. The company September 10, 2026 release announces a groundbreaking, while its current construction update provides a rescheduled blasting look ahead. Permit review underway describes that documented regulatory stage for the new campus proposals. The ceremony and passed forecast dates do not independently verify actual excavation, completion of any listed blast, delivered power or operating service. Two tracker phases are not merged into a claim that every campus building has the same physical status. Advertised water, power and community benefits are not measured outcomes.", "fields": { "current_stage_evidence": { "outcome": "named_shippingport_phase_permit_review_and_company_schedule_not_accomplished_work", "scope": "DEP original project CSV separately lists Aligned Shippingport Phase 1 and Phase 2 under permit review. The company September 10, 2026 release announces a groundbreaking, while its current construction update provides a rescheduled blasting look ahead. Permit review underway describes that documented regulatory stage for the new campus proposals. The ceremony and passed forecast dates do not independently verify actual excavation, completion of any listed blast, delivered power or operating service. Two tracker phases are not merged into a claim that every campus building has the same physical status. Advertised water, power and community benefits are not measured outcomes." }, "tracker_scope": { "project_ids": [ "10000014", "10000068" ], "different_phases_not_collapsed": true, "future_or_passed_schedule_not_accomplished_work": true } }, "notes": [ "DEP original project CSV separately lists Aligned Shippingport Phase 1 and Phase 2 under permit review. The company September 10, 2026 release announces a groundbreaking, while its current construction update provides a rescheduled blasting look ahead. Permit review underway describes that documented regulatory stage for the new campus proposals. The ceremony and passed forecast dates do not independently verify actual excavation, completion of any listed blast, delivered power or operating service. Two tracker phases are not merged into a claim that every campus building has the same physical status. Advertised water, power and community benefits are not measured outcomes.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://aligneddc.com/press-release/project-phoenix-data-center-shippingport-pa/", "host": "aligneddc.com", "published": "2026-09-10", "date": "2026-09-10", "checked": "2026-10-23", "label": "Reviewed operator source" }, { "url": "https://aligneddc.com/shippingport-pa-data-center/", "host": "aligneddc.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Shippingport · Beaver · Source context reviewed", "status_scope": "DEP original project CSV separately lists Aligned Shippingport Phase 1 and Phase 2 under permit review. The company September 10, 2026 release announces a groundbreaking, while its current construction update provides a rescheduled blasting look ahead. Permit review underway describes that documented regulatory stage for the new campus proposals. The ceremony and passed forecast dates do not independently verify actual excavation, completion of any listed blast, delivered power or operating service. Two tracker phases are not merged into a claim that every campus building has the same physical status. Advertised water, power and community benefits are not measured outcomes.", "event_evidence": [ { "date": "2026-09-10", "text": "Aligned published its Project Phoenix Shippingport groundbreaking announcement September 10, 2026. This records the dated company announcement and ceremony account, not independent verification of excavation, completion of planned blasting or operating data center service.", "kind": "announced", "sources": [ { "url": "https://aligneddc.com/press-release/project-phoenix-data-center-shippingport-pa/", "host": "aligneddc.com", "published": "2026-09-10", "date": "2026-09-10", "checked": "2026-10-23", "label": "Reviewed operator source" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42007" } }, { "id": "slate-belt-holdings-upper-mount-bethel-northampton-pa", "state": "pa", "kind": "facility", "name": "Slate Belt Holdings Data Center Campus (Upper Mount Bethel)", "group": "proposed", "status": "Listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Northampton" ], "city": "Upper Mount Bethel Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.. Reported 754-acre purchase and submitted plans are not approved data center construction. Planned 480 MW SUBSTATION is not critical IT; nearby Talen 607 MW natural-gas plant is separate generation. Historical 15-building/six-million-square-foot and 168 MW descriptions concern prior development scope, not additive current campus capacity. Amazon’s prior reported discussions and withdrawal of interest do not establish a committed tenant. Other Susquehanna/Amazon operating campus and Montour denial are separate projects. Court challenge is not a ruling; no approval/RFS adopted. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.bicmagazine.com/departments/AI-Infrastructure/talen-looks-to-develop-23-building-data-center-campus-in-pennsylvania/", "host": "bicmagazine.com", "date": "2026-08-10", "published": "2026-08-10", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.umbt.org/", "host": "www.umbt.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.umbt.org/wp-content/uploads/Memorandum-of-Understanding-4908-3404-7178-v1.pdf", "host": "www.umbt.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.umbt.org/wp-content/uploads/UMBT-ZoningAmend-DataCntrs-DRAFT2.pdf", "host": "www.umbt.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.umbt.org/wp-content/uploads/RPL-Data-Center-Validity-Challenge-Submission-Letter.pdf", "host": "www.umbt.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.76912, "lng": -75.32339, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round32-2026-10-14.json", "scope": "Personally read public project context only; no whole-record certification. Identity, date, future-outcome, permit, capacity and financial scopes remain limited.", "fields": { "reported_context": "BIC republishes trade/local reporting on Slate Belt Holdings’ proposed up-to-23-building Upper Mount Bethel campus and zoning challenge.", "independently_verified_current_operating_status": null }, "notes": [ "Reported 754-acre purchase and submitted plans are not approved data center construction. Planned 480 MW SUBSTATION is not critical IT; nearby Talen 607 MW natural-gas plant is separate generation. Historical 15-building/six-million-square-foot and 168 MW descriptions concern prior development scope, not additive current campus capacity. Amazon’s prior reported discussions and withdrawal of interest do not establish a committed tenant. Other Susquehanna/Amazon operating campus and Montour denial are separate projects. Court challenge is not a ruling; no approval/RFS adopted.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.bicmagazine.com/departments/AI-Infrastructure/talen-looks-to-develop-23-building-data-center-campus-in-pennsylvania/", "host": "bicmagazine.com", "date": "2026-08-10", "published": "2026-08-10", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 64", "scope": "The complete original six page posted memorandum names Slate Belt Holdings and a proposed data center campus. This supports a listed proposal. Its date and signature fields remain blank, and community payments, rule changes, litigation resolution, cooling commitments and later approvals remain conditional. Selected original draft ordinance pages one through three and thirty one retain a blank adoption day and execution fields. The independent October 8 RPL East letter concerns a separate property and is not assigned to this Slate Belt campus. The original July filing packet returned HTTP 404. No current final ordinance, executed agreement, construction, service or measured benefit is established by these bodies.", "fields": { "current_stage_evidence": { "outcome": "official_named_slatebelt_proposal_draft_agreements_and_separate_rpl_east", "scope": "The complete original six page posted memorandum names Slate Belt Holdings and a proposed data center campus. This supports a listed proposal. Its date and signature fields remain blank, and community payments, rule changes, litigation resolution, cooling commitments and later approvals remain conditional. Selected original draft ordinance pages one through three and thirty one retain a blank adoption day and execution fields. The independent October 8 RPL East letter concerns a separate property and is not assigned to this Slate Belt campus. The original July filing packet returned HTTP 404. No current final ordinance, executed agreement, construction, service or measured benefit is established by these bodies." }, "source_read_scope": { "complete_original_home_body_read": true, "complete_original_six_page_mou_text_read": true, "mou_date_and_execution_fields_blank": true, "selected31page_draft_text_pages_read": [ 1, 2, 3, 31 ], "complete31page_review_not_claimed": true, "complete_original_two_page_rpl_east_letter_text_read": true, "separate_rpl_east_not_forced_slatebelt_property": true, "conditional_donation_not_actual_payment": true, "original_july_packet404_retained": true } }, "notes": [ "The complete original six page posted memorandum names Slate Belt Holdings and a proposed data center campus. This supports a listed proposal. Its date and signature fields remain blank, and community payments, rule changes, litigation resolution, cooling commitments and later approvals remain conditional. Selected original draft ordinance pages one through three and thirty one retain a blank adoption day and execution fields. The independent October 8 RPL East letter concerns a separate property and is not assigned to this Slate Belt campus. The original July filing packet returned HTTP 404. No current final ordinance, executed agreement, construction, service or measured benefit is established by these bodies.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://www.umbt.org/", "host": "www.umbt.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.umbt.org/wp-content/uploads/Memorandum-of-Understanding-4908-3404-7178-v1.pdf", "host": "www.umbt.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.umbt.org/wp-content/uploads/UMBT-ZoningAmend-DataCntrs-DRAFT2.pdf", "host": "www.umbt.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.umbt.org/wp-content/uploads/RPL-Data-Center-Validity-Challenge-Submission-Letter.pdf", "host": "www.umbt.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Upper Mount Bethel Township · Northampton · Source context reviewed", "status_scope": "The complete original six page posted memorandum names Slate Belt Holdings and a proposed data center campus. This supports a listed proposal. Its date and signature fields remain blank, and community payments, rule changes, litigation resolution, cooling commitments and later approvals remain conditional. Selected original draft ordinance pages one through three and thirty one retain a blank adoption day and execution fields. The independent October 8 RPL East letter concerns a separate property and is not assigned to this Slate Belt campus. The original July filing packet returned HTTP 404. No current final ordinance, executed agreement, construction, service or measured benefit is established by these bodies.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42095" } }, { "id": "depg-smithfield-gateway-data-center-monroe-pa", "state": "pa", "kind": "facility", "name": "Smithfield Gateway Data Center", "group": "proposed", "status": "Application under review", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Monroe" ], "city": "East Stroudsburg", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Smithfield agency future hearing schedule and conditional-use limits. Both meetings are future as of October 14 and subject to postponement if review deadline extended. Recommendation is separate from Board hearing. Conditional-use application is not land-development approval; final engineering and land development still required before construction. Older sketch phases are not approved additional data-center buildings. No hearing outcome, numeric IT MW or current operations inferred. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [ [ "2026-10-28", "Scheduled event: A Smithfield Gateway conditional use hearing is scheduled to begin October 28, 2026 for party status and scheduling, according to the Township published October 21 procedural correspondence. The date remains future at this review and does not establish an accomplished hearing, substantive permit approval or construction." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://smithfieldtownship.com/odp/gatewaydc/", "host": "smithfieldtownship.com", "date": "2026-10-07", "published": "2026-10-07", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://smithfieldtownship.com/wp-content/uploads/2026/09/Smithfield-Gateway-Data-Center_Conditional-Use-Review-No.-2.pdf", "host": "smithfieldtownship.com", "published": "2026-09-11", "date": "2026-09-11", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://smithfieldtownship.com/wp-content/uploads/2026/10/2026.10.21-Response-to-Applicant.pdf", "host": "smithfieldtownship.com", "published": "2026-10-21", "date": "2026-10-21", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.05822, "lng": -75.3396, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "public-institution-review-round11-2026-10-14.json", "scope": "Smithfield agency future hearing schedule and conditional-use limits", "fields": { "agency": "Smithfield Township, Pennsylvania", "page_updated": "2026-10-07", "applicants": [ "DEPG Mosier Associates LP", "DEPG of Shawnee II LP" ], "project": "Smithfield Gateway conditional use", "proposed_buildings": 1, "proposed_stories": 2, "proposed_area_sqft": 250000, "application_date": "2026-04-03", "resubmission_date": "2026-08-11", "scheduled_planning_recommendation_meeting": "2026-10-21T19:00:00-04:00", "scheduled_conditional_use_hearing": "2026-10-28T18:00:00-04:00", "scheduled_venue": "J.T. Lambert Intermediate School, 2000 Milford Road, East Stroudsburg, PA18301", "party_status_email_deadline_date": "2026-10-27" }, "notes": [ "Both meetings are future as of October 14 and subject to postponement if review deadline extended. Recommendation is separate from Board hearing. Conditional-use application is not land-development approval; final engineering and land development still required before construction. Older sketch phases are not approved additional data-center buildings. No hearing outcome, numeric IT MW or current operations inferred.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://smithfieldtownship.com/odp/gatewaydc/", "host": "smithfieldtownship.com", "date": "2026-10-07", "published": "2026-10-07", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 27", "scope": "The Township published consulting engineer September 11, 2026 review explicitly concerns the named Smithfield Gateway data center conditional use application. October 21 published correspondence confirms agreement to open the October 28 hearing for party status and later scheduling, with substantive review to follow after revised plans and engineering review. Proposed records this active named application, not an issued conditional use approval, land development approval, a completed future hearing or current construction. Applicant counsel statements about legal rights and zoning effects are attributed positions, not court findings. Unrelated pharmacy strings in the captured website navigation are excluded; the original dated project PDFs are the evidence used here.", "fields": { "current_stage_evidence": { "outcome": "dated_original_conditional_use_review_and_future_procedural_hearing", "scope": "The Township published consulting engineer September 11, 2026 review explicitly concerns the named Smithfield Gateway data center conditional use application. October 21 published correspondence confirms agreement to open the October 28 hearing for party status and later scheduling, with substantive review to follow after revised plans and engineering review. Proposed records this active named application, not an issued conditional use approval, land development approval, a completed future hearing or current construction. Applicant counsel statements about legal rights and zoning effects are attributed positions, not court findings. Unrelated pharmacy strings in the captured website navigation are excluded; the original dated project PDFs are the evidence used here." }, "source_read_scope": { "technical_review_pdf_pages_visually_read": [ 1, 7 ], "technical_noise_pages_text_read": [ 9, 10 ], "procedural_pdf_pages_visually_read": [ 1, 2 ], "future_hearing_not_accomplished": true, "applicant_legal_positions_not_adjudicated": true, "unrelated_navigation_strings_excluded": true } }, "notes": [ "The Township published consulting engineer September 11, 2026 review explicitly concerns the named Smithfield Gateway data center conditional use application. October 21 published correspondence confirms agreement to open the October 28 hearing for party status and later scheduling, with substantive review to follow after revised plans and engineering review. Proposed records this active named application, not an issued conditional use approval, land development approval, a completed future hearing or current construction. Applicant counsel statements about legal rights and zoning effects are attributed positions, not court findings. Unrelated pharmacy strings in the captured website navigation are excluded; the original dated project PDFs are the evidence used here.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://smithfieldtownship.com/wp-content/uploads/2026/09/Smithfield-Gateway-Data-Center_Conditional-Use-Review-No.-2.pdf", "host": "smithfieldtownship.com", "published": "2026-09-11", "date": "2026-09-11", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://smithfieldtownship.com/wp-content/uploads/2026/10/2026.10.21-Response-to-Applicant.pdf", "host": "smithfieldtownship.com", "published": "2026-10-21", "date": "2026-10-21", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "East Stroudsburg · Monroe · Source context reviewed", "status_scope": "The Township published consulting engineer September 11, 2026 review explicitly concerns the named Smithfield Gateway data center conditional use application. October 21 published correspondence confirms agreement to open the October 28 hearing for party status and later scheduling, with substantive review to follow after revised plans and engineering review. Proposed records this active named application, not an issued conditional use approval, land development approval, a completed future hearing or current construction. Applicant counsel statements about legal rights and zoning effects are attributed positions, not court findings. Unrelated pharmacy strings in the captured website navigation are excluded; the original dated project PDFs are the evidence used here.", "event_evidence": [ { "date": "2026-10-28", "text": "Scheduled event: A Smithfield Gateway conditional use hearing is scheduled to begin October 28, 2026 for party status and scheduling, according to the Township published October 21 procedural correspondence. The date remains future at this review and does not establish an accomplished hearing, substantive permit approval or construction.", "kind": "scheduled_event", "sources": [ { "url": "https://smithfieldtownship.com/wp-content/uploads/2026/10/2026.10.21-Response-to-Applicant.pdf", "host": "smithfieldtownship.com", "published": "2026-10-21", "date": "2026-10-21", "checked": "2026-10-23", "label": "Reviewed government record" } ] } ], "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42089" } }, { "id": "inch-eastern-land-south-annville-lebanon-pa", "state": "pa", "kind": "facility", "name": "South Annville Township Data Center Campus", "group": "stopped", "status": "Reported rezoning application withdrawn", "raw_status": "stopped", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lebanon" ], "city": "South Annville Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.. The May 5 planning recommendation to deny was not a final board denial. A withdrawn site application is not a township-wide ban. The former investment and floor-area proposal was not constructed; the original withdrawal letter is not separately retained. Original approvals and later observed outcomes take precedence; future dates have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://lebtown.com/2026/05/13/south-annville-twp-data-center-project-scrapped-after-grass-roots-opposition/", "host": "lebtown.com", "date": "2026-05-13", "published": "2026-05-13", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 40.36721, "lng": -76.45751, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round27-2026-10-14.json", "scope": "Personally read public named-source context only; no whole-record certification. See public-preview, identity and date limitations.", "fields": { "reported_context": "LebTown quotes the developer attorney's May 12 withdrawal of the South Annville rezoning application and intention to stop pursuing a data center at the Martina Drive property.", "independently_verified_current_operating_status": null, "reported_application_status": "withdrawn", "reported_withdrawal_date": "2026-05-12" }, "notes": [ "The May 5 planning recommendation to deny was not a final board denial. A withdrawn site application is not a township-wide ban. The former investment and floor-area proposal was not constructed; the original withdrawal letter is not separately retained.", "Original approvals and later observed outcomes take precedence; future dates have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://lebtown.com/2026/05/13/south-annville-twp-data-center-project-scrapped-after-grass-roots-opposition/", "host": "lebtown.com", "date": "2026-05-13", "published": "2026-05-13", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-F1-label-review-2026-10-20", "scope": "LebTown reports the applicant attorney's May 2026 withdrawal letter for the South Annville zoning petition and its statement that the applicant would no longer pursue that data center. This label concerns the named petition, not the operation of a completed facility or the outcome of later property proposals.", "fields": { "identity_label_context": { "previous_name": "South Annville Township Data Center Campus (withdrawn)", "plain_name": "South Annville Township Data Center Campus", "interpretation": "LebTown reports the applicant attorney's May 2026 withdrawal letter for the South Annville zoning petition and its statement that the applicant would no longer pursue that data center. This label concerns the named petition, not the operation of a completed facility or the outcome of later property proposals.", "outcome_wording_is_not_identity": true }, "current_stage_evidence": { "outcome": "reported_rezoning_application_withdrawn", "scope": "LebTown reports the applicant attorney's May 2026 withdrawal letter for the South Annville zoning petition and its statement that the applicant would no longer pursue that data center. This label concerns the named petition, not the operation of a completed facility or the outcome of later property proposals." } }, "notes": [ "LebTown reports the applicant attorney's May 2026 withdrawal letter for the South Annville zoning petition and its statement that the applicant would no longer pursue that data center. This label concerns the named petition, not the operation of a completed facility or the outcome of later property proposals.", "Inherited inventory name: South Annville Township Data Center Campus (withdrawn). The wording is retained as provenance, not as an independently verified outcome.", "An application decision is separate from a current physical stage. No coordinate, address, parcel, company role, technical figure or physical milestone date is changed." ], "sources": [ { "url": "https://lebtown.com/2026/05/13/south-annville-twp-data-center-project-scrapped-after-grass-roots-opposition/", "host": "lebtown.com", "published": "2026-05-13", "date": "2026-05-13", "checked": "2026-10-20", "label": "LebTown" } ], "checked": "2026-10-20", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "South Annville Township · Lebanon · Source context reviewed", "status_scope": "LebTown reports the applicant attorney's May 2026 withdrawal letter for the South Annville zoning petition and its statement that the applicant would no longer pursue that data center. This label concerns the named petition, not the operation of a completed facility or the outcome of later property proposals.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42075" } }, { "id": "allegheny-dc-springdale-cheswick-pa", "state": "pa", "kind": "facility", "name": "Springdale Data Center (former Cheswick Generating Station)", "group": "proposed", "status": "Permit review underway", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Allegheny" ], "city": "Springdale", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Springdale reported conditional-use approval and soundmodel limits. Conditionaluseapprovalreported, actualfinalpermitconditions andlaterappealsnotinspected. Existingcoalplantclosed/notoperationofnewDC.140000homepoweranalogy notnumericITMW.85decibelreportedboroughthresholdnotverifiedweighting/measurementpoint/timebasisoractualsitelevel. Soundmodelnotmeasuredoperatingcompliance. No constructioncompletion, customerenergization oractualtaxreceipt. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.alleghenyfront.org/springdale-allegheny-county-data-center-approval/", "host": "alleghenyfront.org", "date": "2025-12-17", "published": "2025-12-17", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.46887, "lng": -79.98146, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round13-2026-10-14.json", "scope": "Springdale reported conditional-use approval and soundmodel limits", "fields": { "company": "Allegheny DC Property Company", "site": "formerCheswickGeneratingStation, Springdale, AlleghenyCounty, Pennsylvania", "reported_conditional_use_approval_date": "2025-12-16", "reported_vote": "5-2", "proposed_building_area_sqft": 565000, "proposed_height_stories_approx": 7 }, "notes": [ "Conditionaluseapprovalreported, actualfinalpermitconditions andlaterappealsnotinspected. Existingcoalplantclosed/notoperationofnewDC.140000homepoweranalogy notnumericITMW.85decibelreportedboroughthresholdnotverifiedweighting/measurementpoint/timebasisoractualsitelevel. Soundmodelnotmeasuredoperatingcompliance. No constructioncompletion, customerenergization oractualtaxreceipt.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.alleghenyfront.org/springdale-allegheny-county-data-center-approval/", "host": "alleghenyfront.org", "date": "2025-12-17", "published": "2025-12-17", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 28", "scope": "The current DEP tracker original project CSV identifies Springdale Data Center as project 10000019 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed.", "fields": { "current_stage_evidence": { "outcome": "current_named_dep_project_permit_review_not_physical_operation", "scope": "The current DEP tracker original project CSV identifies Springdale Data Center as project 10000019 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed." }, "tracker_scope": { "project_id": "10000019", "project_and_permit_csv_read_together": true, "aggregate_status_not_every_permit_complete": true, "source_coordinates_not_promoted": true, "submitted_day_not_issued_day": true } }, "notes": [ "The current DEP tracker original project CSV identifies Springdale Data Center as project 10000019 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Springdale · Allegheny · Source context reviewed", "status_scope": "The current DEP tracker original project CSV identifies Springdale Data Center as project 10000019 and lists its permit review as under review. The related original permit CSV distinguishes individual issued, pending and not yet submitted items. Permit review underway describes the named new proposal regulatory account, not a final approval, physical construction or operating service. A submitted date is not an issuance day. Existing names, developer roles, quantities, location coordinates and jurisdiction wrappers are not changed.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42003" } }, { "id": "suncap-stowe-township-allegheny-county-pa", "state": "pa", "kind": "facility", "name": "Stowe Township Data Center (former railcar plant)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Allegheny" ], "city": "Stowe Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.. Advertising is not ordinance adoption, rezoning or site construction approval; next-month vote outcome is unobserved. Report expressly says amendment would enable a future developer, not immediately start a project. Unknown operator, utility arrangement, power, capital and RFS remain unknown. Commissioners’ statements about environmental regulators are assurances, not examined permit findings. This is 2025 reporting, not anOctober 2026 action. Later original decisions and observed outcomes take precedence; future events have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wpxi.com/news/local/stowe-township-community-expresses-concerns-over-data-center-proposal/F3UN7MXY3RD2DMMTPZDZR6VVXM/", "host": "wpxi.com", "date": "2025-10-15", "published": "2025-10-15", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://stowetwp.net/wp-content/uploads/2026/09/August-2026.pdf", "host": "stowetwp.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://stowetwp.net/", "host": "stowetwp.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://stowetwp.net/meetings/", "host": "stowetwp.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.43503, "lng": -79.9785, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round33-2026-10-14.json", "scope": "Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.", "fields": { "reported_context": "WPXI reports Stowe commissioners authorized advertising a proposed ordinance amendment after SunCap’s presentation about allowing a potential Nichol Avenue railcar-site data center.", "independently_verified_current_operating_status": null }, "notes": [ "Advertising is not ordinance adoption, rezoning or site construction approval; next-month vote outcome is unobserved. Report expressly says amendment would enable a future developer, not immediately start a project. Unknown operator, utility arrangement, power, capital and RFS remain unknown. Commissioners’ statements about environmental regulators are assurances, not examined permit findings. This is 2025 reporting, not anOctober 2026 action.", "Later original decisions and observed outcomes take precedence; future events have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.wpxi.com/news/local/stowe-township-community-expresses-concerns-over-data-center-proposal/F3UN7MXY3RD2DMMTPZDZR6VVXM/", "host": "wpxi.com", "date": "2025-10-15", "published": "2025-10-15", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 64", "scope": "All three original signed August 11, 2026 Council minute scans were viewed. The Solicitor describes a social media rumor about an anticipated data center discussion, and officials distinguish the actual meeting subject. Residents mention SunCap, potential protection of future generations and transparency around the ordinance, while officials describe separate approval requirements. This does not independently establish a submitted SunCap computing application, final project cancellation, physical closure or current service. Current general meeting dates are not computing hearings. Private resident names, addresses, unrelated complaints and municipal financial details are excluded. The missing older October PDF is not treated as a source body.", "fields": { "current_stage_evidence": { "outcome": "official_signed_stowe_concern_and_meeting_context_exact_stage_held", "scope": "All three original signed August 11, 2026 Council minute scans were viewed. The Solicitor describes a social media rumor about an anticipated data center discussion, and officials distinguish the actual meeting subject. Residents mention SunCap, potential protection of future generations and transparency around the ordinance, while officials describe separate approval requirements. This does not independently establish a submitted SunCap computing application, final project cancellation, physical closure or current service. Current general meeting dates are not computing hearings. Private resident names, addresses, unrelated complaints and municipal financial details are excluded. The missing older October PDF is not treated as a source body." }, "source_read_scope": { "all3_original_august11_signed_scan_pages_actually_viewed": true, "official_rumor_account_not_private_article_wording": true, "residents_suncap_and_transparency_accounts_attributed": true, "no_direct_operator_response_independently_verified": true, "private_names_and_addresses_excluded": true, "unrelated_finances_not_exported": true, "original_oct2025_pdf404_retained": true } }, "notes": [ "All three original signed August 11, 2026 Council minute scans were viewed. The Solicitor describes a social media rumor about an anticipated data center discussion, and officials distinguish the actual meeting subject. Residents mention SunCap, potential protection of future generations and transparency around the ordinance, while officials describe separate approval requirements. This does not independently establish a submitted SunCap computing application, final project cancellation, physical closure or current service. Current general meeting dates are not computing hearings. Private resident names, addresses, unrelated complaints and municipal financial details are excluded. The missing older October PDF is not treated as a source body.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://stowetwp.net/wp-content/uploads/2026/09/August-2026.pdf", "host": "stowetwp.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://stowetwp.net/", "host": "stowetwp.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://stowetwp.net/meetings/", "host": "stowetwp.net", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Stowe Township · Allegheny · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42003" } }, { "id": "talen-montour-data-center-campus-montour-county-pa", "state": "pa", "kind": "facility", "name": "Talen Energy Montour Data Center Campus", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Montour" ], "city": "Washingtonville", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.. Discussion and future hearing are not rezoning approval. About twelve buildings of 2 to 3 acres each are preliminary concept, not built floor area or final parcel count. Data centers and generation are distinct; no electrical MW or water volume established. Developer environmental/lake-level assurances and intended public review are not measured impacts or permit findings. This 2025 stage must not override later reported denial or original decisions. No unrelated land offers are assigned to Talen. Later original decisions and observed outcomes take precedence; future events have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.northcentralpa.com/business/talen-energy-officials-address-community-concerns-about-rezoning/article_18cf27f5-6015-4978-a910-593e02b43c79.html", "host": "northcentralpa.com", "date": "2025-11-18", "published": "2025-11-18", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 41.02793, "lng": -76.65863, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round33-2026-10-14.json", "scope": "Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.", "fields": { "reported_context": "NorthcentralPA relays Talen’s virtual community session ahead of a planning hearing for a roughly 1,000-acre agricultural-to-industrial rezoning in northern Montour County.", "independently_verified_current_operating_status": null }, "notes": [ "Discussion and future hearing are not rezoning approval. About twelve buildings of 2 to 3 acres each are preliminary concept, not built floor area or final parcel count. Data centers and generation are distinct; no electrical MW or water volume established. Developer environmental/lake-level assurances and intended public review are not measured impacts or permit findings. This 2025 stage must not override later reported denial or original decisions. No unrelated land offers are assigned to Talen.", "Later original decisions and observed outcomes take precedence; future events have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.northcentralpa.com/business/talen-energy-officials-address-community-concerns-about-rezoning/article_18cf27f5-6015-4978-a910-593e02b43c79.html", "host": "northcentralpa.com", "date": "2025-11-18", "published": "2025-11-18", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Washingtonville · Montour · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42093" } }, { "id": "tecfusions-keystone-connect-upper-burrell-pa", "state": "pa", "kind": "facility", "name": "TECfusions Keystone Connect", "group": "proposed", "status": "Project listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Westmoreland" ], "city": "Upper Burrell Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original reporter/issuer named-project context, with inference and stages explicit.. MiaHollie PublicSource September3updated4,2026 originalUpperBurrellmeetingreport:180dayMaymoratorium reportedlyexpiresNovember2, but EXCLUDESpreviousBuildingJpermits. August5planapprovalcoversJinterior/mechanical/electricalalterations, notentire1400acre/3GWfuturecampus. PartialBuildingJliveclaimattributedtoTribLive/companyrelease, notindependentlyinspectedcurrentservice. LanduseappealProtectPT/residentsinWestmorelandCommonPleas ALLEGESspecialexceptionproceduremissing, notcourtwin/currentinjunction. Case number/unreadoriginalpleading/finaloutcomeunknown. Newdraftbaseloadgenerationrequirement notenactedlaw; September15reviewfutureinreportnotobservedoutcome. Moratoriumnotproofallcurrentworkillegal. Plans/historicalchanges/courtallegations/utilitycustomerinference not all-field,siteITorcurrentoperatingcertification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.publicsource.org/upper-burrell-data-center-transparency-backlash/", "host": "publicsource.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://tecfusions.com/wp-content/uploads/2025/11/KEYSTONE-CONNECT-FLYER.pdf", "host": "tecfusions.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "loc": { "lat": 40.31081, "lng": -79.46689, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-withdrawals-power-redesign-and-review-stage-round79-2026-10-15.json", "scope": "Original reporter/issuer named-project context, with inference and stages explicit.", "fields": {}, "notes": [ "MiaHollie PublicSource September3updated4,2026 originalUpperBurrellmeetingreport:180dayMaymoratorium reportedlyexpiresNovember2, but EXCLUDESpreviousBuildingJpermits. August5planapprovalcoversJinterior/mechanical/electricalalterations, notentire1400acre/3GWfuturecampus. PartialBuildingJliveclaimattributedtoTribLive/companyrelease, notindependentlyinspectedcurrentservice.", "LanduseappealProtectPT/residentsinWestmorelandCommonPleas ALLEGESspecialexceptionproceduremissing, notcourtwin/currentinjunction. Case number/unreadoriginalpleading/finaloutcomeunknown. Newdraftbaseloadgenerationrequirement notenactedlaw; September15reviewfutureinreportnotobservedoutcome. Moratoriumnotproofallcurrentworkillegal.", "Plans/historicalchanges/courtallegations/utilitycustomerinference not all-field,siteITorcurrentoperatingcertification." ], "sources": [ { "url": "https://www.publicsource.org/upper-burrell-data-center-transparency-backlash/", "host": "publicsource.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 28", "scope": "The current DEP original project CSV identifies Keystone Connect as project 10000020 with aggregate DEP Review Complete wording, while its related original permit rows include a pending item as well as issued items. That aggregate label is not certified as every approval complete. The company flyer describes adaptive reuse development and claimed leasing and future deployment timing. Project listed development records the named proposal account, not verified live service, a completed conversion or delivery of its advertised capacity. The flyer file path month is not its publication date, and stock photographs do not establish current facility operation.", "fields": { "current_stage_evidence": { "outcome": "named_keystone_development_with_aggregate_and_individual_permit_difference", "scope": "The current DEP original project CSV identifies Keystone Connect as project 10000020 with aggregate DEP Review Complete wording, while its related original permit rows include a pending item as well as issued items. That aggregate label is not certified as every approval complete. The company flyer describes adaptive reuse development and claimed leasing and future deployment timing. Project listed development records the named proposal account, not verified live service, a completed conversion or delivery of its advertised capacity. The flyer file path month is not its publication date, and stock photographs do not establish current facility operation." }, "tracker_scope": { "project_id": "10000020", "aggregate_review_complete_does_not_clear_pending_related_row": true, "flyer_first_page_visually_read": true, "leasing_claim_not_commissioning": true } }, "notes": [ "The current DEP original project CSV identifies Keystone Connect as project 10000020 with aggregate DEP Review Complete wording, while its related original permit rows include a pending item as well as issued items. That aggregate label is not certified as every approval complete. The company flyer describes adaptive reuse development and claimed leasing and future deployment timing. Project listed development records the named proposal account, not verified live service, a completed conversion or delivery of its advertised capacity. The flyer file path month is not its publication date, and stock photographs do not establish current facility operation.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://tecfusions.com/wp-content/uploads/2025/11/KEYSTONE-CONNECT-FLYER.pdf", "host": "tecfusions.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Upper Burrell Township · Westmoreland · Source context reviewed", "status_scope": "The current DEP original project CSV identifies Keystone Connect as project 10000020 with aggregate DEP Review Complete wording, while its related original permit rows include a pending item as well as issued items. That aggregate label is not certified as every approval complete. The company flyer describes adaptive reuse development and claimed leasing and future deployment timing. Project listed development records the named proposal account, not verified live service, a completed conversion or delivery of its advertised capacity. The flyer file path month is not its publication date, and stock photographs do not establish current facility operation.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42129" } }, { "id": "tierpoint-allentown-tekpark-breinigsville-pa", "state": "pa", "kind": "facility", "name": "TierPoint Allentown TekPark", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lehigh" ], "city": "Breinigsville", "address": "", "who": "TierPoint", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/tekpark-campus/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://www.tierpoint.com/data-centers/pennsylvania/allentown-tekpark/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=9999+Hamilton+Boulevard%2C+Breinigsville%2C+PA+18031&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint facility navigation links and separate corporate headquarters section" } ], "loc": { "lat": 40.543122693409, "lng": -75.659851731482, "precision": "address", "basis": "Published TierPoint facility address 9999 Hamilton Boulevard, Building #4, Breinigsville, PA 18031 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "operator-specifications-round3-2026-10-14.json", "scope": "Field or source context only", "fields": { "current_operator_listing": "Operator currently advertises the named facility and services. This is an operator statement, not a site inspection or uptime measurement." }, "notes": [ "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/tekpark-campus/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "TierPoint lists current colocation services at its Allentown TekPark TEK facility in Building 4. The broader TekPark campus page includes future expansion; this label does not certify that expansion as complete. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "TierPoint lists current colocation services at its Allentown TekPark TEK facility in Building 4. The broader TekPark campus page includes future expansion; this label does not certify that expansion as complete. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." } }, "notes": [ "TierPoint lists current colocation services at its Allentown TekPark TEK facility in Building 4. The broader TekPark campus page includes future expansion; this label does not certify that expansion as complete." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/allentown-tekpark/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 5, October 22, 2026", "scope": "Published operator street reference only. No canonical address, status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 40.543122693409, "lng": -75.659851731482, "precision": "address", "basis": "Published TierPoint facility address 9999 Hamilton Boulevard, Building #4, Breinigsville, PA 18031 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "9999 Hamilton Boulevard, Building #4, Breinigsville, PA 18031", "county_fips": [ "42077" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named facility address section supplies the street and locality. The corporate headquarters footer is excluded. The published facility address is retained as location evidence; the existing blank canonical address field is not changed in this location only transaction.", "The source facility page and its current navigation link identify the same existing research record. A regional market name does not replace the published locality or county. The existing service status, physical dates, technical figures, organizations and jurisdiction wrappers remain exact.", "The previous point is explicitly an inherited general area reference without a verified street or parcel. The current TierPoint facility section Allentown - TekPark (TEK) publishes 9999 Hamilton Boulevard, Building #4, Breinigsville, PA 18031. Its unique Census street range and retained county polygon agree with the existing county. This 2676.0 meter move replaces that unsupported general area reference with a calculated street address reference. It does not certify a roof, full campus boundary, ownership or physical milestone.", "Building 4 is retained only as the operator published address qualifier. This is one calculated street reference for the existing TekPark research record, not an added building pin or whole campus boundary." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/allentown-tekpark/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint named facility address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=9999+Hamilton+Boulevard%2C+Breinigsville%2C+PA+18031&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint facility navigation links and separate corporate headquarters section" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 06, October 23, 2026", "scope": "TierPoint presents this named facility as part of its own colocation service network on its first party facility page. Operator is the attributed provider brand role, not an independently established legal operating entity or property owner. No status, location, physical date, technical figure, certification or environmental outcome is promoted. The source describes a campus and future expansion. Its ownership marketing, acreage and growth claims are not adopted as independently verified legal title, technical capacity, completion or environmental findings.", "fields": { "company_association": { "name": "TierPoint", "role": "operator", "identity_scope": "provider_brand_only", "scope": "TierPoint presents this named facility as part of its own colocation service network on its first party facility page. Operator is the attributed provider brand role, not an independently established legal operating entity or property owner. No status, location, physical date, technical figure, certification or environmental outcome is promoted. The source describes a campus and future expansion. Its ownership marketing, acreage and growth claims are not adopted as independently verified legal title, technical capacity, completion or environmental findings." }, "provider_role": "operator" }, "notes": [ "TierPoint presents this named facility as part of its own colocation service network on its first party facility page. Operator is the attributed provider brand role, not an independently established legal operating entity or property owner. No status, location, physical date, technical figure, certification or environmental outcome is promoted. The source describes a campus and future expansion. Its ownership marketing, acreage and growth claims are not adopted as independently verified legal title, technical capacity, completion or environmental findings.", "Source dates remain separate from physical milestones and the retained status field." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/tekpark-campus/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party named facility page, reviewed named service or development context" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Breinigsville · Lehigh · Source context reviewed", "status_scope": "TierPoint lists current colocation services at its Allentown TekPark TEK facility in Building 4. The broader TekPark campus page includes future expansion; this label does not certify that expansion as complete. This supports only the qualified stage described by the source, not an opening date, every hall being operational, full energized capacity, independently verified certification, legal ownership or parcel accuracy." }, { "id": "tierpoint-valley-forge-pa", "state": "pa", "kind": "facility", "name": "TierPoint Valley Forge", "group": "operating", "status": "Operator-listed colocation service", "raw_status": "operating", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Montgomery" ], "city": "Norristown", "address": "", "who": "TierPoint", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Field or source context only. Listed MW/kW values describe emergency generators. No critical IT or measured grid-load value is established by this specification. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/valley-forge/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1000+Adams+Avenue%2C+Norristown%2C+PA+19403&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint facility navigation links and separate corporate headquarters section" } ], "loc": { "lat": 40.121457158086, "lng": -75.419924186561, "precision": "address", "basis": "Published TierPoint facility address 1000 Adams Avenue, Norristown, PA 19403 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding." }, "reviewed_evidence": [ { "overlay": "operator-specifications-round3-2026-10-14.json", "scope": "Field or source context only", "fields": { "gross_area_sqft": 137000, "gross_area_is_lower_bound": true, "raised_floor_sqft": 61000, "raised_floor_is_lower_bound": true, "backup_generator_configuration_source_statement": "Nine 2.5 MW redundant generators", "current_operator_listing": "Operator currently advertises the named facility and services. This is an operator statement, not a site inspection or uptime measurement." }, "notes": [ "Listed MW/kW values describe emergency generators. No critical IT or measured grid-load value is established by this specification.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/valley-forge/", "host": "tierpoint.com", "date": "", "published": "", "checked": "2026-10-14", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "orchestra-status-2026-10-19", "scope": "TierPoint lists colocation and managed services at its Valley Forge location. This supports an operator-listed colocation service label, not an opening date, full energized capacity, independently verified certification, legal ownership or a surveyed parcel.", "fields": { "current_stage_evidence": { "outcome": "operator_listed_colocation_service", "scope": "TierPoint lists colocation and managed services at its Valley Forge location. This supports an operator-listed colocation service label, not an opening date, full energized capacity, independently verified certification, legal ownership or a surveyed parcel." } }, "notes": [ "Named main-body introduction, current product-availability passage and physical-location block. Promotional guarantees, technical totals and certifications were not adopted." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/valley-forge/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-19", "label": "Operator source for the qualified stage" } ], "checked": "2026-10-19", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 5, October 22, 2026", "scope": "Published operator street reference only. No canonical address, status, date, quantity, legal jurisdiction, title, surveyed parcel, whole campus or distinct building identity is adopted.", "fields": { "location_review_decision": { "location": { "lat": 40.121457158086, "lng": -75.419924186561, "precision": "address", "basis": "Published TierPoint facility address 1000 Adams Avenue, Norristown, PA 19403 matched to one Census street range inside the existing county. Calculated street reference, not a surveyed parcel, roof, suite, full campus or property ownership finding." }, "reference_method": "Census interpolated street address", "published_address": "1000 Adams Avenue, Norristown, PA 19403", "county_fips": [ "42091" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The named facility address section supplies the street and locality. The corporate headquarters footer is excluded. The published facility address is retained as location evidence; the existing blank canonical address field is not changed in this location only transaction.", "The source facility page and its current navigation link identify the same existing research record. A regional market name does not replace the published locality or county. The existing service status, physical dates, technical figures, organizations and jurisdiction wrappers remain exact." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/valley-forge/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint named facility address section" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=1000+Adams+Avenue%2C+Norristown%2C+PA+19403&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census calculated street range and county context" }, { "url": "https://geocoding.geo.census.gov/geocoder/Geocoding_Services_API.html", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-22", "label": "Census address range method and limits" }, { "url": "https://www.tierpoint.com/data-centers/arkansas/little-rock/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-22", "label": "TierPoint facility navigation links and separate corporate headquarters section" } ], "checked": "2026-10-22", "whole_record_certified": false }, { "overlay": "Company role source check 06, October 23, 2026", "scope": "TierPoint presents this named facility as part of its own colocation service network on its first party facility page. Operator is the attributed provider brand role, not an independently established legal operating entity or property owner. No status, location, physical date, technical figure, certification or environmental outcome is promoted.", "fields": { "company_association": { "name": "TierPoint", "role": "operator", "identity_scope": "provider_brand_only", "scope": "TierPoint presents this named facility as part of its own colocation service network on its first party facility page. Operator is the attributed provider brand role, not an independently established legal operating entity or property owner. No status, location, physical date, technical figure, certification or environmental outcome is promoted." }, "provider_role": "operator" }, "notes": [ "TierPoint presents this named facility as part of its own colocation service network on its first party facility page. Operator is the attributed provider brand role, not an independently established legal operating entity or property owner. No status, location, physical date, technical figure, certification or environmental outcome is promoted.", "Source dates remain separate from physical milestones and the retained status field." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/valley-forge/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-23", "label": "First party named facility page, reviewed named service or development context" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Published address reference, not a surveyed building or parcel", "summary": "Norristown · Montgomery · Source context reviewed", "status_scope": "TierPoint lists colocation and managed services at its Valley Forge location. This supports an operator-listed colocation service label, not an opening date, full energized capacity, independently verified certification, legal ownership or a surveyed parcel." }, { "id": "triboro-industrial-park-jessup-olyphant-lackawanna-county-pa", "state": "pa", "kind": "facility", "name": "Triboro Industrial Park / Triboro Commerce Park", "group": "proposed", "status": "Permit review underway", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lackawanna" ], "city": "Jessup / Olyphant", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original reporter/issuer named-project context, with inference and stages explicit.. KatBolus WVIA April22,2026 originalPPLopenhouseinterviews/recordwork. Tribune/ErcorTriboro548acre/17.5MJunepropertypurchase/4buildingindustrial2027targetnotpaidDCcapexorITload. Map-basedinferenceconnectssite toPPLproject; utilityREFUSESnamingcustomers. No confirmedexactcustomerESA ornewparcelpin.10yearLERTAclaimnotabatementamount/receivedcash. PPLworksplanningindependentlyofcustomerlocalapprovals;2029/early2030transmissiontargetconditionalonPUC/permits, notDCcommissioning. Dedicatedcustomerfacilitiespaidbycustomer whileREGIONALRELIABILITYupgradesratebased, so no blankettaxpayer-freeclaim. WildcatRidgeexplicitconditional-useprocess/May14historicalhearing; notfinalapproval. Othercampushearing/datesnotfutureOctobercalendar. PPLroute notselectedatAprilmeeting. Plans/historicalchanges/courtallegations/utilitycustomerinference not all-field,siteITorcurrentoperatingcertification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wvia.org/news/local/2026-04-22/ppl-electric-utilities-confirms-data-centers-spurred-transmission-project-in-lackawanna-county", "host": "wvia.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.48297, "lng": -75.62178, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-withdrawals-power-redesign-and-review-stage-round79-2026-10-15.json", "scope": "Original reporter/issuer named-project context, with inference and stages explicit.", "fields": {}, "notes": [ "KatBolus WVIA April22,2026 originalPPLopenhouseinterviews/recordwork. Tribune/ErcorTriboro548acre/17.5MJunepropertypurchase/4buildingindustrial2027targetnotpaidDCcapexorITload. Map-basedinferenceconnectssite toPPLproject; utilityREFUSESnamingcustomers. No confirmedexactcustomerESA ornewparcelpin.10yearLERTAclaimnotabatementamount/receivedcash.", "PPLworksplanningindependentlyofcustomerlocalapprovals;2029/early2030transmissiontargetconditionalonPUC/permits, notDCcommissioning. Dedicatedcustomerfacilitiespaidbycustomer whileREGIONALRELIABILITYupgradesratebased, so no blankettaxpayer-freeclaim. WildcatRidgeexplicitconditional-useprocess/May14historicalhearing; notfinalapproval. Othercampushearing/datesnotfutureOctobercalendar. PPLroute notselectedatAprilmeeting.", "Plans/historicalchanges/courtallegations/utilitycustomerinference not all-field,siteITorcurrentoperatingcertification." ], "sources": [ { "url": "https://www.wvia.org/news/local/2026-04-22/ppl-electric-utilities-confirms-data-centers-spurred-transmission-project-in-lackawanna-county", "host": "wvia.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "The DEP row names Triboro Industrial Park with Jessup, Olyphant and Throop context. That agency context does not change the inherited project jurisdiction wrapper or establish a common physical phase for every tract. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "exact_named_dep_proposal_account_not_physical_commissioning", "scope": "The DEP row names Triboro Industrial Park with Jessup, Olyphant and Throop context. That agency context does not change the inherited project jurisdiction wrapper or establish a common physical phase for every tract. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged." }, "tracker_scope": { "project_id": "10000069", "original_project_and_related_permit_csv_read": true, "no_data_center_operation_inferred": true, "no_coordinate_or_role_promotion": true } }, "notes": [ "The DEP row names Triboro Industrial Park with Jessup, Olyphant and Throop context. That agency context does not change the inherited project jurisdiction wrapper or establish a common physical phase for every tract. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Jessup / Olyphant · Lackawanna · Source context reviewed", "status_scope": "The DEP row names Triboro Industrial Park with Jessup, Olyphant and Throop context. That agency context does not change the inherited project jurisdiction wrapper or establish a common physical phase for every tract. The original DEP project CSV lists the named project as under review, and its related original permit rows remain separate. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42069" } }, { "id": "tron-usa-ai-campus-titus-station-cumru-berks-pa", "state": "pa", "kind": "facility", "name": "TRON USA AI Campus (former Titus Station)", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Berks" ], "city": "Reading", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.. 200 MWbasis is undefined and proposed, not critical IT/current operation. Potential future generation is separate; no MWaddition inferred. Existing industrial zoning, study activity and grant-related work are not final development/interconnection approval or awarded incentives. Investment, construction timeline and engineering details are explicitly pending.2014 coal-plant decommissioning is not newDCopening. Strategic developer agreement is not an executed tenant lease or utility ESA; TRONname does not independently identify a blockchain affiliate or crypto workload. Later original decisions and observed outcomes take precedence; future events have no assumed result. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://berksweekly.com/news/titus-station-redevelopment-project-in-berks-county-planned-as-ai-infrastructure-campus/", "host": "berksweekly.com", "date": "2026-05-19", "published": "2026-05-19", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "loc": { "lat": 40.41632, "lng": -75.9258, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round33-2026-10-14.json", "scope": "Personally read dated project context only; no whole-record certification. Preview, identity, numerical, legal-stage and future-outcome holds remain.", "fields": { "reported_context": "Berks Weekly reports Titus Development announced a strategic agreement with Go Energy Group for a proposedTRONUSA AIcampus on about 196 acres at former TitusStation, initially described as 200 MW.", "independently_verified_current_operating_status": null }, "notes": [ "200 MWbasis is undefined and proposed, not critical IT/current operation. Potential future generation is separate; no MWaddition inferred. Existing industrial zoning, study activity and grant-related work are not final development/interconnection approval or awarded incentives. Investment, construction timeline and engineering details are explicitly pending.2014 coal-plant decommissioning is not newDCopening. Strategic developer agreement is not an executed tenant lease or utility ESA; TRONname does not independently identify a blockchain affiliate or crypto workload.", "Later original decisions and observed outcomes take precedence; future events have no assumed result.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://berksweekly.com/news/titus-station-redevelopment-project-in-berks-county-planned-as-ai-infrastructure-campus/", "host": "berksweekly.com", "date": "2026-05-19", "published": "2026-05-19", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Reading · Berks · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42011" } }, { "id": "wildcat-ridge-archbald-lackawanna-county-pa", "state": "pa", "kind": "facility", "name": "Wildcat Ridge AI Data Center Campus", "group": "proposed", "status": "Agency listed proposal", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Lackawanna" ], "city": "Archbald", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Original reporter/issuer named-project context, with inference and stages explicit.. KatBolus WVIA April22,2026 originalPPLopenhouseinterviews/recordwork. Tribune/ErcorTriboro548acre/17.5MJunepropertypurchase/4buildingindustrial2027targetnotpaidDCcapexorITload. Map-basedinferenceconnectssite toPPLproject; utilityREFUSESnamingcustomers. No confirmedexactcustomerESA ornewparcelpin.10yearLERTAclaimnotabatementamount/receivedcash. PPLworksplanningindependentlyofcustomerlocalapprovals;2029/early2030transmissiontargetconditionalonPUC/permits, notDCcommissioning. Dedicatedcustomerfacilitiespaidbycustomer whileREGIONALRELIABILITYupgradesratebased, so no blankettaxpayer-freeclaim. WildcatRidgeexplicitconditional-useprocess/May14historicalhearing; notfinalapproval. Othercampushearing/datesnotfutureOctobercalendar. PPLroute notselectedatAprilmeeting. Plans/historicalchanges/courtallegations/utilitycustomerinference not all-field,siteITorcurrentoperatingcertification.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.wvia.org/news/local/2026-04-22/ppl-electric-utilities-confirms-data-centers-spurred-transmission-project-in-lackawanna-county", "host": "wvia.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 41.39016, "lng": -75.63327, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "national-withdrawals-power-redesign-and-review-stage-round79-2026-10-15.json", "scope": "Original reporter/issuer named-project context, with inference and stages explicit.", "fields": {}, "notes": [ "KatBolus WVIA April22,2026 originalPPLopenhouseinterviews/recordwork. Tribune/ErcorTriboro548acre/17.5MJunepropertypurchase/4buildingindustrial2027targetnotpaidDCcapexorITload. Map-basedinferenceconnectssite toPPLproject; utilityREFUSESnamingcustomers. No confirmedexactcustomerESA ornewparcelpin.10yearLERTAclaimnotabatementamount/receivedcash.", "PPLworksplanningindependentlyofcustomerlocalapprovals;2029/early2030transmissiontargetconditionalonPUC/permits, notDCcommissioning. Dedicatedcustomerfacilitiespaidbycustomer whileREGIONALRELIABILITYupgradesratebased, so no blankettaxpayer-freeclaim. WildcatRidgeexplicitconditional-useprocess/May14historicalhearing; notfinalapproval. Othercampushearing/datesnotfutureOctobercalendar. PPLroute notselectedatAprilmeeting.", "Plans/historicalchanges/courtallegations/utilitycustomerinference not all-field,siteITorcurrentoperatingcertification." ], "sources": [ { "url": "https://www.wvia.org/news/local/2026-04-22/ppl-electric-utilities-confirms-data-centers-spurred-transmission-project-in-lackawanna-county", "host": "wvia.org", "date": "", "published": "", "checked": "2026-10-15", "date_kind": "publication date not established", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 29", "scope": "The DEP row explicitly names Wildcat Ridge and Pine Line in Archbald. A named proposal and its current tracker account do not establish current construction or a power delivery milestone. The original DEP project CSV lists the named project as proposed with no applications received in that tracker account. This does not establish absence of every municipal or other agency application. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "fields": { "current_stage_evidence": { "outcome": "exact_named_dep_proposal_account_not_physical_commissioning", "scope": "The DEP row explicitly names Wildcat Ridge and Pine Line in Archbald. A named proposal and its current tracker account do not establish current construction or a power delivery milestone. The original DEP project CSV lists the named project as proposed with no applications received in that tracker account. This does not establish absence of every municipal or other agency application. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged." }, "tracker_scope": { "project_id": "10000027", "original_project_and_related_permit_csv_read": true, "no_data_center_operation_inferred": true, "no_coordinate_or_role_promotion": true } }, "notes": [ "The DEP row explicitly names Wildcat Ridge and Pine Line in Archbald. A named proposal and its current tracker account do not establish current construction or a power delivery milestone. The original DEP project CSV lists the named project as proposed with no applications received in that tracker account. This does not establish absence of every municipal or other agency application. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": false, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Archbald · Lackawanna · Source context reviewed", "status_scope": "The DEP row explicitly names Wildcat Ridge and Pine Line in Archbald. A named proposal and its current tracker account do not establish current construction or a power delivery milestone. The original DEP project CSV lists the named project as proposed with no applications received in that tracker account. This does not establish absence of every municipal or other agency application. The scoped label describes the documented proposal or permit account, not physical operation. Submission dates do not become issuance or construction dates. Existing corporate roles, legal identity, technical quantities and location references remain unchanged.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42069" } }, { "id": "ecp-york-2-energy-center-data-center-peach-bottom-york-pa", "state": "pa", "kind": "facility", "name": "York 2 Energy Center Data Center", "group": "unknown", "status": "Status unclear", "raw_status": "", "status_field": "", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "York" ], "city": "Peach Bottom Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.. The proposed five-billion-USD project and 2,500 construction jobs are forecasts. The power station's 828 MW generation is not data-center IT. The article's much smaller statewide investment figure is inconsistent and excluded. Current original approvals, disclosures and later outcomes take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.cpbj.com/5b-data-center-coming-to-york-county-energy-site/", "host": "cpbj.com", "date": "2025-07-21", "published": "2025-07-21", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://www.peachbottomtownship.org/2000-2", "host": "www.peachbottomtownship.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 39.91997, "lng": -76.72621, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round26-2026-10-14.json", "scope": "Personally read named-source context; historical/proposed figures stay attributed. No whole-record certification.", "fields": { "reported_context": "Central Penn Business Journal reports an ECP plan for a data center at Calpine's York 2 Energy Center in Peach Bottom.", "independently_verified_current_operating_status": null }, "notes": [ "The proposed five-billion-USD project and 2,500 construction jobs are forecasts. The power station's 828 MW generation is not data-center IT. The article's much smaller statewide investment figure is inconsistent and excluded.", "Current original approvals, disclosures and later outcomes take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.cpbj.com/5b-data-center-coming-to-york-county-energy-site/", "host": "cpbj.com", "date": "2025-07-21", "published": "2025-07-21", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 64", "scope": "The complete original Township page labels its May 21, 2026 data center ordinance a draft, says it was submitted for County review and expressly says no final action has been taken. This is a municipal policy account rather than an exact York 2 computing project disposition. A working gas power plant is not commissioned computing, and a draft ordinance does not establish approval, current construction or a legal prohibition. The linked complete draft remains unread.", "fields": { "current_stage_evidence": { "outcome": "original_township_policy_draft_exact_york2_stage_held", "scope": "The complete original Township page labels its May 21, 2026 data center ordinance a draft, says it was submitted for County review and expressly says no final action has been taken. This is a municipal policy account rather than an exact York 2 computing project disposition. A working gas power plant is not commissioned computing, and a draft ordinance does not establish approval, current construction or a legal prohibition. The linked complete draft remains unread." }, "source_read_scope": { "complete_original_draft_notice_body_read": true, "linked_full_draft_unread": true, "power_generation_not_computing_operation": true } }, "notes": [ "The complete original Township page labels its May 21, 2026 data center ordinance a draft, says it was submitted for County review and expressly says no final action has been taken. This is a municipal policy account rather than an exact York 2 computing project disposition. A working gas power plant is not commissioned computing, and a draft ordinance does not establish approval, current construction or a legal prohibition. The linked complete draft remains unread.", "Existing location, jurisdiction, provider roles, identities, quantities and physical opening dates remain unchanged. Administrative evidence and prospective dates do not certify computing operation." ], "sources": [ { "url": "https://www.peachbottomtownship.org/2000-2", "host": "www.peachbottomtownship.org", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "Peach Bottom Township · York · Source context reviewed", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42133" } }, { "id": "cnx-zediker-station-south-strabane-washington-county-pa", "state": "pa", "kind": "facility", "name": "Zediker Station Data Center Site", "group": "proposed", "status": "Project listed development", "raw_status": "proposed", "status_field": "current_status", "crypto": false, "type": "Data center (inventory classification)", "counties": [ "Washington" ], "city": "South Strabane Township", "address": "", "who": "", "end_user": "", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Manual source context is available for this inherited inventory record. The inventory label and approximate geography are retained for discovery. This is not certification of current operation, ownership, a separate physical building, technical capacity or a precise parcel. Missing fields remain unknown. Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.. Marketing release dateOct24 differs body datelineOct20. Generation is not critical IT; net-zero claim is broker/fuel-accounting assertion, not audited emissions. Available industrial site is not an operating data center. Subsequent original decisions and current operator disclosures take precedence. Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building.", "date": "", "events": [], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.jll.com/en-us/newsroom/jll-announces-major-data-center-development-site-in-washington", "host": "jll.com", "date": "2025-10-24", "published": "2025-10-24", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" } ], "loc": { "lat": 40.18942, "lng": -80.24855, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "reviewed_evidence": [ { "overlay": "regional-development-review-round24-2026-10-14.json", "scope": "Named content personally reviewed; no whole-record certification. Dates and forecasts remain source-specific.", "fields": { "reported_context": "JLL markets CNX Zediker Station1500-acre property with400buildable acres and potential500to700MW gas generation.", "independently_verified_current_operating_status": null }, "notes": [ "Marketing release dateOct24 differs body datelineOct20. Generation is not critical IT; net-zero claim is broker/fuel-accounting assertion, not audited emissions. Available industrial site is not an operating data center.", "Subsequent original decisions and current operator disclosures take precedence.", "Fields can apply to shared campus, regional or historical context; consult source review before assigning to a building." ], "sources": [ { "url": "https://www.jll.com/en-us/newsroom/jll-announces-major-data-center-development-site-in-washington", "host": "jll.com", "date": "2025-10-24", "published": "2025-10-24", "checked": "2026-10-14", "date_kind": "publication", "label": "Reviewed source" } ], "whole_record_certified": false }, { "overlay": "Codex 3 research cohort 28", "scope": "JLL describes marketing Zediker Station for future data center development. DEP original project CSV identifies the named CNX project 10000057 as proposed with no applications received in that tracker account and an approximate location classification. Proposed is limited to this marketed development account, not delivered carbon neutral power, a lease, physical construction or current computing service. The JLL page header says October 24, 2025 while its dateline says October 20; neither becomes an exact physical milestone here. Source coordinates, ownership assertions, roles and technical quantities are not promoted.", "fields": { "current_stage_evidence": { "outcome": "current_named_market_listing_and_bounded_dep_proposal_account", "scope": "JLL describes marketing Zediker Station for future data center development. DEP original project CSV identifies the named CNX project 10000057 as proposed with no applications received in that tracker account and an approximate location classification. Proposed is limited to this marketed development account, not delivered carbon neutral power, a lease, physical construction or current computing service. The JLL page header says October 24, 2025 while its dateline says October 20; neither becomes an exact physical milestone here. Source coordinates, ownership assertions, roles and technical quantities are not promoted." } }, "notes": [ "JLL describes marketing Zediker Station for future data center development. DEP original project CSV identifies the named CNX project 10000057 as proposed with no applications received in that tracker account and an approximate location classification. Proposed is limited to this marketed development account, not delivered carbon neutral power, a lease, physical construction or current computing service. The JLL page header says October 24, 2025 while its dateline says October 20; neither becomes an exact physical milestone here. Source coordinates, ownership assertions, roles and technical quantities are not promoted.", "The review preserves existing identity, roles, locations, jurisdictions, quantities and physical opening fields. Source publication, checked dates and physical milestones remain distinct." ], "sources": [ { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterProjectTrackingAllProjects.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://gis.dep.pa.gov/DataCenterPermitTracker/static/DataCenterPermitTracking.csv", "host": "gis.dep.pa.gov", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed government record" }, { "url": "https://www.jll.com/en-us/newsroom/jll-announces-major-data-center-development-site-in-washington", "host": "www.jll.com", "published": "", "date": "", "checked": "2026-10-23", "label": "Reviewed operator source" } ], "checked": "2026-10-23", "whole_record_certified": false } ], "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": true, "precision_label": "Exact site not published; shown at county level", "summary": "South Strabane Township · Washington · Source context reviewed", "status_scope": "JLL describes marketing Zediker Station for future data center development. DEP original project CSV identifies the named CNX project 10000057 as proposed with no applications received in that tracker account and an approximate location classification. Proposed is limited to this marketed development account, not delivered carbon neutral power, a lease, physical construction or current computing service. The JLL page header says October 24, 2025 while its dateline says October 20; neither becomes an exact physical milestone here. Source coordinates, ownership assertions, roles and technical quantities are not promoted.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "withheld_unreviewed_point", "scope": "The available point evidence does not establish a supported site location. No site pin, nearby distance or aerial destination is published. The original coordinate and its provenance remain in research history.", "county_display": "42125" } }, { "id": "tierpoint-bethlehem-pa", "state": "pa", "kind": "facility", "name": "TierPoint Bethlehem", "group": "operating", "status": "Operator listed colocation service", "crypto": false, "type": "Colocation", "counties": [ "Northampton" ], "city": "Bethlehem", "address": "3864 Courtney Street, Suite 130, Bethlehem, PA 18017", "who": "TierPoint", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Operator listed colocation service. County level map context. Technical performance and whole campus delivery remain unverified.", "date": "", "events": [ [ "2026-10-24", "Added to the atlas. Admission date, not an opening or construction milestone." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/bethlehem/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Operator facility listing" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3864+Courtney+Street%2C+Suite+130%2C+Bethlehem%2C+PA+18017&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Census county context only" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3864+Courtney+Street%2C+Ste+130%2C+Bethlehem%2C+PA+18017&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete literal computing street query, interpolated reference only" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-75.38252816439079%2C40.666729288537546%2C-75.3694998356092%2C40.67661071146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "loc": { "lng": -75.376014, "lat": 40.67167, "precision": "address", "basis": "Original operator reported street 3864 Courtney Street, Ste 130, Bethlehem, PA 18017 matched through the complete literal Census query. The retained original operator version explicitly names this computing facility and complete street. The later direct request returned HTTP 403, preserved separately. No fresh successful retrieval is claimed. Calculated street reference only, never a tenant floor, suite, present operation or roof. No roof, tenant floor, title, present operation or complete campus is certified. Imagery acquisition date is unknown and may predate construction." }, "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": false, "precision_label": "Calculated street reference, not a roof or tenant floor", "summary": "Bethlehem operator listing. County level map context.", "reviewed_evidence": [ { "overlay": "Codex 5 discovery cohort 1", "scope": "TierPoint currently lists colocation service at the named facility and published address. Operator reported service context checked October 24, 2026. Whole campus completion, occupancy, measured performance and opening day remain unverified.", "fields": { "operator_reported_service": { "provider": "TierPoint", "name": "TierPoint Bethlehem", "address": "3864 Courtney Street, Suite 130, Bethlehem, PA 18017", "scope": "TierPoint currently lists colocation service at the named facility and published address. Operator reported service context checked October 24, 2026. Whole campus completion, occupancy, measured performance and opening day remain unverified." }, "county_association": { "county": "Northampton", "county_fips": "42095", "scope": "Census matched 3864 COURTNEY ST, BETHLEHEM, PA, 18017. Only county context is adopted. No point, parcel, roof, street spelling, ZIP correction or legal municipality is adopted." }, "atlas_added_event": { "kind": "atlas_added", "date": "2026-10-24", "scope": "Atlas admission date only. Not publication, opening or construction." } }, "notes": [ "Census matched 3864 COURTNEY ST, BETHLEHEM, PA, 18017. Only county context is adopted. No point, parcel, roof, street spelling, ZIP correction or legal municipality is adopted.", "Publication date is unknown. Advertised capacity, area, uptime and security claims are excluded." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/bethlehem/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Operator facility listing" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3864+Courtney+Street%2C+Suite+130%2C+Bethlehem%2C+PA+18017&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Census county context only" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 75, 2026-10-24", "scope": "The retained original operator version explicitly names this computing facility and complete street. The later direct request returned HTTP 403, preserved separately. No fresh successful retrieval is claimed. Calculated street reference only, never a tenant floor, suite, present operation or roof. All inherited discovery facts, exact source history, county wrappers, quantities, roles and physical stages remain unchanged. Unresolved legacy identity and physical site counting eligibility remain unchanged.", "fields": { "location_review_decision": { "location": { "lng": -75.376014, "lat": 40.67167, "precision": "address", "basis": "Original operator reported street 3864 Courtney Street, Ste 130, Bethlehem, PA 18017 matched through the complete literal Census query. The retained original operator version explicitly names this computing facility and complete street. The later direct request returned HTTP 403, preserved separately. No fresh successful retrieval is claimed. Calculated street reference only, never a tenant floor, suite, present operation or roof. No roof, tenant floor, title, present operation or complete campus is certified. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "3864 Courtney Street, Ste 130, Bethlehem, PA 18017", "county_fips": [ "42095" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The retained original operator version explicitly names this computing facility and complete street. The later direct request returned HTTP 403, preserved separately. No fresh successful retrieval is claimed. Calculated street reference only, never a tenant floor, suite, present operation or roof. All inherited discovery facts, exact source history, county wrappers, quantities, roles and physical stages remain unchanged. Unresolved legacy identity and physical site counting eligibility remain unchanged.", "The original Native location is null, so a prior point offset cannot be calculated and remains unknown. This source review supplies the first independently qualified location reference for this existing record. The retained original operator version explicitly names this computing facility and complete street. The later direct request returned HTTP 403, preserved separately. No fresh successful retrieval is claimed. Calculated street reference only, never a tenant floor, suite, present operation or roof. The complete literal Census input and independently calculated reference agree with the unchanged retained county 42095. This is no claim of physical relocation.", "Industrial blocks, parking, roads, open ground and a wooded corridor occupy the frame. Suite 130 is not selected. Source setting only. Acquisition date is unknown and may predate construction. No pixel supplies coordinates, a computing roof, current stage, room, suite, ownership or full campus boundary." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/bethlehem/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original operator named computing street, source scope retained" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3864+Courtney+Street%2C+Ste+130%2C+Bethlehem%2C+PA+18017&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete literal computing street query, interpolated reference only" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-75.38252816439079%2C40.666729288537546%2C-75.3694998356092%2C40.67661071146245&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "raw_status": "partly operating", "status_field": "current_status", "status_scope": "TierPoint currently lists colocation service at the named facility and published address. Operator reported service context checked October 24, 2026. Whole campus completion, occupancy, measured performance and opening day remain unverified." }, { "id": "tierpoint-lehigh-valley-pa", "state": "pa", "kind": "facility", "name": "TierPoint Lehigh Valley", "group": "operating", "status": "Operator listed colocation service", "crypto": false, "type": "Colocation", "counties": [ "Northampton" ], "city": "Bethlehem", "address": "3949 Schelden Circle, Bethlehem, PA 18017", "who": "TierPoint", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Operator listed colocation service. County level map context. Technical performance and whole campus delivery remain unverified.", "date": "", "events": [ [ "2026-10-24", "Added to the atlas. Admission date, not an opening or construction milestone." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/lehigh-valley/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Operator facility listing" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3949+Schelden+Circle%2C+Bethlehem%2C+PA+18017&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Census county context only" } ], "loc": { "lat": 40.72417, "lng": -75.30482, "precision": "county", "basis": "Shown at county level only. The dot is placed inside the county for the map and is not the site, its address or a parcel." }, "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": false, "precision_label": "Exact site not published; shown at county level", "summary": "Bethlehem operator listing. County level map context.", "reviewed_evidence": [ { "overlay": "Codex 5 discovery cohort 1", "scope": "TierPoint currently lists colocation service at the named facility and published address. Operator reported service context checked October 24, 2026. Whole campus completion, occupancy, measured performance and opening day remain unverified.", "fields": { "operator_reported_service": { "provider": "TierPoint", "name": "TierPoint Lehigh Valley", "address": "3949 Schelden Circle, Bethlehem, PA 18017", "scope": "TierPoint currently lists colocation service at the named facility and published address. Operator reported service context checked October 24, 2026. Whole campus completion, occupancy, measured performance and opening day remain unverified." }, "county_association": { "county": "Northampton", "county_fips": "42095", "scope": "Census matched 3949 SCHELDON CIR, BETHLEHEM, PA, 18017. Only county context is adopted. No point, parcel, roof, street spelling, ZIP correction or legal municipality is adopted. Operator Schelden and Census Sheldon spellings remain distinct." }, "atlas_added_event": { "kind": "atlas_added", "date": "2026-10-24", "scope": "Atlas admission date only. Not publication, opening or construction." } }, "notes": [ "Census matched 3949 SCHELDON CIR, BETHLEHEM, PA, 18017. Only county context is adopted. No point, parcel, roof, street spelling, ZIP correction or legal municipality is adopted. Operator Schelden and Census Sheldon spellings remain distinct.", "Publication date is unknown. Advertised capacity, area, uptime and security claims are excluded." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/lehigh-valley/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Operator facility listing" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=3949+Schelden+Circle%2C+Bethlehem%2C+PA+18017&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Census county context only" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "raw_status": "partly operating", "status_field": "current_status", "status_scope": "TierPoint currently lists colocation service at the named facility and published address. Operator reported service context checked October 24, 2026. Whole campus completion, occupancy, measured performance and opening day remain unverified.", "location_display": { "policy": "reviewed-map-references-2026-10-23", "decision": "no_site_point", "county_display": "42095" } }, { "id": "tierpoint-philadelphia-pa", "state": "pa", "kind": "facility", "name": "TierPoint Philadelphia", "group": "operating", "status": "Operator listed colocation service", "crypto": false, "type": "Colocation", "counties": [ "Philadelphia" ], "city": "Philadelphia", "address": "4775 League Island Boulevard, Philadelphia, PA 19112", "who": "TierPoint", "mw": null, "power": "", "power_note": "", "investment": "", "jobs": "", "acres": null, "utility": "", "water": "", "incentives": "", "note": "Operator listed colocation service. County level map context. Technical performance and whole campus delivery remain unverified.", "date": "", "events": [ [ "2026-10-24", "Added to the atlas. Admission date, not an opening or construction milestone." ] ], "timeline": [], "opened": "", "tier": "", "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/philadelphia/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Operator facility listing" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=4775+League+Island+Boulevard%2C+Philadelphia%2C+PA+19112&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Census county context only" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-75.1729854978408%2C39.88738628853755%2C-75.1601065021592%2C39.897267711462455&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "loc": { "lng": -75.166546, "lat": 39.892327, "precision": "address", "basis": "Original operator reported street 4775 League Island Boulevard, Philadelphia, PA 19112 matched through the complete literal Census query. The retained original operator version explicitly names this computing facility and complete street. The later direct request returned HTTP 403, preserved separately. No fresh successful retrieval is claimed. Calculated street reference only, never a tenant floor, suite, present operation or roof. No roof, tenant floor, title, present operation or complete campus is certified. Imagery acquisition date is unknown and may predate construction." }, "manual_source_reviewed": true, "whole_record_certified": false, "field_evidence_present": true, "inventory_label_retained": false, "precision_label": "Calculated street reference, not a roof or tenant floor", "summary": "Philadelphia operator listing. County level map context.", "reviewed_evidence": [ { "overlay": "Codex 5 discovery cohort 1", "scope": "TierPoint currently lists colocation service at the named facility and published address. Operator reported service context checked October 24, 2026. Whole campus completion, occupancy, measured performance and opening day remain unverified.", "fields": { "operator_reported_service": { "provider": "TierPoint", "name": "TierPoint Philadelphia", "address": "4775 League Island Boulevard, Philadelphia, PA 19112", "scope": "TierPoint currently lists colocation service at the named facility and published address. Operator reported service context checked October 24, 2026. Whole campus completion, occupancy, measured performance and opening day remain unverified." }, "county_association": { "county": "Philadelphia", "county_fips": "42101", "scope": "Census matched 4775 LEAGUE ISLAND BLVD, PHILADELPHIA, PA, 19112. Only county context is adopted. No point, parcel, roof, street spelling, ZIP correction or legal municipality is adopted." }, "atlas_added_event": { "kind": "atlas_added", "date": "2026-10-24", "scope": "Atlas admission date only. Not publication, opening or construction." } }, "notes": [ "Census matched 4775 LEAGUE ISLAND BLVD, PHILADELPHIA, PA, 19112. Only county context is adopted. No point, parcel, roof, street spelling, ZIP correction or legal municipality is adopted.", "Publication date is unknown. Advertised capacity, area, uptime and security claims are excluded." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/philadelphia/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Operator facility listing" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=4775+League+Island+Boulevard%2C+Philadelphia%2C+PA+19112&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Census county context only" } ], "checked": "2026-10-24", "whole_record_certified": false }, { "overlay": "Codex 2 location cohort 75, 2026-10-24", "scope": "The retained original operator version explicitly names this computing facility and complete street. The later direct request returned HTTP 403, preserved separately. No fresh successful retrieval is claimed. Calculated street reference only, never a tenant floor, suite, present operation or roof. All inherited discovery facts, exact source history, county wrappers, quantities, roles and physical stages remain unchanged. Unresolved legacy identity and physical site counting eligibility remain unchanged.", "fields": { "location_review_decision": { "location": { "lng": -75.166546, "lat": 39.892327, "precision": "address", "basis": "Original operator reported street 4775 League Island Boulevard, Philadelphia, PA 19112 matched through the complete literal Census query. The retained original operator version explicitly names this computing facility and complete street. The later direct request returned HTTP 403, preserved separately. No fresh successful retrieval is claimed. Calculated street reference only, never a tenant floor, suite, present operation or roof. No roof, tenant floor, title, present operation or complete campus is certified. Imagery acquisition date is unknown and may predate construction." }, "reference_method": "Census interpolated street address", "published_address": "4775 League Island Boulevard, Philadelphia, PA 19112", "county_fips": [ "42101" ], "operator_coordinates_adopted": false, "corporate_address_adopted": false } }, "notes": [ "The retained original operator version explicitly names this computing facility and complete street. The later direct request returned HTTP 403, preserved separately. No fresh successful retrieval is claimed. Calculated street reference only, never a tenant floor, suite, present operation or roof. All inherited discovery facts, exact source history, county wrappers, quantities, roles and physical stages remain unchanged. Unresolved legacy identity and physical site counting eligibility remain unchanged.", "The original Native location is null, so a prior point offset cannot be calculated and remains unknown. This source review supplies the first independently qualified location reference for this existing record. The retained original operator version explicitly names this computing facility and complete street. The later direct request returned HTTP 403, preserved separately. No fresh successful retrieval is claimed. Calculated street reference only, never a tenant floor, suite, present operation or roof. The complete literal Census input and independently calculated reference agree with the unchanged retained county 42101. This is no claim of physical relocation.", "Large industrial buildings, access roads, parking and extensive open or wooded ground occupy the frame. Source setting only. Acquisition date is unknown and may predate construction. No pixel supplies coordinates, a computing roof, current stage, room, suite, ownership or full campus boundary." ], "sources": [ { "url": "https://www.tierpoint.com/data-centers/pennsylvania/philadelphia/", "host": "www.tierpoint.com", "published": "", "date": "", "checked": "2026-10-24", "label": "Original operator named computing street, source scope retained" }, { "url": "https://geocoding.geo.census.gov/geocoder/geographies/onelineaddress?address=4775+League+Island+Boulevard%2C+Philadelphia%2C+PA+19112&benchmark=Public_AR_Current&vintage=Current_Current&format=json", "host": "geocoding.geo.census.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Complete literal computing street query, interpolated reference only" }, { "url": "https://imagery.nationalmap.gov/arcgis/rest/services/USGSNAIPPlus/ImageServer/exportImage?bbox=-75.1729854978408%2C39.88738628853755%2C-75.1601065021592%2C39.897267711462455&bboxSR=4326&imageSR=3857&size=600%2C600&format=png&f=image", "host": "imagery.nationalmap.gov", "published": "", "date": "", "checked": "2026-10-24", "label": "Actually viewed source setting, acquisition date unknown" } ], "checked": "2026-10-24", "whole_record_certified": false } ], "raw_status": "partly operating", "status_field": "current_status", "status_scope": "TierPoint currently lists colocation service at the named facility and published address. Operator reported service context checked October 24, 2026. Whole campus completion, occupancy, measured performance and opening day remain unverified." } ], "compilation_license": "withheld_pending_owner_decision" }